Commit graph

295 commits

Author SHA1 Message Date
Alexander Koblov
5988dea577 ADD: Feature [0001254] Hidden files: Show with half-transparent icons 2018-07-22 15:02:30 +00:00
Alexander Koblov
42422703f1 FIX: Editor option name 2018-07-04 20:44:20 +00:00
Alexander Koblov
f93ed6960c ADD: Editor - additional options 2018-07-03 21:55:12 +00:00
Alexander Koblov
145f1e0cb4 ADD: Editor - Delete trailing spaces option 2018-07-02 20:24:48 +00:00
Alexander Koblov
ad802823c9 FIX: Change path label font 2018-06-28 18:46:46 +00:00
Denis Bisson
9f2d669def FIX: In archiver configuration, clear from memory temporary structure that was not freed.
CHG: In archiver configuration, when adding a new one, make the new one enabled and make us ready to configure it.
2018-06-19 01:21:27 +00:00
Denis Bisson
f2c7a65aa9 FIX: Change the tab order sequence between controls in the archiver configuration so it is better ordered from top to bottom. 2018-06-16 04:26:54 +00:00
Denis Bisson
590341aa63 FIX: Workaround for problem under Linux/gtk2 when cycling between tabs in archiver configuration.
UPD: Updated language file for minimal effect with above mentionned modification.
2018-06-16 04:08:07 +00:00
Denis Bisson
21e0a429dd ADD: Improvement in user interface regarding the configuration of archivers.
ADD: When attempting to quit configuration of archivers with unsaved modification, we're now prompt to save or not.
ADD: When disabling an archiver configuration, the whole setting turn gray.
ADD: We may now start a new archiver configuration by copying an existing one.
ADD: We may now import/export configuration or archivers.
ADD: We may now sort the archivers in the configuration.
ADD: Function enable/disable all the archivers at once.
ADD: New internal command "cm_ConfigArchivers".
ADD: When importing/export toolbar to TC, there is now an translation between "cm_ConfigArchivers" and "cm_PackerConfig".
ADD: Little variable reminder helper in popup menu for commands and parameters.
UPD: Language file regenerated. Minimal impact with above modification since existing translation have been re-used, with no additional "Fuzzy".
UPD: French language translation back 100% done.
2018-06-14 01:09:23 +00:00
Alexander Koblov
9c1f45eae6 DEL: Wrong hint 2018-05-21 19:37:05 +00:00
Alexander Koblov
d35ec63719 UPD: Select file by click on icon (options dialog) 2018-03-31 19:09:31 +00:00
Alexander Koblov
7967e52d08 ADD: Select file by click on icon (options dialog) 2018-03-31 17:37:33 +00:00
Alexander Koblov
5f217d22fb ADD: Load highlighters from user directory 2018-03-31 12:03:08 +00:00
Alexander Koblov
bc40cf3a5d FIX: Remove incorrect hint 2018-03-18 09:05:39 +00:00
Alexander Koblov
37430837e8 FIX: Bug [0001931] Misleading tooltip to quote files and paths in the File Associations dialog 2018-02-23 08:38:17 +00:00
Alexander Koblov
75c1c93617 ADD: Show error when cannot load wlx-plugin 2017-12-25 19:20:59 +00:00
cordylus
5b1ee46e95 ADD: Feature [0001595] Shift with up/down arrow to select items during quick search 2017-12-19 21:02:44 +00:00
cordylus
842335151c FIX: Bug [0001965] "Cannot focus a disabled or invisible window" when clicking on "Folder with wrench" buttons 2017-12-18 00:01:34 +00:00
Alexander Koblov
9805ccfb01 FIX: Incorrect visible panel under GTK2 2017-10-01 08:08:22 +00:00
Alexander Koblov
7aca055812 FIX: Access violation 2017-09-30 17:16:25 +00:00
Alexander Koblov
bcfa97c129 FIX: Fill correct title 2017-09-22 10:51:58 +00:00
Alexander Koblov
bdbaa974cd FIX: Various spelling and grammar errors reported by Lintian (patch by Graham Inggs) 2017-09-22 08:26:33 +00:00
Alexander Koblov
af8a9eb0ee FIX: Access violation 2017-09-20 18:04:03 +00:00
Alexander Koblov
a6204fc16b ADD: Show UNIX attributes in octal mode 2017-09-19 19:29:40 +00:00
Alexander Koblov
8bc56b41f2 ADD: Configure custom columns for Wfx plugins 2017-09-19 16:44:28 +00:00
Denis Bisson
f8d1921d36 FIX: In the "Directory Hotlist" configuration window, stop moving the cursor for the user when clicking on the button in top right that make appear popup menu. 2017-07-12 02:47:04 +00:00
Alexander Koblov
43ecd4d578 FIX: Display correct console font size 2017-07-10 15:04:32 +00:00
Alexander Koblov
97c4c6a68d FIX: Set console font name 2017-07-10 14:53:20 +00:00
Denis Bisson
c655d7242f FIX: When directory hotlist was empty AND we were accessing directory hotlist configuration indirectly, like accessing Configuration > Option and then select the Directory Hotlist in the configuration tree on left, Directory Hotlist configuration windows was still showing path and target path controls... This was incorrect since no entry were selected in the tree at that moment. This has been fixed.
CHG: It should not happen, but if by an unexpected manipulation we would be able to access popup menu helper for path and target, it won't cause an exception error any more since the pop-up menu won't even be displayed in these circumstances.
2017-07-08 01:04:33 +00:00
Denis Bisson
63b667fe27 CHG: In "Hot Directory", Most of the action are now actually a "TAction" from an "TActionList" instead of being simply from a "TPopupMenu". This way, the keyboard shortcut for them is working even if the focus is not on the TreeView like it was before.
ADD: In "Hot Directory", Previous modification now allow to have user stay with focus in the edit boxes of the "Name", "Path" and "Target" ready to type and still being able to use keyboard shortcut to move into the treelist. This speed up the periodic clean up we may do monthly for example without having to keep clicking in the treeview and going back and forth in the edit boxes at the bottom.
ADD: In "Hot Directory", Add many accelerator keys for accessing bottom edit boxes, to have the popup of the buttons in top right, etc. This way, user may access and do actions faster keeping his hands on the keyboard.
CHG: In "Hot Directory", When editing the name of a directory hotlist entry name, the name in the tree is updated as we type. No need any more to switch to a new entry to see the entry updated.
ADD: In "Hot Directory", after a scan to validate the existence of the pointed directories, the focus in the three will be move to the first unfound one, immediately ready to have the situation fixed.
ADD: In "Hot Directory", after importing entries from another .hotlist file for example, the focus at the end will be on the last imported entry.
CHG: In "Hot Directory", after inserting/adding a new branches, the focus is now on the node instead of the dummy new entry inside the node. It's more logical since we're ready to name the new wanted created branch.
FIX: In "Hot Directory", when inserting or adding a new entry based on the current path of panels, it will now include file source in the name. This will be mainly noticeable in Linux when using current panel location is "smb://tera-15/openshare01/Backup" for example.
2017-06-27 01:51:48 +00:00
Alexander Koblov
a5799280f7 ADD: Feature [0001769] Escape to cancel editing of fields in Custom columns settings (patch by cordylus) 2017-06-12 07:48:19 +00:00
Denis Bisson
a46bad4c9c CHG: Rewrite the importation of TC toolbar to make it simpler and faster (work with DCXmlConfig instead of playing directly with DC toolbars). 2017-06-02 11:42:26 +00:00
Denis Bisson
fd46cfbdf0 FIX: Was crashing 9 times on 10 in Linux/Ubuntu, in "Toolbar" configuration, when doing the "Other... -> Add toolbar with all DC commands".
ADD: "DCGetNewGUID" function in "uDCUtils" to get a unique ID number (used in "fOptionsToolbar" and "ufavoritetabs").
CHG: Languages files changed because of the addition of a forgotten message
2017-06-01 00:10:50 +00:00
Alexander Koblov
1ee0407262 ADD: Choose icon theme 2017-05-01 10:45:37 +00:00
Alexander Koblov
3182c219da UPD: Show used directories in configuration 2017-05-01 09:17:46 +00:00
Alexander Koblov
6edfe2b91a ADD: Show DC directories 2017-04-30 13:05:14 +00:00
Alexander Koblov
c20aefc5a2 ADD: Feature [0000194] Extend filenames without extension to the max 2017-04-16 11:30:19 +00:00
Alexander Koblov
44fbd8f669 UPD: Enable exif-wdx plugin 2017-04-02 10:08:25 +00:00
Alexander Koblov
22ce842ac0 UPD: Change disk icon size without restart 2017-03-11 20:11:46 +00:00
Alexander Koblov
5c35a4faae FIX: Bug [0001475] 22x22 should be 24x24 #2 2017-03-11 17:31:12 +00:00
Alexander Koblov
dbafc3e595 UPD: Icons - better high-DPI support 2017-03-11 10:40:44 +00:00
Alexander Koblov
e5e56550a5 ADD: Capability to choose disk icons size 2017-03-11 09:01:59 +00:00
Alexander Koblov
1447ba68d8 UPD: Use tree view in highlighter options 2017-03-05 12:35:30 +00:00
Alexander Koblov
34bab6f64c UPD: Don't show TSynUniHighlighter in options 2017-02-25 13:48:06 +00:00
Alexander Koblov
0001aeb611 UPD: Clean up - drop doublecmd.ini support 2017-01-29 17:20:21 +00:00
Alexander Koblov
fba4ae356c UPD: Max value 2017-01-21 21:01:54 +00:00
Alexander Koblov
a6c2402833 ADD: Feature [0001631] 2017-01-21 20:58:52 +00:00
Denis Bisson
c56d1af98e ADD: In windows, we may now import internal command from TC toolbar to an equivalent DC internal command requiring a parameter to be equivalent.
FIX: In windows, the TC internal commands "cm_ShrinkSelection" and "cm_ClearAll" are not imported to a better equivalence since we may now set parameter for internal command "cm_MarkMinus" and "cm_MarkUnmarkAll".
ADD: In windows, we may now import correctly additional 22 TC internal commands. These TC internal commands are cm_SelectCurrentName, cm_UnselectCurrentName, cm_SelectCurrentNameExt, cm_UnselectCurrentNameExt, cm_SelectCurrentPath, cm_UnselectCurrentPath, cm_SelectBoth, cm_SelectFiles, cm_SelectFolders, cm_ClearFiles, cm_ClearFolders, cm_ClearSelCfg, cm_ClearAllFiles, cm_SelectAllFolders, cm_ClearAllCfg, cm_ExchangeSelBoth, cm_ExchangeSelFiles, cm_ExchangeSelFolders, cm_SelectAllBoth, cm_SelectAllFiles, cm_SelectAllFolders and cm_ConfigSaveSettings.
FIX: In Windows, fix a little display problem when we import tool bar from TC to a new created toolbar. This toolbar was not created but not displayed. Now it is.
DEL: Remove annoying "New Item1" from foptionshotkeysedithotkey's files  and language files.
2016-12-04 05:05:05 +00:00
Denis Bisson
d1ddd9ffcb FIX: The internal commands "cm_MarkMarkAll", "cm_MarkUnmarkAll", "cm_MarkInvert" may now take in consideration the global "Default attribute mask value to use" setting to determine what will be selected/unselected/toggle.
NEW: The internal commands "cm_MarkMarkAll", "cm_MarkUnmarkAll", "cm_MarkInvert" may now work with the parameter "attr" to determine what they will select/unselect/toggle.
UPD: The options "Default attribute mask value to use" and "Use an independent attribute filter in mask input dialog each time" are now in "File views" configuration page instead of "File operations".
UPD: All languages files have been updated AND this time, what could be preserved has been preserved! For example, the string for "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption" has been taken from the "tfrmoptionsfileoperations.chkmarkmaskfilterwindows.caption" since the options moved from a place to another.
2016-12-03 23:00:45 +00:00
Denis Bisson
3c8068c942 ADD: New internal command "cm_AddNewSearch" to generate a new instance of the "Find files" dialog window. This way, more than one search may be done at the same time.
ADD: When closing any "Find files" dialog window, if at least one search has been done, that window will remain in memory. If no search has been done, it will be cleared from memory.
ADD: New internal command "cm_ViewSearches" to show a list of "Find files" dialog window and select one of them to activate it. This way, it possible to do a second search without losing the first one and to be able to reactive it.
ADD: New internal command "cm_DeleteSearches" to delete all the "Find files" dialog windows we may have in memory. If you want to delete just one, activate it via the "cm_ViewSearches" internal command and then clear it from memory from there.
ADD: New internal command "cm_ConfigSearches" to jump directly to the configuration of options related with searches.
ADD: New 32x32 icons for the new internal commands "cm_AddNewSearch", "cm_ViewSearches", "cm_DeleteSearches" and "cm_ConfigSearches". For the 16x16, the last three mentionned were added since for the "cm_AddNewSearch" it was already there, added by mistake too early but now it's used.
ADD: There is now a dedicated page for the option of the search instead of being inside the "File operations" page.
UPD: On new installation, in the "Find files" dialog window, the "ENTER" key is not a shortcut anymore to launch a search. Too many persons get used that pressing enter in the result page was making us to jump to the file location. Code were already in place to have pertinent action on default button so pressing "ENTER" do the pertinent expected job.
ADD: Possibility to have a menu bar in the "Find files" dialog window. This is mainly to help the user at first to see all the possibility. There is an option to hide it and probably experienced user after a while will hide it to gain some 20 extra pixels vertically.
ADD: Reserve, if not already used, the keyboard shortcut "Ctrl+Shift+F7" for the new internal command "cm_AddNewSearch".
UPD: Inside the "Find files" unit, re-arrange the code so the buttons will use TAction to do something instead of the opposite where the TAction were pressing button.
UPD: Language files have been updated.
2016-12-01 02:23:28 +00:00