msgid "" msgstr "" "Project-Id-Version: Double Commander 0.8.0 alpha\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: 2008-01-17 23:08+0300\n" "PO-Revision-Date: YEAR-MO-DA HO:MI+ZONE\n" "Last-Translator: Full Name \n" "Language-Team: Language \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=utf-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Native-Language: English\n" #: fsyncdirsdlg.rscomparingpercent msgid "Comparing... %d%% (ESC to cancel)" msgstr "" #: fsyncdirsdlg.rsdeleteright msgid "Right: Delete %d file(s)" msgstr "" #: fsyncdirsdlg.rsfilesfound msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)" msgstr "" #: fsyncdirsdlg.rslefttorightcopy msgid "Left to Right: Copy %d files, total size: %d bytes" msgstr "" #: fsyncdirsdlg.rsrighttoleftcopy msgid "Right to Left: Copy %d files, total size: %d bytes" msgstr "" #: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint msgid "Choose template..." msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption msgid "C&heck free space" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption msgid "Cop&y attributes" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption msgid "Copy o&wnership" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption msgid "Copy &permissions" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption msgid "Correct lin&ks" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption msgid "Drop readonly fla&g" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption msgid "E&xclude empty directories" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption msgid "Fo&llow links" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption msgid "&Reserve space" msgstr "" #: tfilesystemcopymoveoperationoptionsui.chkverify.caption msgid "&Verify" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint msgid "What to do when cannot set file time, attributes, etc." msgstr "" #: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption msgid "Use file template" msgstr "" #: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption msgid "When dir&ectory exists" msgstr "" #: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption msgid "When &file exists" msgstr "" #: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption msgid "When ca&nnot set property" msgstr "" #: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption msgid "" msgstr "" #: tfrmabout.btnclose.caption msgctxt "tfrmabout.btnclose.caption" msgid "&Close" msgstr "" #: tfrmabout.btncopytoclipboard.caption msgid "Copy to clipboard" msgstr "" #: tfrmabout.caption msgctxt "tfrmabout.caption" msgid "About" msgstr "" #: tfrmabout.lblbuild.caption msgctxt "tfrmabout.lblbuild.caption" msgid "Build" msgstr "" #: tfrmabout.lblfreepascalver.caption msgctxt "tfrmabout.lblfreepascalver.caption" msgid "Free Pascal" msgstr "" #: tfrmabout.lblhomepage.caption msgid "Home Page:" msgstr "" #: tfrmabout.lblhomepageaddress.caption msgid "http://doublecmd.sourceforge.net" msgstr "" #: tfrmabout.lbllazarusver.caption msgctxt "tfrmabout.lbllazarusver.caption" msgid "Lazarus" msgstr "" #: tfrmabout.lblrevision.caption msgctxt "tfrmabout.lblrevision.caption" msgid "Revision" msgstr "" #: tfrmabout.lbltitle.caption msgctxt "tfrmabout.lbltitle.caption" msgid "Double Commander" msgstr "" #: tfrmabout.lblversion.caption msgctxt "tfrmabout.lblversion.caption" msgid "Version" msgstr "" #: tfrmattributesedit.btncancel.caption msgctxt "tfrmattributesedit.btncancel.caption" msgid "&Cancel" msgstr "" #: tfrmattributesedit.btnok.caption msgctxt "tfrmattributesedit.btnok.caption" msgid "&OK" msgstr "" #: tfrmattributesedit.btnreset.caption msgid "&Reset" msgstr "" #: tfrmattributesedit.caption msgid "Choose attributes" msgstr "" #: tfrmattributesedit.cbarchive.caption msgid "&Archive" msgstr "" #: tfrmattributesedit.cbcompressed.caption msgid "Co&mpressed" msgstr "" #: tfrmattributesedit.cbdirectory.caption msgid "&Directory" msgstr "" #: tfrmattributesedit.cbencrypted.caption msgid "&Encrypted" msgstr "" #: tfrmattributesedit.cbhidden.caption msgid "&Hidden" msgstr "" #: tfrmattributesedit.cbreadonly.caption msgid "Read o&nly" msgstr "" #: tfrmattributesedit.cbsgid.caption msgctxt "tfrmattributesedit.cbsgid.caption" msgid "SGID" msgstr "" #: tfrmattributesedit.cbsparse.caption msgid "S&parse" msgstr "" #: tfrmattributesedit.cbsticky.caption msgctxt "tfrmattributesedit.cbsticky.caption" msgid "Sticky" msgstr "" #: tfrmattributesedit.cbsuid.caption msgctxt "tfrmattributesedit.cbsuid.caption" msgid "SUID" msgstr "" #: tfrmattributesedit.cbsymlink.caption msgid "&Symlink" msgstr "" #: tfrmattributesedit.cbsystem.caption msgid "S&ystem" msgstr "" #: tfrmattributesedit.cbtemporary.caption msgid "&Temporary" msgstr "" #: tfrmattributesedit.gbntfsattributes.caption msgid "NTFS attributes" msgstr "" #: tfrmattributesedit.gbwingeneral.caption msgid "General attributes" msgstr "" #: tfrmattributesedit.lblattrbitsstr.caption msgctxt "tfrmattributesedit.lblattrbitsstr.caption" msgid "Bits:" msgstr "" #: tfrmattributesedit.lblattrgroupstr.caption msgctxt "tfrmattributesedit.lblattrgroupstr.caption" msgid "Group" msgstr "" #: tfrmattributesedit.lblattrotherstr.caption msgctxt "tfrmattributesedit.lblattrotherstr.caption" msgid "Other" msgstr "" #: tfrmattributesedit.lblattrownerstr.caption msgctxt "tfrmattributesedit.lblattrownerstr.caption" msgid "Owner" msgstr "" #: tfrmattributesedit.lblexec.caption msgctxt "tfrmattributesedit.lblexec.caption" msgid "Execute" msgstr "" #: tfrmattributesedit.lblread.caption msgctxt "tfrmattributesedit.lblread.caption" msgid "Read" msgstr "" #: tfrmattributesedit.lbltextattrs.caption msgid "As te&xt:" msgstr "" #: tfrmattributesedit.lblwrite.caption msgctxt "tfrmattributesedit.lblwrite.caption" msgid "Write" msgstr "" #: tfrmchecksumcalc.caption msgctxt "tfrmchecksumcalc.caption" msgid "Calculate checksum..." msgstr "" #: tfrmchecksumcalc.cbopenafterjobiscomplete.caption msgid "Open checksum file after job is completed" msgstr "" #: tfrmchecksumcalc.cbseparatefile.caption msgid "C&reate separate checksum file for each file" msgstr "" #: tfrmchecksumcalc.lblsaveto.caption msgid "&Save checksum file(s) to:" msgstr "" #: tfrmchecksumverify.btnclose.caption msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION" msgid "&Close" msgstr "" #: tfrmchecksumverify.caption msgctxt "tfrmchecksumverify.caption" msgid "Verify checksum..." msgstr "" #: tfrmconnectionmanager.btnadd.caption msgctxt "tfrmconnectionmanager.btnadd.caption" msgid "A&dd" msgstr "" #: tfrmconnectionmanager.btncancel.caption msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmconnectionmanager.btnconnect.caption msgid "C&onnect" msgstr "" #: tfrmconnectionmanager.btndelete.caption msgctxt "tfrmconnectionmanager.btndelete.caption" msgid "&Delete" msgstr "" #: tfrmconnectionmanager.btnedit.caption msgctxt "tfrmconnectionmanager.btnedit.caption" msgid "&Edit" msgstr "" #: tfrmconnectionmanager.caption msgid "Connection manager" msgstr "" #: tfrmconnectionmanager.gbconnectto.caption msgid "Connect to:" msgstr "" #: tfrmcopydlg.btnaddtoqueue.caption msgid "A&dd To Queue" msgstr "" #: tfrmcopydlg.btncancel.caption msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmcopydlg.btnoptions.caption msgid "O&ptions" msgstr "" #: tfrmcopydlg.btnsaveoptions.caption msgid "Sa&ve these options as default" msgstr "" #: tfrmcopydlg.caption msgctxt "tfrmcopydlg.caption" msgid "Copy file(s)" msgstr "" #: tfrmcopydlg.mnunewqueue.caption msgid "New queue" msgstr "" #: tfrmcopydlg.mnuqueue1.caption msgid "Queue 1" msgstr "" #: tfrmcopydlg.mnuqueue2.caption msgid "Queue 2" msgstr "" #: tfrmcopydlg.mnuqueue3.caption msgid "Queue 3" msgstr "" #: tfrmcopydlg.mnuqueue4.caption msgid "Queue 4" msgstr "" #: tfrmcopydlg.mnuqueue5.caption msgid "Queue 5" msgstr "" #: tfrmdescredit.actsavedescription.caption msgid "Save Description" msgstr "" #: tfrmdescredit.btncancel.caption msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmdescredit.btnok.caption msgctxt "TFRMDESCREDIT.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmdescredit.caption msgid "File/folder comment" msgstr "" #: tfrmdescredit.lbleditcommentfor.caption msgid "E&dit comment for:" msgstr "" #: tfrmdescredit.lblencoding.caption msgid "&Encoding:" msgstr "" #: tfrmdescredit.lblfilename.caption msgctxt "tfrmdescredit.lblfilename.caption" msgid "???" msgstr "" #: tfrmdiffer.actabout.caption msgctxt "TFRMDIFFER.ACTABOUT.CAPTION" msgid "About" msgstr "" #: tfrmdiffer.actautocompare.caption msgid "Auto Compare" msgstr "" #: tfrmdiffer.actbinarycompare.caption msgid "Binary Mode" msgstr "" #: tfrmdiffer.actcancelcompare.caption msgctxt "tfrmdiffer.actcancelcompare.caption" msgid "Cancel" msgstr "" #: tfrmdiffer.actcancelcompare.hint msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT" msgid "Cancel" msgstr "" #: tfrmdiffer.actcopylefttoright.caption msgctxt "tfrmdiffer.actcopylefttoright.caption" msgid "Copy Block Right" msgstr "" #: tfrmdiffer.actcopylefttoright.hint msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT" msgid "Copy Block Right" msgstr "" #: tfrmdiffer.actcopyrighttoleft.caption msgctxt "tfrmdiffer.actcopyrighttoleft.caption" msgid "Copy Block Left" msgstr "" #: tfrmdiffer.actcopyrighttoleft.hint msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT" msgid "Copy Block Left" msgstr "" #: tfrmdiffer.acteditcopy.caption msgctxt "tfrmdiffer.acteditcopy.caption" msgid "Copy" msgstr "" #: tfrmdiffer.acteditcut.caption msgctxt "tfrmdiffer.acteditcut.caption" msgid "Cut" msgstr "" #: tfrmdiffer.acteditdelete.caption msgctxt "tfrmdiffer.acteditdelete.caption" msgid "Delete" msgstr "" #: tfrmdiffer.acteditpaste.caption msgctxt "tfrmdiffer.acteditpaste.caption" msgid "Paste" msgstr "" #: tfrmdiffer.acteditredo.caption msgctxt "tfrmdiffer.acteditredo.caption" msgid "Redo" msgstr "" #: tfrmdiffer.acteditselectall.caption msgid "Select &All" msgstr "" #: tfrmdiffer.acteditundo.caption msgctxt "tfrmdiffer.acteditundo.caption" msgid "Undo" msgstr "" #: tfrmdiffer.actexit.caption msgctxt "tfrmdiffer.actexit.caption" msgid "E&xit" msgstr "" #: tfrmdiffer.actfirstdifference.caption msgctxt "tfrmdiffer.actfirstdifference.caption" msgid "First Difference" msgstr "" #: tfrmdiffer.actfirstdifference.hint msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT" msgid "First Difference" msgstr "" #: tfrmdiffer.actignorecase.caption msgid "Ignore Case" msgstr "" #: tfrmdiffer.actignorewhitespace.caption msgid "Ignore Blanks" msgstr "" #: tfrmdiffer.actkeepscrolling.caption msgid "Keep Scrolling" msgstr "" #: tfrmdiffer.actlastdifference.caption msgctxt "tfrmdiffer.actlastdifference.caption" msgid "Last Difference" msgstr "" #: tfrmdiffer.actlastdifference.hint msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT" msgid "Last Difference" msgstr "" #: tfrmdiffer.actlinedifferences.caption msgid "Line Differences" msgstr "" #: tfrmdiffer.actnextdifference.caption msgctxt "tfrmdiffer.actnextdifference.caption" msgid "Next Difference" msgstr "" #: tfrmdiffer.actnextdifference.hint msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT" msgid "Next Difference" msgstr "" #: tfrmdiffer.actopenleft.caption msgid "Open Left..." msgstr "" #: tfrmdiffer.actopenright.caption msgid "Open Right..." msgstr "" #: tfrmdiffer.actpaintbackground.caption msgid "Paint Background" msgstr "" #: tfrmdiffer.actprevdifference.caption msgctxt "tfrmdiffer.actprevdifference.caption" msgid "Previous Difference" msgstr "" #: tfrmdiffer.actprevdifference.hint msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT" msgid "Previous Difference" msgstr "" #: tfrmdiffer.actreload.caption msgid "&Reload" msgstr "" #: tfrmdiffer.actreload.hint msgctxt "tfrmdiffer.actreload.hint" msgid "Reload" msgstr "" #: tfrmdiffer.actsave.caption msgctxt "tfrmdiffer.actsave.caption" msgid "Save" msgstr "" #: tfrmdiffer.actsave.hint msgctxt "TFRMDIFFER.ACTSAVE.HINT" msgid "Save" msgstr "" #: tfrmdiffer.actsaveas.caption msgctxt "tfrmdiffer.actsaveas.caption" msgid "Save as..." msgstr "" #: tfrmdiffer.actsaveas.hint msgctxt "TFRMDIFFER.ACTSAVEAS.HINT" msgid "Save as..." msgstr "" #: tfrmdiffer.actsaveleft.caption msgctxt "tfrmdiffer.actsaveleft.caption" msgid "Save Left" msgstr "" #: tfrmdiffer.actsaveleft.hint msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT" msgid "Save Left" msgstr "" #: tfrmdiffer.actsaveleftas.caption msgctxt "tfrmdiffer.actsaveleftas.caption" msgid "Save Left As..." msgstr "" #: tfrmdiffer.actsaveleftas.hint msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT" msgid "Save Left As..." msgstr "" #: tfrmdiffer.actsaveright.caption msgctxt "tfrmdiffer.actsaveright.caption" msgid "Save Right" msgstr "" #: tfrmdiffer.actsaveright.hint msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT" msgid "Save Right" msgstr "" #: tfrmdiffer.actsaverightas.caption msgctxt "tfrmdiffer.actsaverightas.caption" msgid "Save Right As..." msgstr "" #: tfrmdiffer.actsaverightas.hint msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT" msgid "Save Right As..." msgstr "" #: tfrmdiffer.actstartcompare.caption msgctxt "tfrmdiffer.actstartcompare.caption" msgid "Compare" msgstr "" #: tfrmdiffer.actstartcompare.hint msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT" msgid "Compare" msgstr "" #: tfrmdiffer.btnleftencoding.hint msgctxt "tfrmdiffer.btnleftencoding.hint" msgid "Encoding" msgstr "" #: tfrmdiffer.btnrightencoding.hint msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT" msgid "Encoding" msgstr "" #: tfrmdiffer.caption msgid "Compare files" msgstr "" #: tfrmdiffer.midivider1.caption msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.midivider10.caption msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.midivider2.caption msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.midivider3.caption msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.midivider4.caption msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.midivider5.caption msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.midivider6.caption msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.midivider7.caption msgctxt "tfrmdiffer.midivider7.caption" msgid "-" msgstr "" #: tfrmdiffer.midivider8.caption msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.midivider9.caption msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.miencodingleft.caption msgid "&Left" msgstr "" #: tfrmdiffer.miencodingright.caption msgid "&Right" msgstr "" #: tfrmdiffer.miseparator1.caption msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.miseparator2.caption msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION" msgid "-" msgstr "" #: tfrmdiffer.mnuactions.caption msgid "&Actions" msgstr "" #: tfrmdiffer.mnuedit.caption msgctxt "TFRMDIFFER.MNUEDIT.CAPTION" msgid "&Edit" msgstr "" #: tfrmdiffer.mnuencoding.caption msgctxt "tfrmdiffer.mnuencoding.caption" msgid "En&coding" msgstr "" #: tfrmdiffer.mnufile.caption msgctxt "tfrmdiffer.mnufile.caption" msgid "&File" msgstr "" #: tfrmdiffer.mnuoptions.caption msgid "&Options" msgstr "" #: tfrmedithotkey.btnaddshortcut.hint msgid "Add new shortcut to sequence" msgstr "" #: tfrmedithotkey.btncancel.caption msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmedithotkey.btnok.caption msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmedithotkey.btnremoveshortcut.hint msgid "Remove last shortcut from sequence" msgstr "" #: tfrmedithotkey.btnselectfromlist.hint msgid "Select shortcut from list of remaining free available keys" msgstr "" #: tfrmedithotkey.cghkcontrols.caption msgid "Only for these controls" msgstr "" #: tfrmedithotkey.lblparameters.caption msgid "&Parameters (each in a separate line):" msgstr "" #: tfrmedithotkey.lblshortcuts.caption msgid "Shortcuts:" msgstr "" #: tfrmeditor.actabout.caption msgctxt "TFRMEDITOR.ACTABOUT.CAPTION" msgid "About" msgstr "" #: tfrmeditor.actabout.hint msgctxt "TFRMEDITOR.ACTABOUT.HINT" msgid "About" msgstr "" #: tfrmeditor.actconfhigh.caption msgid "&Configuration" msgstr "" #: tfrmeditor.actconfhigh.hint msgctxt "tfrmeditor.actconfhigh.hint" msgid "Configuration" msgstr "" #: tfrmeditor.acteditcopy.caption msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "" #: tfrmeditor.acteditcopy.hint msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT" msgid "Copy" msgstr "" #: tfrmeditor.acteditcut.caption msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "" #: tfrmeditor.acteditcut.hint msgctxt "TFRMEDITOR.ACTEDITCUT.HINT" msgid "Cut" msgstr "" #: tfrmeditor.acteditdelete.caption msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "" #: tfrmeditor.acteditdelete.hint msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT" msgid "Delete" msgstr "" #: tfrmeditor.acteditfind.caption msgctxt "tfrmeditor.acteditfind.caption" msgid "&Find" msgstr "" #: tfrmeditor.acteditfind.hint msgctxt "tfrmeditor.acteditfind.hint" msgid "Find" msgstr "" #: tfrmeditor.acteditfindnext.caption msgctxt "tfrmeditor.acteditfindnext.caption" msgid "Find next" msgstr "" #: tfrmeditor.acteditfindnext.hint msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT" msgid "Find next" msgstr "" #: tfrmeditor.acteditfindprevious.caption msgctxt "tfrmeditor.acteditfindprevious.caption" msgid "Find previous" msgstr "" #: tfrmeditor.acteditgotoline.caption msgid "Goto Line..." msgstr "" #: tfrmeditor.acteditlineendcr.caption msgctxt "tfrmeditor.acteditlineendcr.caption" msgid "Mac (CR)" msgstr "" #: tfrmeditor.acteditlineendcr.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT" msgid "Mac (CR)" msgstr "" #: tfrmeditor.acteditlineendcrlf.caption msgctxt "tfrmeditor.acteditlineendcrlf.caption" msgid "Windows (CRLF)" msgstr "" #: tfrmeditor.acteditlineendcrlf.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT" msgid "Windows (CRLF)" msgstr "" #: tfrmeditor.acteditlineendlf.caption msgctxt "tfrmeditor.acteditlineendlf.caption" msgid "Unix (LF)" msgstr "" #: tfrmeditor.acteditlineendlf.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT" msgid "Unix (LF)" msgstr "" #: tfrmeditor.acteditpaste.caption msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "" #: tfrmeditor.acteditpaste.hint msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT" msgid "Paste" msgstr "" #: tfrmeditor.acteditredo.caption msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "" #: tfrmeditor.acteditredo.hint msgctxt "TFRMEDITOR.ACTEDITREDO.HINT" msgid "Redo" msgstr "" #: tfrmeditor.acteditrplc.caption msgid "&Replace" msgstr "" #: tfrmeditor.acteditrplc.hint msgctxt "tfrmeditor.acteditrplc.hint" msgid "Replace" msgstr "" #: tfrmeditor.acteditselectall.caption msgid "Select&All" msgstr "" #: tfrmeditor.acteditselectall.hint msgctxt "tfrmeditor.acteditselectall.hint" msgid "Select All" msgstr "" #: tfrmeditor.acteditundo.caption msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "" #: tfrmeditor.acteditundo.hint msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT" msgid "Undo" msgstr "" #: tfrmeditor.actfileclose.caption msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION" msgid "&Close" msgstr "" #: tfrmeditor.actfileclose.hint msgctxt "tfrmeditor.actfileclose.hint" msgid "Close" msgstr "" #: tfrmeditor.actfileexit.caption msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION" msgid "E&xit" msgstr "" #: tfrmeditor.actfileexit.hint msgctxt "tfrmeditor.actfileexit.hint" msgid "Exit" msgstr "" #: tfrmeditor.actfilenew.caption msgid "&New" msgstr "" #: tfrmeditor.actfilenew.hint msgctxt "tfrmeditor.actfilenew.hint" msgid "New" msgstr "" #: tfrmeditor.actfileopen.caption msgid "&Open" msgstr "" #: tfrmeditor.actfileopen.hint msgctxt "tfrmeditor.actfileopen.hint" msgid "Open" msgstr "" #: tfrmeditor.actfilesave.caption msgctxt "tfrmeditor.actfilesave.caption" msgid "&Save" msgstr "" #: tfrmeditor.actfilesave.hint msgctxt "TFRMEDITOR.ACTFILESAVE.HINT" msgid "Save" msgstr "" #: tfrmeditor.actfilesaveas.caption msgid "Save &As..." msgstr "" #: tfrmeditor.actfilesaveas.hint msgid "Save As" msgstr "" #: tfrmeditor.actsaveall.caption msgid "Sa&ve All" msgstr "" #: tfrmeditor.actsaveall.hint msgid "Save All" msgstr "" #: tfrmeditor.caption msgctxt "tfrmeditor.caption" msgid "Editor" msgstr "" #: tfrmeditor.help1.caption msgctxt "tfrmeditor.help1.caption" msgid "&Help" msgstr "" #: tfrmeditor.menuitem1.caption msgctxt "TFRMEDITOR.MENUITEM1.CAPTION" msgid "-" msgstr "" #: tfrmeditor.midiv.caption msgctxt "TFRMEDITOR.MIDIV.CAPTION" msgid "-" msgstr "" #: tfrmeditor.miedit.caption msgctxt "TFRMEDITOR.MIEDIT.CAPTION" msgid "&Edit" msgstr "" #: tfrmeditor.miencoding.caption msgctxt "TFRMEDITOR.MIENCODING.CAPTION" msgid "En&coding" msgstr "" #: tfrmeditor.miencodingin.caption msgid "Open as" msgstr "" #: tfrmeditor.miencodingout.caption msgctxt "tfrmeditor.miencodingout.caption" msgid "Save as" msgstr "" #: tfrmeditor.mifile.caption msgctxt "TFRMEDITOR.MIFILE.CAPTION" msgid "&File" msgstr "" #: tfrmeditor.mihighlight.caption msgid "Syntax highlight" msgstr "" #: tfrmeditor.milineendtype.caption msgid "End Of Line" msgstr "" #: tfrmeditor.miseparator1.caption msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION" msgid "-" msgstr "" #: tfrmeditor.miseparator2.caption msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION" msgid "-" msgstr "" #: tfrmeditor.n1.caption msgctxt "TFRMEDITOR.N1.CAPTION" msgid "-" msgstr "" #: tfrmeditor.n3.caption msgctxt "TFRMEDITOR.N3.CAPTION" msgid "-" msgstr "" #: tfrmeditor.n4.caption msgctxt "TFRMEDITOR.N4.CAPTION" msgid "-" msgstr "" #: tfrmeditor.n5.caption msgctxt "TFRMEDITOR.N5.CAPTION" msgid "-" msgstr "" #: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.CANCELBUTTON.CAPTION" msgid "&Cancel" msgstr "" #: tfrmeditsearchreplace.buttonpanel.okbutton.caption msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.OKBUTTON.CAPTION" msgid "&OK" msgstr "" #: tfrmeditsearchreplace.cbsearchcasesensitive.caption msgid "C&ase sensitivity" msgstr "" #: tfrmeditsearchreplace.cbsearchfromcursor.caption msgid "S&earch from caret" msgstr "" #: tfrmeditsearchreplace.cbsearchregexp.caption msgid "&Regular expressions" msgstr "" #: tfrmeditsearchreplace.cbsearchselectedonly.caption msgid "Selected &text only" msgstr "" #: tfrmeditsearchreplace.cbsearchwholewords.caption msgid "&Whole words only" msgstr "" #: tfrmeditsearchreplace.gbsearchoptions.caption msgid "Option" msgstr "" #: tfrmeditsearchreplace.lblreplacewith.caption msgid "&Replace with:" msgstr "" #: tfrmeditsearchreplace.lblsearchfor.caption msgid "&Search for:" msgstr "" #: tfrmeditsearchreplace.rgsearchdirection.caption msgid "Direction" msgstr "" #: tfrmextractdlg.caption msgid "Unpack files" msgstr "" #: tfrmextractdlg.cbextractpath.caption msgid "&Unpack path names if stored with files" msgstr "" #: tfrmextractdlg.cbfilemask.text msgctxt "tfrmextractdlg.cbfilemask.text" msgid "*.*" msgstr "" #: tfrmextractdlg.cbinseparatefolder.caption msgid "Unpack each archive to a &separate subdir (name of the archive)" msgstr "" #: tfrmextractdlg.cboverwrite.caption msgid "O&verwrite existing files" msgstr "" #: tfrmextractdlg.lblextractto.caption msgid "To the &directory:" msgstr "" #: tfrmextractdlg.lblfilemask.caption msgid "&Extract files matching file mask:" msgstr "" #: tfrmextractdlg.lblpassword.caption msgid "&Password for encrypted files:" msgstr "" #: tfrmfileexecuteyourself.btnclose.caption msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION" msgid "&Close" msgstr "" #: tfrmfileexecuteyourself.caption msgid "Wait..." msgstr "" #: tfrmfileexecuteyourself.lblfilename.caption msgid "File name:" msgstr "" #: tfrmfileexecuteyourself.lblfrompath.caption msgctxt "tfrmfileexecuteyourself.lblfrompath.caption" msgid "From:" msgstr "" #: tfrmfileexecuteyourself.lblprompt.caption msgid "Click on Close when the temporary file can be deleted!" msgstr "" #: tfrmfileop.btncancel.caption msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmfileop.btnminimizetopanel.caption msgid "&To panel" msgstr "" #: tfrmfileop.btnviewoperations.caption msgid "&View all" msgstr "" #: tfrmfileop.lblcurrentoperation.caption msgid "Current operation:" msgstr "" #: tfrmfileop.lblfrom.caption msgctxt "TFRMFILEOP.LBLFROM.CAPTION" msgid "From:" msgstr "" #: tfrmfileop.lblto.caption msgid "To:" msgstr "" #: tfrmfileproperties.btnclose.caption msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION" msgid "&Close" msgstr "" #: tfrmfileproperties.btnsetproperties.caption msgid "&Set properties" msgstr "" #: tfrmfileproperties.btnsetpropertiestoallfiles.caption msgid "Set to &all selected files" msgstr "" #: tfrmfileproperties.btnskipfile.caption msgid "Ski&p this file" msgstr "" #: tfrmfileproperties.caption msgctxt "tfrmfileproperties.caption" msgid "Properties" msgstr "" #: tfrmfileproperties.cbsgid.caption msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "" #: tfrmfileproperties.cbsticky.caption msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "" #: tfrmfileproperties.cbsuid.caption msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "" #: tfrmfileproperties.chkexecutable.caption msgid "Allow &executing file as program" msgstr "" #: tfrmfileproperties.gbowner.caption msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION" msgid "Owner" msgstr "" #: tfrmfileproperties.lblattrbitsstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "" #: tfrmfileproperties.lblattrgroupstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "" #: tfrmfileproperties.lblattrotherstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "" #: tfrmfileproperties.lblattrownerstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "" #: tfrmfileproperties.lblattrtext.caption msgctxt "tfrmfileproperties.lblattrtext.caption" msgid "-----------" msgstr "" #: tfrmfileproperties.lblattrtextstr.caption msgctxt "tfrmfileproperties.lblattrtextstr.caption" msgid "Text:" msgstr "" #: tfrmfileproperties.lblcontains.caption msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lblcontainsstr.caption msgid "Contains:" msgstr "" #: tfrmfileproperties.lblexec.caption msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "" #: tfrmfileproperties.lblexecutable.caption msgid "Execute:" msgstr "" #: tfrmfileproperties.lblfile.caption msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION" msgid "File name" msgstr "" #: tfrmfileproperties.lblfilename.caption msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lblfilestr.caption msgctxt "tfrmfileproperties.lblfilestr.caption" msgid "File name" msgstr "" #: tfrmfileproperties.lblfolder.caption msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lblfolderstr.caption msgctxt "tfrmfileproperties.lblfolderstr.caption" msgid "Path:" msgstr "" #: tfrmfileproperties.lblgroupstr.caption msgid "&Group" msgstr "" #: tfrmfileproperties.lbllastaccess.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lbllastaccessstr.caption msgid "Last access:" msgstr "" #: tfrmfileproperties.lbllastmodif.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lbllastmodifstr.caption msgid "Last modification:" msgstr "" #: tfrmfileproperties.lbllaststchange.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lbllaststchangestr.caption msgid "Last status change:" msgstr "" #: tfrmfileproperties.lbloctal.caption msgctxt "tfrmfileproperties.lbloctal.caption" msgid "Octal:" msgstr "" #: tfrmfileproperties.lblownerstr.caption msgid "O&wner" msgstr "" #: tfrmfileproperties.lblread.caption msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "" #: tfrmfileproperties.lblsize.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lblsizestr.caption msgctxt "tfrmfileproperties.lblsizestr.caption" msgid "Size:" msgstr "" #: tfrmfileproperties.lblsymlink.caption msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lblsymlinkstr.caption msgid "Symlink to:" msgstr "" #: tfrmfileproperties.lbltype.caption msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION" msgid "???" msgstr "" #: tfrmfileproperties.lbltypestr.caption msgid "Type:" msgstr "" #: tfrmfileproperties.lblwrite.caption msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "" #: tfrmfileproperties.sgimage.columns[0].title.caption msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption" msgid "Name" msgstr "" #: tfrmfileproperties.sgimage.columns[1].title.caption msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption" msgid "Value" msgstr "" #: tfrmfileproperties.tsattributes.caption msgctxt "tfrmfileproperties.tsattributes.caption" msgid "Attributes" msgstr "" #: tfrmfileproperties.tsimage.caption msgid "Image" msgstr "" #: tfrmfileproperties.tsproperties.caption msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION" msgid "Properties" msgstr "" #: tfrmfinddlg.actcancel.caption msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION" msgid "C&ancel" msgstr "" #: tfrmfinddlg.actcancelclose.caption msgid "Cancel search and close window" msgstr "" #: tfrmfinddlg.actclose.caption msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION" msgid "&Close" msgstr "" #: tfrmfinddlg.actconfigfilesearchhotkeys.caption msgctxt "TFRMFINDDLG.ACTCONFIGFILESEARCHHOTKEYS.CAPTION" msgid "Configuration of hot keys" msgstr "" #: tfrmfinddlg.actedit.caption msgctxt "tfrmfinddlg.actedit.caption" msgid "&Edit" msgstr "" #: tfrmfinddlg.actfeedtolistbox.caption msgid "Feed to &listbox" msgstr "" #: tfrmfinddlg.actfreefrommem.caption msgid "Cancel search, close and free from memory" msgstr "" #: tfrmfinddlg.actfreefrommemallothers.caption msgid "For all other \"Find files\", cancel, close and free from memory" msgstr "" #: tfrmfinddlg.actgotofile.caption msgid "&Go to file" msgstr "" #: tfrmfinddlg.actintellifocus.caption msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION" msgid "Find Data" msgstr "" #: tfrmfinddlg.actlastsearch.caption msgid "&Last search" msgstr "" #: tfrmfinddlg.actnewsearch.caption msgid "&New search" msgstr "" #: tfrmfinddlg.actnewsearchclearfilters.caption msgid "New search (clear filters)" msgstr "" #: tfrmfinddlg.actpageadvanced.caption msgid "Go to page \"Advanced\"" msgstr "" #: tfrmfinddlg.actpageloadsave.caption msgid "Go to page \"Load/Save\"" msgstr "" #: tfrmfinddlg.actpagenext.caption msgid "Switch to Nex&t Page" msgstr "" #: tfrmfinddlg.actpageplugins.caption msgid "Go to page \"Plugins\"" msgstr "" #: tfrmfinddlg.actpageprev.caption msgid "Switch to &Previous Page" msgstr "" #: tfrmfinddlg.actpageresults.caption msgid "Go to page \"Results\"" msgstr "" #: tfrmfinddlg.actpagestandard.caption msgid "Go to page \"Standard\"" msgstr "" #: tfrmfinddlg.actstart.caption msgctxt "tfrmfinddlg.actstart.caption" msgid "&Start" msgstr "" #: tfrmfinddlg.actview.caption msgctxt "tfrmfinddlg.actview.caption" msgid "&View" msgstr "" #: tfrmfinddlg.btnaddattribute.caption msgctxt "tfrmfinddlg.btnaddattribute.caption" msgid "&Add" msgstr "" #: tfrmfinddlg.btnattrshelp.caption msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION" msgid "&Help" msgstr "" #: tfrmfinddlg.btnsavetemplate.caption msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION" msgid "&Save" msgstr "" #: tfrmfinddlg.btnsearchdelete.caption msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION" msgid "&Delete" msgstr "" #: tfrmfinddlg.btnsearchload.caption msgid "L&oad" msgstr "" #: tfrmfinddlg.btnsearchsave.caption msgid "S&ave" msgstr "" #: tfrmfinddlg.btnsearchsavewithstartingpath.caption msgid "Sa&ve with \"Start in directory\"" msgstr "" #: tfrmfinddlg.btnsearchsavewithstartingpath.hint msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory" msgstr "" #: tfrmfinddlg.btnusetemplate.caption msgid "Use template" msgstr "" #: tfrmfinddlg.caption msgctxt "tfrmfinddlg.caption" msgid "Find files" msgstr "" #: tfrmfinddlg.cbcasesens.caption msgid "Case sens&itive" msgstr "" #: tfrmfinddlg.cbdatefrom.caption msgid "&Date from:" msgstr "" #: tfrmfinddlg.cbdateto.caption msgid "Dat&e to:" msgstr "" #: tfrmfinddlg.cbfilesizefrom.caption msgid "S&ize from:" msgstr "" #: tfrmfinddlg.cbfilesizeto.caption msgid "Si&ze to:" msgstr "" #: tfrmfinddlg.cbfindinarchive.caption msgid "Search in &archives" msgstr "" #: tfrmfinddlg.cbfindtext.caption msgid "Find &text in file" msgstr "" #: tfrmfinddlg.cbfollowsymlinks.caption msgid "Follow s&ymlinks" msgstr "" #: tfrmfinddlg.cbnotcontainingtext.caption msgid "Find files N&OT containing the text" msgstr "" #: tfrmfinddlg.cbnotolderthan.caption msgid "N&ot older than:" msgstr "" #: tfrmfinddlg.cbopenedtabs.caption msgid "Opened tabs" msgstr "" #: tfrmfinddlg.cbpartialnamesearch.caption msgid "Searc&h for part of file name" msgstr "" #: tfrmfinddlg.cbregexp.caption msgid "&Regular expression" msgstr "" #: tfrmfinddlg.cbreplacetext.caption msgid "Re&place by" msgstr "" #: tfrmfinddlg.cbselectedfiles.caption msgid "Selected directories and &files" msgstr "" #: tfrmfinddlg.cbtextregexp.caption msgid "Regular &expression" msgstr "" #: tfrmfinddlg.cbtimefrom.caption msgid "&Time from:" msgstr "" #: tfrmfinddlg.cbtimeto.caption msgid "Ti&me to:" msgstr "" #: tfrmfinddlg.cbuseplugin.caption msgid "&Use search plugin:" msgstr "" #: tfrmfinddlg.cmbexcludedirectories.hint msgid "Enter directories names that should be excluded from search separated with \";\"" msgstr "" #: tfrmfinddlg.cmbexcludefiles.hint msgid "Enter files names that should be excluded from search separated with \";\"" msgstr "" #: tfrmfinddlg.cmbfindfilemask.hint msgid "Enter files names separated with \";\"" msgstr "" #: tfrmfinddlg.gbdirectories.caption msgctxt "tfrmfinddlg.gbdirectories.caption" msgid "Directories" msgstr "" #: tfrmfinddlg.gbfiles.caption msgctxt "tfrmfinddlg.gbfiles.caption" msgid "Files" msgstr "" #: tfrmfinddlg.gbfinddata.caption msgctxt "tfrmfinddlg.gbfinddata.caption" msgid "Find Data" msgstr "" #: tfrmfinddlg.lblattributes.caption msgid "Attri&butes" msgstr "" #: tfrmfinddlg.lblencoding.caption msgid "Encodin&g:" msgstr "" #: tfrmfinddlg.lblexcludedirectories.caption msgid "E&xclude subdirectories" msgstr "" #: tfrmfinddlg.lblexcludefiles.caption msgid "&Exclude files" msgstr "" #: tfrmfinddlg.lblfindfilemask.caption msgid "&File mask" msgstr "" #: tfrmfinddlg.lblfindpathstart.caption msgid "Start in &directory" msgstr "" #: tfrmfinddlg.lblsearchdepth.caption msgid "Search su&bdirectories:" msgstr "" #: tfrmfinddlg.lbltemplateheader.caption msgid "&Previous searches:" msgstr "" #: tfrmfinddlg.miaction.caption msgid "&Action" msgstr "" #: tfrmfinddlg.mifreefrommemallothers.caption msgid "For all others, cancel, close and free from memory" msgstr "" #: tfrmfinddlg.miopeninnewtab.caption msgid "Open In New Tab(s)" msgstr "" #: tfrmfinddlg.mioptions.caption msgctxt "TFRMFINDDLG.MIOPTIONS.CAPTION" msgid "Options" msgstr "" #: tfrmfinddlg.miremovefromllist.caption msgid "Remove from list" msgstr "" #: tfrmfinddlg.miresult.caption msgid "&Result" msgstr "" #: tfrmfinddlg.miseparator1.caption msgctxt "TFRMFINDDLG.MISEPARATOR1.CAPTION" msgid "-" msgstr "" #: tfrmfinddlg.miseparator2.caption msgctxt "TFRMFINDDLG.MISEPARATOR2.CAPTION" msgid "-" msgstr "" #: tfrmfinddlg.mishowallfound.caption msgid "Show all found items" msgstr "" #: tfrmfinddlg.mishowineditor.caption msgid "Show In Editor" msgstr "" #: tfrmfinddlg.mishowinviewer.caption msgid "Show In Viewer" msgstr "" #: tfrmfinddlg.miviewtab.caption msgctxt "TFRMFINDDLG.MIVIEWTAB.CAPTION" msgid "&View" msgstr "" #: tfrmfinddlg.tsadvanced.caption msgid "Advanced" msgstr "" #: tfrmfinddlg.tsloadsave.caption msgid "Load/Save" msgstr "" #: tfrmfinddlg.tsplugins.caption msgctxt "tfrmfinddlg.tsplugins.caption" msgid "Plugins" msgstr "" #: tfrmfinddlg.tsresults.caption msgid "Results" msgstr "" #: tfrmfinddlg.tsstandard.caption msgid "Standard" msgstr "" #: tfrmfindview.btnclose.caption msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION" msgid "&Cancel" msgstr "" #: tfrmfindview.btnfind.caption msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION" msgid "&Find" msgstr "" #: tfrmfindview.caption msgctxt "TFRMFINDVIEW.CAPTION" msgid "Find" msgstr "" #: tfrmfindview.cbcasesens.caption msgid "C&ase sensitive" msgstr "" #: tfrmhardlink.btncancel.caption msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmhardlink.btnok.caption msgctxt "TFRMHARDLINK.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmhardlink.caption msgid "Create hard link" msgstr "" #: tfrmhardlink.lblexistingfile.caption msgctxt "tfrmhardlink.lblexistingfile.caption" msgid "&Destination that the link will point to" msgstr "" #: tfrmhardlink.lbllinktocreate.caption msgctxt "tfrmhardlink.lbllinktocreate.caption" msgid "&Link name" msgstr "" #: tfrmhotdirexportimport.btnselectall.caption msgctxt "tfrmhotdirexportimport.btnselectall.caption" msgid "Import all!" msgstr "" #: tfrmhotdirexportimport.btnselectiondone.caption msgctxt "tfrmhotdirexportimport.btnselectiondone.caption" msgid "Import selected" msgstr "" #: tfrmhotdirexportimport.caption msgid "Select the entries your want to import" msgstr "" #: tfrmhotdirexportimport.lbhint.caption msgid "When clicking a sub-menu, it will select the whole menu" msgstr "" #: tfrmhotdirexportimport.lblhintholdcontrol.caption msgid "Hold CTRL and click entries to select multiple ones" msgstr "" #: tfrmlinker.btnsave.caption msgctxt "tfrmlinker.btnsave.caption" msgid "..." msgstr "" #: tfrmlinker.caption msgid "Linker" msgstr "" #: tfrmlinker.gbsaveto.caption msgid "Save to..." msgstr "" #: tfrmlinker.grbxcontrol.caption msgid "Item" msgstr "" #: tfrmlinker.lblfilename.caption msgid "&File name" msgstr "" #: tfrmlinker.spbtndown.caption msgid "Do&wn" msgstr "" #: tfrmlinker.spbtndown.hint msgid "Down" msgstr "" #: tfrmlinker.spbtnrem.caption msgctxt "tfrmlinker.spbtnrem.caption" msgid "&Remove" msgstr "" #: tfrmlinker.spbtnrem.hint msgctxt "TFRMLINKER.SPBTNREM.HINT" msgid "Delete" msgstr "" #: tfrmlinker.spbtnup.caption msgctxt "tfrmlinker.spbtnup.caption" msgid "&Up" msgstr "" #: tfrmlinker.spbtnup.hint msgid "Up" msgstr "" #: tfrmmain.actabout.caption msgid "&About" msgstr "" #: tfrmmain.actaddfilenametocmdline.caption msgid "Add file name to command line" msgstr "" #: tfrmmain.actaddnewsearch.caption msgid "New search instance..." msgstr "" #: tfrmmain.actaddpathandfilenametocmdline.caption msgid "Add path and file name to command line" msgstr "" #: tfrmmain.actaddpathtocmdline.caption msgid "Copy path to command line" msgstr "" #: tfrmmain.actbriefview.caption msgid "Brief view" msgstr "" #: tfrmmain.actbriefview.hint msgid "Brief View" msgstr "" #: tfrmmain.actcalculatespace.caption msgid "Calculate &Occupied Space" msgstr "" #: tfrmmain.actchangedir.caption msgid "Change directory" msgstr "" #: tfrmmain.actchangedirtohome.caption msgid "Change directory to home" msgstr "" #: tfrmmain.actchangedirtoparent.caption msgid "Change Directory To Parent" msgstr "" #: tfrmmain.actchangedirtoroot.caption msgid "Change directory to root" msgstr "" #: tfrmmain.actchecksumcalc.caption msgid "Calculate Check&sum..." msgstr "" #: tfrmmain.actchecksumverify.caption msgid "&Verify Checksum..." msgstr "" #: tfrmmain.actclearlogfile.caption msgid "Clear log file" msgstr "" #: tfrmmain.actclearlogwindow.caption msgid "Clear log window" msgstr "" #: tfrmmain.actclosealltabs.caption msgid "Close &All Tabs" msgstr "" #: tfrmmain.actcloseduplicatetabs.caption msgid "Close Duplicate Tabs" msgstr "" #: tfrmmain.actclosetab.caption msgid "&Close Tab" msgstr "" #: tfrmmain.actcmdlinenext.caption msgid "Next Command Line" msgstr "" #: tfrmmain.actcmdlinenext.hint msgid "Set command line to next command in history" msgstr "" #: tfrmmain.actcmdlineprev.caption msgid "Previous Command Line" msgstr "" #: tfrmmain.actcmdlineprev.hint msgid "Set command line to previous command in history" msgstr "" #: tfrmmain.actcolumnsview.caption msgid "Full" msgstr "" #: tfrmmain.actcolumnsview.hint msgid "Columns View" msgstr "" #: tfrmmain.actcomparecontents.caption msgid "Compare by &Contents" msgstr "" #: tfrmmain.actcomparedirectories.caption msgctxt "tfrmmain.actcomparedirectories.caption" msgid "Compare Directories" msgstr "" #: tfrmmain.actcomparedirectories.hint msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT" msgid "Compare Directories" msgstr "" #: tfrmmain.actconfigdirhotlist.caption msgctxt "tfrmmain.actconfigdirhotlist.caption" msgid "Configuration of Directory Hotlist" msgstr "" #: tfrmmain.actconfigfavoritetabs.caption msgid "Configuration of Favorite Tabs" msgstr "" #: tfrmmain.actconfigfoldertabs.caption msgid "Configuration of folder tabs" msgstr "" #: tfrmmain.actconfighotkeys.caption msgctxt "tfrmmain.actconfighotkeys.caption" msgid "Configuration of hot keys" msgstr "" #: tfrmmain.actconfigsavesettings.caption msgid "Save Settings" msgstr "" #: tfrmmain.actconfigsearches.caption msgid "Configuration of searches" msgstr "" #: tfrmmain.actconfigtoolbars.caption msgid "Toolbar..." msgstr "" #: tfrmmain.actconfigtreeviewmenus.caption msgctxt "tfrmmain.actconfigtreeviewmenus.caption" msgid "Configuration of Tree View Menu" msgstr "" #: tfrmmain.actconfigtreeviewmenuscolors.caption msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption" msgid "Configuration of Tree View Menu Colors" msgstr "" #: tfrmmain.actcontextmenu.caption msgid "Show context menu" msgstr "" #: tfrmmain.actcopy.caption msgctxt "TFRMMAIN.ACTCOPY.CAPTION" msgid "Copy" msgstr "" #: tfrmmain.actcopyalltabstoopposite.caption msgid "Copy all tabs to opposite side" msgstr "" #: tfrmmain.actcopyfiledetailstoclip.caption msgid "Copy all shown &columns" msgstr "" #: tfrmmain.actcopyfullnamestoclip.caption msgid "Copy Filename(s) with Full &Path" msgstr "" #: tfrmmain.actcopynamestoclip.caption msgid "Copy &Filename(s) to Clipboard" msgstr "" #: tfrmmain.actcopynoask.caption msgid "Copy files without asking for confirmation" msgstr "" #: tfrmmain.actcopypathnosepoffilestoclip.caption msgid "Copy Full Path of selected file(s) with no ending dir separator" msgstr "" #: tfrmmain.actcopypathoffilestoclip.caption msgid "Copy Full Path of selected file(s)" msgstr "" #: tfrmmain.actcopysamepanel.caption msgid "Copy to same panel" msgstr "" #: tfrmmain.actcopytoclipboard.caption msgid "&Copy" msgstr "" #: tfrmmain.actcountdircontent.caption msgid "Sho&w Occupied Space" msgstr "" #: tfrmmain.actcuttoclipboard.caption msgid "Cu&t" msgstr "" #: tfrmmain.actdebugshowcommandparameters.caption msgid "Show Command Parameters" msgstr "" #: tfrmmain.actdelete.caption msgctxt "TFRMMAIN.ACTDELETE.CAPTION" msgid "Delete" msgstr "" #: tfrmmain.actdeletesearches.caption msgid "For all searches, cancel, close and free memory" msgstr "" #: tfrmmain.actdirhistory.caption msgid "Directory history" msgstr "" #: tfrmmain.actdirhotlist.caption msgid "Directory &Hotlist" msgstr "" #: tfrmmain.actdoanycmcommand.caption msgid "Select any command and execute it" msgstr "" #: tfrmmain.actedit.caption msgctxt "TFRMMAIN.ACTEDIT.CAPTION" msgid "Edit" msgstr "" #: tfrmmain.acteditcomment.caption msgid "Edit Co&mment..." msgstr "" #: tfrmmain.acteditnew.caption msgid "Edit new file" msgstr "" #: tfrmmain.acteditpath.caption msgid "Edit path field above file list" msgstr "" #: tfrmmain.actexchange.caption msgid "Swap &Panels" msgstr "" #: tfrmmain.actexecutescript.caption msgid "Execute Script" msgstr "" #: tfrmmain.actexit.caption msgctxt "TFRMMAIN.ACTEXIT.CAPTION" msgid "E&xit" msgstr "" #: tfrmmain.actextractfiles.caption msgid "&Extract Files..." msgstr "" #: tfrmmain.actfileassoc.caption msgid "Configuration of File &Associations" msgstr "" #: tfrmmain.actfilelinker.caption msgid "Com&bine Files..." msgstr "" #: tfrmmain.actfileproperties.caption msgid "Show &File Properties" msgstr "" #: tfrmmain.actfilespliter.caption msgid "Spl&it File..." msgstr "" #: tfrmmain.actflatview.caption msgid "&Flat view" msgstr "" #: tfrmmain.actfocuscmdline.caption msgid "Focus command line" msgstr "" #: tfrmmain.actfocusswap.caption msgid "Swap focus" msgstr "" #: tfrmmain.actfocusswap.hint msgid "Switch between left and right file list" msgstr "" #: tfrmmain.actgotofirstfile.caption msgid "Place cursor on first file in list" msgstr "" #: tfrmmain.actgotolastfile.caption msgid "Place cursor on last file in list" msgstr "" #: tfrmmain.acthardlink.caption msgid "Create &Hard Link..." msgstr "" #: tfrmmain.acthelpindex.caption msgid "&Contents" msgstr "" #: tfrmmain.acthorizontalfilepanels.caption msgid "&Horizontal Panels Mode" msgstr "" #: tfrmmain.actkeyboard.caption msgid "&Keyboard" msgstr "" #: tfrmmain.actleftbriefview.caption msgid "Brief view on left panel" msgstr "" #: tfrmmain.actleftcolumnsview.caption msgid "Columns view on left panel" msgstr "" #: tfrmmain.actleftequalright.caption msgid "Left &= Right" msgstr "" #: tfrmmain.actleftflatview.caption msgid "&Flat view on left panel" msgstr "" #: tfrmmain.actleftopendrives.caption msgid "Open left drive list" msgstr "" #: tfrmmain.actleftreverseorder.caption msgid "Re&verse order on left panel" msgstr "" #: tfrmmain.actleftsortbyattr.caption msgid "Sort left panel by &Attributes" msgstr "" #: tfrmmain.actleftsortbydate.caption msgid "Sort left panel by &Date" msgstr "" #: tfrmmain.actleftsortbyext.caption msgid "Sort left panel by &Extension" msgstr "" #: tfrmmain.actleftsortbyname.caption msgid "Sort left panel by &Name" msgstr "" #: tfrmmain.actleftsortbysize.caption msgid "Sort left panel by &Size" msgstr "" #: tfrmmain.actleftthumbview.caption msgid "Thumbnails view on left panel" msgstr "" #: tfrmmain.actloadfavoritetabs.caption msgid "Load tabs from Favorite Tabs" msgstr "" #: tfrmmain.actloadselectionfromclip.caption msgid "Load Selection from Clip&board" msgstr "" #: tfrmmain.actloadselectionfromfile.caption msgid "&Load Selection from File..." msgstr "" #: tfrmmain.actloadtabs.caption msgid "&Load Tabs from File" msgstr "" #: tfrmmain.actmakedir.caption msgid "Create &Directory" msgstr "" #: tfrmmain.actmarkcurrentextension.caption msgid "Select All with the Same E&xtension" msgstr "" #: tfrmmain.actmarkcurrentname.caption msgid "Select all files with same name" msgstr "" #: tfrmmain.actmarkcurrentnameext.caption msgid "Select all files with same name and extension" msgstr "" #: tfrmmain.actmarkcurrentpath.caption msgid "Select all in same path" msgstr "" #: tfrmmain.actmarkinvert.caption msgid "&Invert Selection" msgstr "" #: tfrmmain.actmarkmarkall.caption msgid "&Select All" msgstr "" #: tfrmmain.actmarkminus.caption msgid "Unselect a Gro&up..." msgstr "" #: tfrmmain.actmarkplus.caption msgid "Select a &Group..." msgstr "" #: tfrmmain.actmarkunmarkall.caption msgid "&Unselect All" msgstr "" #: tfrmmain.actminimize.caption msgid "Minimize window" msgstr "" #: tfrmmain.actmultirename.caption msgid "Multi &Rename Tool" msgstr "" #: tfrmmain.actnetworkconnect.caption msgid "Network &Connect..." msgstr "" #: tfrmmain.actnetworkdisconnect.caption msgid "Network &Disconnect" msgstr "" #: tfrmmain.actnetworkquickconnect.caption msgid "Network &Quick Connect..." msgstr "" #: tfrmmain.actnewtab.caption msgid "&New Tab" msgstr "" #: tfrmmain.actnextfavoritetabs.caption msgid "Load the Next Favorite Tabs in the list" msgstr "" #: tfrmmain.actnexttab.caption msgid "Switch to Nex&t Tab" msgstr "" #: tfrmmain.actopen.caption msgctxt "TFRMMAIN.ACTOPEN.CAPTION" msgid "Open" msgstr "" #: tfrmmain.actopenarchive.caption msgid "Try open archive" msgstr "" #: tfrmmain.actopenbar.caption msgid "Open bar file" msgstr "" #: tfrmmain.actopendirinnewtab.caption msgid "Open &Folder in a New Tab" msgstr "" #: tfrmmain.actopenvirtualfilesystemlist.caption msgid "Open &VFS List" msgstr "" #: tfrmmain.actoperationsviewer.caption msgid "Operations &Viewer" msgstr "" #: tfrmmain.actoptions.caption msgid "&Options..." msgstr "" #: tfrmmain.actpackfiles.caption msgid "&Pack Files..." msgstr "" #: tfrmmain.actpanelssplitterperpos.caption msgid "Set splitter position" msgstr "" #: tfrmmain.actpastefromclipboard.caption msgid "&Paste" msgstr "" #: tfrmmain.actpreviousfavoritetabs.caption msgid "Load the Previous Favorite Tabs in the list" msgstr "" #: tfrmmain.actprevtab.caption msgid "Switch to &Previous Tab" msgstr "" #: tfrmmain.actquickfilter.caption msgid "Quick filter" msgstr "" #: tfrmmain.actquicksearch.caption msgid "Quick search" msgstr "" #: tfrmmain.actquickview.caption msgid "&Quick View Panel" msgstr "" #: tfrmmain.actrefresh.caption msgid "&Refresh" msgstr "" #: tfrmmain.actreloadfavoritetabs.caption msgid "Reload the last Favorite Tabs loaded" msgstr "" #: tfrmmain.actrename.caption msgctxt "tfrmmain.actrename.caption" msgid "Move" msgstr "" #: tfrmmain.actrenamenoask.caption msgid "Move/Rename files without asking for confirmation" msgstr "" #: tfrmmain.actrenameonly.caption msgctxt "tfrmmain.actrenameonly.caption" msgid "Rename" msgstr "" #: tfrmmain.actrenametab.caption msgid "&Rename Tab" msgstr "" #: tfrmmain.actresavefavoritetabs.caption msgid "Resave on the last Favorite Tabs loaded" msgstr "" #: tfrmmain.actrestoreselection.caption msgid "&Restore Selection" msgstr "" #: tfrmmain.actreverseorder.caption msgid "Re&verse Order" msgstr "" #: tfrmmain.actrightbriefview.caption msgid "Brief view on right panel" msgstr "" #: tfrmmain.actrightcolumnsview.caption msgid "Columns view on right panel" msgstr "" #: tfrmmain.actrightequalleft.caption msgid "Right &= Left" msgstr "" #: tfrmmain.actrightflatview.caption msgid "&Flat view on right panel" msgstr "" #: tfrmmain.actrightopendrives.caption msgid "Open right drive list" msgstr "" #: tfrmmain.actrightreverseorder.caption msgid "Re&verse order on right panel" msgstr "" #: tfrmmain.actrightsortbyattr.caption msgid "Sort right panel by &Attributes" msgstr "" #: tfrmmain.actrightsortbydate.caption msgid "Sort right panel by &Date" msgstr "" #: tfrmmain.actrightsortbyext.caption msgid "Sort right panel by &Extension" msgstr "" #: tfrmmain.actrightsortbyname.caption msgid "Sort right panel by &Name" msgstr "" #: tfrmmain.actrightsortbysize.caption msgid "Sort right panel by &Size" msgstr "" #: tfrmmain.actrightthumbview.caption msgid "Thumbnails view on right panel" msgstr "" #: tfrmmain.actrunterm.caption msgid "Run &Terminal" msgstr "" #: tfrmmain.actsavefavoritetabs.caption msgid "Save current tabs to a New Favorite Tabs" msgstr "" #: tfrmmain.actsaveselection.caption msgid "Sa&ve Selection" msgstr "" #: tfrmmain.actsaveselectiontofile.caption msgid "Save S&election to File..." msgstr "" #: tfrmmain.actsavetabs.caption msgid "&Save Tabs to File" msgstr "" #: tfrmmain.actsearch.caption msgid "&Search..." msgstr "" #: tfrmmain.actsetalltabsoptiondirsinnewtab.caption msgid "All tabs Locked with Dir Opened in New Tabs" msgstr "" #: tfrmmain.actsetalltabsoptionnormal.caption msgid "Set all tabs to Normal" msgstr "" #: tfrmmain.actsetalltabsoptionpathlocked.caption msgid "Set all tabs to Locked" msgstr "" #: tfrmmain.actsetalltabsoptionpathresets.caption msgid "All tabs Locked with Dir Changes Allowed" msgstr "" #: tfrmmain.actsetfileproperties.caption msgid "Change &Attributes..." msgstr "" #: tfrmmain.actsettaboptiondirsinnewtab.caption msgid "Locked with Directories Opened in New &Tabs" msgstr "" #: tfrmmain.actsettaboptionnormal.caption msgid "&Normal" msgstr "" #: tfrmmain.actsettaboptionpathlocked.caption msgid "&Locked" msgstr "" #: tfrmmain.actsettaboptionpathresets.caption msgid "Locked with &Directory Changes Allowed" msgstr "" #: tfrmmain.actshellexecute.caption msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION" msgid "Open" msgstr "" #: tfrmmain.actshellexecute.hint msgid "Open using system associations" msgstr "" #: tfrmmain.actshowbuttonmenu.caption msgid "Show button menu" msgstr "" #: tfrmmain.actshowcmdlinehistory.caption msgid "Show command line history" msgstr "" #: tfrmmain.actshowmainmenu.caption msgid "Menu" msgstr "" #: tfrmmain.actshowsysfiles.caption msgid "Show &Hidden/System Files" msgstr "" #: tfrmmain.actsortbyattr.caption msgid "Sort by &Attributes" msgstr "" #: tfrmmain.actsortbydate.caption msgid "Sort by &Date" msgstr "" #: tfrmmain.actsortbyext.caption msgid "Sort by &Extension" msgstr "" #: tfrmmain.actsortbyname.caption msgid "Sort by &Name" msgstr "" #: tfrmmain.actsortbysize.caption msgid "Sort by &Size" msgstr "" #: tfrmmain.actsrcopendrives.caption msgid "Open drive list" msgstr "" #: tfrmmain.actswitchignorelist.caption msgid "Enable/disable ignore list file to not show file names" msgstr "" #: tfrmmain.actsymlink.caption msgid "Create Symbolic &Link..." msgstr "" #: tfrmmain.actsyncdirs.caption msgid "Synchronize dirs..." msgstr "" #: tfrmmain.acttargetequalsource.caption msgid "Target &= Source" msgstr "" #: tfrmmain.acttestarchive.caption msgid "&Test Archive(s)" msgstr "" #: tfrmmain.actthumbnailsview.caption msgctxt "tfrmmain.actthumbnailsview.caption" msgid "Thumbnails" msgstr "" #: tfrmmain.actthumbnailsview.hint msgid "Thumbnails View" msgstr "" #: tfrmmain.acttogglefullscreenconsole.caption msgid "Toggle fullscreen mode console" msgstr "" #: tfrmmain.acttransferleft.caption msgid "Transfer dir under cursor to left window" msgstr "" #: tfrmmain.acttransferright.caption msgid "Transfer dir under cursor to right window" msgstr "" #: tfrmmain.acttreeview.caption msgid "&Tree View Panel" msgstr "" #: tfrmmain.actuniversalsingledirectsort.caption msgid "Sort according to parameters" msgstr "" #: tfrmmain.actunmarkcurrentextension.caption msgid "Unselect All with the Same Ex&tension" msgstr "" #: tfrmmain.actunmarkcurrentname.caption msgid "Unselect all files with same name" msgstr "" #: tfrmmain.actunmarkcurrentnameext.caption msgid "Unselect all files with same name and extension" msgstr "" #: tfrmmain.actunmarkcurrentpath.caption msgid "Unselect all in same path" msgstr "" #: tfrmmain.actview.caption msgctxt "TFRMMAIN.ACTVIEW.CAPTION" msgid "View" msgstr "" #: tfrmmain.actviewhistory.caption msgid "Show history of visited paths for active view" msgstr "" #: tfrmmain.actviewhistorynext.caption msgid "Go to next entry in history" msgstr "" #: tfrmmain.actviewhistoryprev.caption msgid "Go to previous entry in history" msgstr "" #: tfrmmain.actviewlogfile.caption msgid "View log file" msgstr "" #: tfrmmain.actviewsearches.caption msgid "View current search instances" msgstr "" #: tfrmmain.actvisithomepage.caption msgid "&Visit Double Commander Website" msgstr "" #: tfrmmain.actwipe.caption msgid "Wipe" msgstr "" #: tfrmmain.actworkwithdirectoryhotlist.caption msgid "Work with Directory Hotlist and parameters" msgstr "" #: tfrmmain.btnf10.caption msgctxt "TFRMMAIN.BTNF10.CAPTION" msgid "Exit" msgstr "" #: tfrmmain.btnf7.caption msgctxt "tfrmmain.btnf7.caption" msgid "Directory" msgstr "" #: tfrmmain.btnf8.caption msgctxt "TFRMMAIN.BTNF8.CAPTION" msgid "Delete" msgstr "" #: tfrmmain.btnf9.caption msgctxt "tfrmmain.btnf9.caption" msgid "Terminal" msgstr "" #: tfrmmain.btnleftdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "" #: tfrmmain.btnleftdirectoryhotlist.hint msgctxt "tfrmmain.btnleftdirectoryhotlist.hint" msgid "Directory Hotlist" msgstr "" #: tfrmmain.btnleftequalright.caption msgctxt "tfrmmain.btnleftequalright.caption" msgid "<" msgstr "" #: tfrmmain.btnleftequalright.hint msgid "Show current directory of the right panel in the left panel" msgstr "" #: tfrmmain.btnlefthome.caption msgctxt "tfrmmain.btnlefthome.caption" msgid "~" msgstr "" #: tfrmmain.btnlefthome.hint msgid "Go to home directory" msgstr "" #: tfrmmain.btnleftroot.caption msgctxt "tfrmmain.btnleftroot.caption" msgid "/" msgstr "" #: tfrmmain.btnleftroot.hint msgid "Go to root directory" msgstr "" #: tfrmmain.btnleftup.caption msgctxt "tfrmmain.btnleftup.caption" msgid ".." msgstr "" #: tfrmmain.btnleftup.hint msgid "Go to parent directory" msgstr "" #: tfrmmain.btnrightdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "" #: tfrmmain.btnrightdirectoryhotlist.hint msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT" msgid "Directory Hotlist" msgstr "" #: tfrmmain.btnrightequalleft.caption msgctxt "tfrmmain.btnrightequalleft.caption" msgid ">" msgstr "" #: tfrmmain.btnrightequalleft.hint msgid "Show current directory of the left panel in the right panel" msgstr "" #: tfrmmain.btnrighthome.caption msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION" msgid "~" msgstr "" #: tfrmmain.btnrightroot.caption msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION" msgid "/" msgstr "" #: tfrmmain.btnrightup.caption msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION" msgid ".." msgstr "" #: tfrmmain.caption msgctxt "TFRMMAIN.CAPTION" msgid "Double Commander" msgstr "" #: tfrmmain.lblcommandpath.caption msgctxt "tfrmmain.lblcommandpath.caption" msgid "Path" msgstr "" #: tfrmmain.menuitem2.caption msgctxt "TFRMMAIN.MENUITEM2.CAPTION" msgid "-" msgstr "" #: tfrmmain.mi2080.caption msgid "&20/80" msgstr "" #: tfrmmain.mi3070.caption msgid "&30/70" msgstr "" #: tfrmmain.mi4060.caption msgid "&40/60" msgstr "" #: tfrmmain.mi5050.caption msgid "&50/50" msgstr "" #: tfrmmain.mi6040.caption msgid "&60/40" msgstr "" #: tfrmmain.mi7030.caption msgid "&70/30" msgstr "" #: tfrmmain.mi8020.caption msgid "&80/20" msgstr "" #: tfrmmain.micancel.caption msgctxt "TFRMMAIN.MICANCEL.CAPTION" msgid "Cancel" msgstr "" #: tfrmmain.micopy.caption msgid "Copy..." msgstr "" #: tfrmmain.mihardlink.caption msgid "Create link..." msgstr "" #: tfrmmain.miline1.caption msgctxt "TFRMMAIN.MILINE1.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline10.caption msgctxt "TFRMMAIN.MILINE10.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline11.caption msgctxt "TFRMMAIN.MILINE11.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline12.caption msgctxt "TFRMMAIN.MILINE12.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline13.caption msgctxt "TFRMMAIN.MILINE13.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline14.caption msgctxt "TFRMMAIN.MILINE14.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline15.caption msgctxt "TFRMMAIN.MILINE15.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline16.caption msgctxt "TFRMMAIN.MILINE16.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline17.caption msgctxt "TFRMMAIN.MILINE17.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline18.caption msgctxt "TFRMMAIN.MILINE18.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline19.caption msgctxt "TFRMMAIN.MILINE19.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline2.caption msgctxt "TFRMMAIN.MILINE2.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline20.caption msgctxt "TFRMMAIN.MILINE20.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline21.caption msgctxt "TFRMMAIN.MILINE21.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline22.caption msgctxt "TFRMMAIN.MILINE22.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline23.caption msgctxt "TFRMMAIN.MILINE23.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline24.caption msgctxt "TFRMMAIN.MILINE24.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline25.caption msgctxt "TFRMMAIN.MILINE25.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline26.caption msgctxt "TFRMMAIN.MILINE26.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline3.caption msgctxt "TFRMMAIN.MILINE3.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline32.caption msgctxt "TFRMMAIN.MILINE32.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline33.caption msgctxt "TFRMMAIN.MILINE33.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline37.caption msgctxt "TFRMMAIN.MILINE37.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline38.caption msgctxt "TFRMMAIN.MILINE38.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline39.caption msgctxt "TFRMMAIN.MILINE39.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline4.caption msgctxt "TFRMMAIN.MILINE4.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline40.caption msgctxt "TFRMMAIN.MILINE40.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline47.caption msgctxt "TFRMMAIN.MILINE47.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline5.caption msgctxt "TFRMMAIN.MILINE5.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline50.caption msgctxt "TFRMMAIN.MILINE50.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline55.caption msgctxt "TFRMMAIN.MILINE55.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline6.caption msgctxt "TFRMMAIN.MILINE6.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline7.caption msgctxt "TFRMMAIN.MILINE7.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline8.caption msgctxt "TFRMMAIN.MILINE8.CAPTION" msgid "-" msgstr "" #: tfrmmain.miline9.caption msgctxt "TFRMMAIN.MILINE9.CAPTION" msgid "-" msgstr "" #: tfrmmain.milogclear.caption msgid "Clear" msgstr "" #: tfrmmain.milogcopy.caption msgctxt "TFRMMAIN.MILOGCOPY.CAPTION" msgid "Copy" msgstr "" #: tfrmmain.miloghide.caption msgid "Hide" msgstr "" #: tfrmmain.milogselectall.caption msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION" msgid "Select All" msgstr "" #: tfrmmain.mimove.caption msgid "Move..." msgstr "" #: tfrmmain.misymlink.caption msgid "Create symlink..." msgstr "" #: tfrmmain.mitaboptions.caption msgid "Tab options" msgstr "" #: tfrmmain.mitrayiconexit.caption msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION" msgid "E&xit" msgstr "" #: tfrmmain.mitrayiconrestore.caption msgid "Restore" msgstr "" #: tfrmmain.mnualloperpause.caption msgctxt "tfrmmain.mnualloperpause.caption" msgid "||" msgstr "" #: tfrmmain.mnualloperstart.caption msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION" msgid "Start" msgstr "" #: tfrmmain.mnualloperstop.caption msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION" msgid "Cancel" msgstr "" #: tfrmmain.mnucmd.caption msgid "&Commands" msgstr "" #: tfrmmain.mnuconfig.caption msgid "C&onfiguration" msgstr "" #: tfrmmain.mnucontextline1.caption msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION" msgid "-" msgstr "" #: tfrmmain.mnucontextline2.caption msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION" msgid "-" msgstr "" #: tfrmmain.mnufavoritetabs.caption msgid "Favorites" msgstr "" #: tfrmmain.mnufiles.caption msgid "&Files" msgstr "" #: tfrmmain.mnuhelp.caption msgctxt "TFRMMAIN.MNUHELP.CAPTION" msgid "&Help" msgstr "" #: tfrmmain.mnumark.caption msgid "&Mark" msgstr "" #: tfrmmain.mnunetwork.caption msgctxt "tfrmmain.mnunetwork.caption" msgid "Network" msgstr "" #: tfrmmain.mnushow.caption msgid "&Show" msgstr "" #: tfrmmain.mnutaboptions.caption msgid "Tab &Options" msgstr "" #: tfrmmain.mnutabs.caption msgid "&Tabs" msgstr "" #: tfrmmain.tbchangedir.caption msgid "CD" msgstr "" #: tfrmmain.tbcopy.caption msgctxt "TFRMMAIN.TBCOPY.CAPTION" msgid "Copy" msgstr "" #: tfrmmain.tbcut.caption msgctxt "TFRMMAIN.TBCUT.CAPTION" msgid "Cut" msgstr "" #: tfrmmain.tbdelete.caption msgctxt "TFRMMAIN.TBDELETE.CAPTION" msgid "Delete" msgstr "" #: tfrmmain.tbedit.caption msgctxt "TFRMMAIN.TBEDIT.CAPTION" msgid "Edit" msgstr "" #: tfrmmain.tbpaste.caption msgctxt "TFRMMAIN.TBPASTE.CAPTION" msgid "Paste" msgstr "" #: tfrmmain.tbseparator.caption msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION" msgid "-" msgstr "" #: tfrmmaincommandsdlg.btncancel.caption msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmmaincommandsdlg.btnok.caption msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmmaincommandsdlg.caption msgid "Select your internal command" msgstr "" #: tfrmmaincommandsdlg.cbcategorysortornot.text msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text" msgid "Legacy sorted" msgstr "" #: tfrmmaincommandsdlg.cbcommandssortornot.text msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT" msgid "Legacy sorted" msgstr "" #: tfrmmaincommandsdlg.cbselectallcategorydefault.caption msgid "Select all categories by default" msgstr "" #: tfrmmaincommandsdlg.gbselection.caption msgid "Selection:" msgstr "" #: tfrmmaincommandsdlg.lblcategory.caption msgid "&Categories:" msgstr "" #: tfrmmaincommandsdlg.lblcommandname.caption msgid "Command &name:" msgstr "" #: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption msgid "&Filter:" msgstr "" #: tfrmmaincommandsdlg.lblhint.caption msgid "Hint:" msgstr "" #: tfrmmaincommandsdlg.lblhotkey.caption msgid "Hotkey:" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommand.caption msgid "cm_name" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommandcategory.caption msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption" msgid "Category" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommandhelp.caption msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption" msgid "Help" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommandhint.caption msgid "Hint" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption" msgid "Hotkey" msgstr "" #: tfrmmaskinputdlg.btnaddattribute.caption msgctxt "TFRMMASKINPUTDLG.BTNADDATTRIBUTE.CAPTION" msgid "&Add" msgstr "" #: tfrmmaskinputdlg.btnattrshelp.caption msgctxt "TFRMMASKINPUTDLG.BTNATTRSHELP.CAPTION" msgid "&Help" msgstr "" #: tfrmmaskinputdlg.btncancel.caption msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmmaskinputdlg.btndefinetemplate.caption msgid "&Define..." msgstr "" #: tfrmmaskinputdlg.btnok.caption msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmmaskinputdlg.chkcasesensitive.caption msgid "Case sensitive" msgstr "" #: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption msgid "Ignore accents and ligatures" msgstr "" #: tfrmmaskinputdlg.lblattributes.caption msgid "Attri&butes:" msgstr "" #: tfrmmaskinputdlg.lblprompt.caption msgid "Input Mask:" msgstr "" #: tfrmmaskinputdlg.lblsearchtemplate.caption msgid "O&r select predefined selection type:" msgstr "" #: tfrmmkdir.btncancel.caption msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmmkdir.btnok.caption msgctxt "TFRMMKDIR.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmmkdir.caption msgid "Create new directory" msgstr "" #: tfrmmkdir.lblmakedir.caption msgid "&Input new directory name:" msgstr "" #: tfrmmodview.btnpath1.caption msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION" msgid "..." msgstr "" #: tfrmmodview.btnpath2.caption msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION" msgid "..." msgstr "" #: tfrmmodview.btnpath3.caption msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION" msgid "..." msgstr "" #: tfrmmodview.btnpath4.caption msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION" msgid "..." msgstr "" #: tfrmmodview.btnpath5.caption msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION" msgid "..." msgstr "" #: tfrmmodview.caption msgctxt "tfrmmodview.caption" msgid "New Size" msgstr "" #: tfrmmodview.lblheight.caption msgid "Height :" msgstr "" #: tfrmmodview.lblpath1.caption msgctxt "tfrmmodview.lblpath1.caption" msgid "1" msgstr "" #: tfrmmodview.lblpath2.caption msgid "2" msgstr "" #: tfrmmodview.lblpath3.caption msgid "3" msgstr "" #: tfrmmodview.lblpath4.caption msgid "4" msgstr "" #: tfrmmodview.lblpath5.caption msgid "5" msgstr "" #: tfrmmodview.lblquality.caption msgid "Quality of compress to Jpg" msgstr "" #: tfrmmodview.lblwidth.caption msgid "Width :" msgstr "" #: tfrmmodview.rbbmp.caption msgid "BMP" msgstr "" #: tfrmmodview.rbico.caption msgid "ICO" msgstr "" #: tfrmmodview.rbjpg.caption msgid "JPG" msgstr "" #: tfrmmodview.rbpng.caption msgid "PNG" msgstr "" #: tfrmmodview.rbpnm.caption msgid "PNM" msgstr "" #: tfrmmodview.teheight.text msgctxt "tfrmmodview.teheight.text" msgid "Height" msgstr "" #: tfrmmodview.tequality.text msgid "80" msgstr "" #: tfrmmodview.tewidth.text msgctxt "tfrmmodview.tewidth.text" msgid "Width" msgstr "" #: tfrmmsg.lblmsg.caption msgid "456456465465465" msgstr "" #: tfrmmultirename.btnclose.caption msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION" msgid "&Close" msgstr "" #: tfrmmultirename.btndeletepreset.caption msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION" msgid "&Delete" msgstr "" #: tfrmmultirename.btnedit.caption msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION" msgid "&Edit" msgstr "" #: tfrmmultirename.btnextmenu.caption msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION" msgid "..." msgstr "" #: tfrmmultirename.btnloadpreset.caption msgid "&Load" msgstr "" #: tfrmmultirename.btnnamemenu.caption msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION" msgid "..." msgstr "" #: tfrmmultirename.btnrename.caption msgctxt "tfrmmultirename.btnrename.caption" msgid "&Rename" msgstr "" #: tfrmmultirename.btnrestore.caption msgid "Reset &all" msgstr "" #: tfrmmultirename.btnsavepreset.caption msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION" msgid "&Save" msgstr "" #: tfrmmultirename.caption msgid "MultiRename" msgstr "" #: tfrmmultirename.cblog.caption msgid "Ena&ble" msgstr "" #: tfrmmultirename.cbregexp.caption msgid "Regular e&xpressions" msgstr "" #: tfrmmultirename.cbusesubs.caption msgid "&Use substitution" msgstr "" #: tfrmmultirename.cmbxwidth.text msgid "01" msgstr "" #: tfrmmultirename.edinterval.text msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT" msgid "1" msgstr "" #: tfrmmultirename.edpoc.text msgctxt "TFRMMULTIRENAME.EDPOC.TEXT" msgid "1" msgstr "" #: tfrmmultirename.extension.caption msgid "[E] Extension" msgstr "" #: tfrmmultirename.gbcounter.caption msgid "Counter" msgstr "" #: tfrmmultirename.gbfindreplace.caption msgid "Find && Replace" msgstr "" #: tfrmmultirename.gblog.caption msgid "Log Result" msgstr "" #: tfrmmultirename.gbmaska.caption msgid "Mask" msgstr "" #: tfrmmultirename.gbpresets.caption msgid "Presets" msgstr "" #: tfrmmultirename.lbext.caption msgid "&Extension" msgstr "" #: tfrmmultirename.lbfind.caption msgid "&Find..." msgstr "" #: tfrmmultirename.lbinterval.caption msgid "&Interval" msgstr "" #: tfrmmultirename.lbname.caption msgid "File &Name" msgstr "" #: tfrmmultirename.lbreplace.caption msgid "Re&place..." msgstr "" #: tfrmmultirename.lbstnb.caption msgid "S&tart Number" msgstr "" #: tfrmmultirename.lbwidth.caption msgid "&Width" msgstr "" #: tfrmmultirename.micounter.caption msgid "[C] Counter" msgstr "" #: tfrmmultirename.miday.caption msgid "[D] Day" msgstr "" #: tfrmmultirename.miday1.caption msgid "[DD] Day (2 digits)" msgstr "" #: tfrmmultirename.miday2.caption msgid "[DDD] Day of the week (short, e.g., \"mon\")" msgstr "" #: tfrmmultirename.miday3.caption msgid "[DDDD] Day of the week (long, e.g., \"monday\")" msgstr "" #: tfrmmultirename.miextensionx.caption msgid "[Ex] Character at position x" msgstr "" #: tfrmmultirename.miextensionxx.caption msgid "[Ex:y] Characters from position x to y" msgstr "" #: tfrmmultirename.mihour.caption msgid "[h] Hour" msgstr "" #: tfrmmultirename.mihour1.caption msgid "[hh] Hour (2 digits)" msgstr "" #: tfrmmultirename.miminute.caption msgid "[n] Minute" msgstr "" #: tfrmmultirename.miminute1.caption msgid "[nn] Minute (2 digits)" msgstr "" #: tfrmmultirename.mimonth.caption msgid "[M] Month" msgstr "" #: tfrmmultirename.mimonth1.caption msgid "[MM] Month (2 digits)" msgstr "" #: tfrmmultirename.mimonth2.caption msgid "[MMM] Month name (short, e.g., \"jan\")" msgstr "" #: tfrmmultirename.mimonth3.caption msgid "[MMMM] Month name (long, e.g., \"january\")" msgstr "" #: tfrmmultirename.miname.caption msgid "[N] Name" msgstr "" #: tfrmmultirename.minamex.caption msgid "[Nx] Character at position x" msgstr "" #: tfrmmultirename.minamexx.caption msgid "[Nx:y] Characters from position x to y" msgstr "" #: tfrmmultirename.minext.caption msgid "Time..." msgstr "" #: tfrmmultirename.minextextension.caption msgid "Extension..." msgstr "" #: tfrmmultirename.minextname.caption msgid "Name..." msgstr "" #: tfrmmultirename.miplugin.caption msgctxt "tfrmmultirename.miplugin.caption" msgid "Plugin" msgstr "" #: tfrmmultirename.misecond.caption msgid "[s] Second" msgstr "" #: tfrmmultirename.misecond1.caption msgid "[ss] Second (2 digits)" msgstr "" #: tfrmmultirename.miyear.caption msgid "[Y] Year (2 digits)" msgstr "" #: tfrmmultirename.miyear1.caption msgid "[YYYY] Year (4 digits)" msgstr "" #: tfrmmultirename.mnueditnames.caption msgid "Edit names..." msgstr "" #: tfrmmultirename.mnuloadfromfile.caption msgid "Load names from file..." msgstr "" #: tfrmmultirename.n1.caption msgctxt "TFRMMULTIRENAME.N1.CAPTION" msgid "-" msgstr "" #: tfrmmultirename.n2.caption msgctxt "TFRMMULTIRENAME.N2.CAPTION" msgid "-" msgstr "" #: tfrmmultirename.n3.caption msgctxt "TFRMMULTIRENAME.N3.CAPTION" msgid "-" msgstr "" #: tfrmmultirename.n4.caption msgctxt "TFRMMULTIRENAME.N4.CAPTION" msgid "-" msgstr "" #: tfrmmultirename.n5.caption msgctxt "TFRMMULTIRENAME.N5.CAPTION" msgid "-" msgstr "" #: tfrmmultirename.stringgrid.columns[0].title.caption msgid "Old File Name" msgstr "" #: tfrmmultirename.stringgrid.columns[1].title.caption msgid "New File Name" msgstr "" #: tfrmmultirename.stringgrid.columns[2].title.caption msgid "File Path" msgstr "" #: tfrmmultirenamewait.caption msgctxt "TFRMMULTIRENAMEWAIT.CAPTION" msgid "Double Commander" msgstr "" #: tfrmmultirenamewait.lblmessage.caption msgid "Click OK when you have closed the editor to load the changed names!" msgstr "" #: tfrmopenwith.caption msgid "Choose an application" msgstr "" #: tfrmopenwith.chkcustomcommand.caption msgid "Custom command" msgstr "" #: tfrmopenwith.chksaveassociation.caption msgid "Save association" msgstr "" #: tfrmopenwith.chkuseasdefault.caption msgid "Set selected application as default action" msgstr "" #: tfrmopenwith.lblmimetype.caption msgid "File type to be opened: %s" msgstr "" #: tfrmopenwith.milistoffiles.caption msgid "Multiple file names" msgstr "" #: tfrmopenwith.milistoffiles.hint msgid "%F" msgstr "" #: tfrmopenwith.milistofurls.caption msgid "Multiple URIs" msgstr "" #: tfrmopenwith.milistofurls.hint msgid "%U" msgstr "" #: tfrmopenwith.misinglefilename.caption msgid "Single file name" msgstr "" #: tfrmopenwith.misinglefilename.hint msgid "%f" msgstr "" #: tfrmopenwith.misingleurl.caption msgid "Single URI" msgstr "" #: tfrmopenwith.misingleurl.hint msgid "%u" msgstr "" #: tfrmoptions.btnapply.caption msgid "&Apply" msgstr "" #: tfrmoptions.btncancel.caption msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmoptions.btnok.caption msgctxt "TFRMOPTIONS.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmoptions.caption msgctxt "tfrmoptions.caption" msgid "Options" msgstr "" #: tfrmoptions.lblemptyeditor.caption msgid "Please select one of the subpages, this page does not contain any settings." msgstr "" #: tfrmoptionsarchivers.btnautoconfig.caption msgid "A&uto Configure" msgstr "" #: tfrmoptionsarchivers.btnmultiarcadd.caption msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION" msgid "A&dd" msgstr "" #: tfrmoptionsarchivers.btnmultiarcapply.caption msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption" msgid "A&pply" msgstr "" #: tfrmoptionsarchivers.btnmultiarcdelete.caption msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption" msgid "D&elete" msgstr "" #: tfrmoptionsarchivers.btnmultiarcrename.caption msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION" msgid "&Rename" msgstr "" #: tfrmoptionsarchivers.btnrelativearchiver.hint msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsarchivers.chkmultiarcdebug.caption msgid "De&bug mode" msgstr "" #: tfrmoptionsarchivers.chkmultiarcenabled.caption msgid "E&nabled" msgstr "" #: tfrmoptionsarchivers.chkmultiarcoutput.caption msgid "S&how console output" msgstr "" #: tfrmoptionsarchivers.gbarchiveroptions.caption msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION" msgid "Options" msgstr "" #: tfrmoptionsarchivers.lblarchiveadd.caption msgid "Add&ing:" msgstr "" #: tfrmoptionsarchivers.lblarchiveextension.caption msgid "E&xtension:" msgstr "" #: tfrmoptionsarchivers.lblarchiveextract.caption msgid "Ex&tract:" msgstr "" #: tfrmoptionsarchivers.lblarchivelist.caption msgid "&List:" msgstr "" #: tfrmoptionsarchivers.lblarchivelistend.caption msgid "Listing &finish (optional):" msgstr "" #: tfrmoptionsarchivers.lblarchivelistformat.caption msgid "Listing for&mat:" msgstr "" #: tfrmoptionsarchivers.lblarchiveliststart.caption msgid "Listin&g start (optional):" msgstr "" #: tfrmoptionsarchivers.lblarchiver.caption msgid "Arc&hiver:" msgstr "" #: tfrmoptionsarchivers.lbldescription.caption msgid "De&scription:" msgstr "" #: tfrmoptionsarchivers.tbarchiveradditional.caption msgid "Additional" msgstr "" #: tfrmoptionsarchivers.tbarchivergeneral.caption msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption" msgid "General" msgstr "" #: tfrmoptionsautorefresh.cbwatchattributeschange.caption msgid "When &size, date or attributes change" msgstr "" #: tfrmoptionsautorefresh.cbwatchexcludedirs.caption msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption" msgid "For the following &paths and their subdirectories:" msgstr "" #: tfrmoptionsautorefresh.cbwatchfilenamechange.caption msgid "When &files are created, deleted or renamed" msgstr "" #: tfrmoptionsautorefresh.cbwatchonlyforeground.caption msgid "When application is in the &background" msgstr "" #: tfrmoptionsautorefresh.gbautorefreshdisable.caption msgid "Disable auto-refresh" msgstr "" #: tfrmoptionsautorefresh.gbautorefreshenable.caption msgid "Refresh file list" msgstr "" #: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption msgid "Al&ways show tray icon" msgstr "" #: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption msgid "Automatically &hide unmounted devices" msgstr "" #: tfrmoptionsbehavior.cbminimizetotray.caption msgid "Mo&ve icon to system tray when minimized" msgstr "" #: tfrmoptionsbehavior.cbonlyonce.caption msgid "A&llow only one copy of DC at a time" msgstr "" #: tfrmoptionsbehavior.edtdrivesblacklist.hint msgid "Here you can enter one or more drives or mount points, separated by \";\"." msgstr "" #: tfrmoptionsbehavior.lbldrivesblacklist.caption msgid "Drives &blacklist" msgstr "" #: tfrmoptionsbriefview.gbcolumns.caption msgid "Columns size" msgstr "" #: tfrmoptionsbriefview.gbshowfileext.caption msgid "Show file extensions" msgstr "" #: tfrmoptionsbriefview.rbaligned.caption msgid "ali&gned (with Tab)" msgstr "" #: tfrmoptionsbriefview.rbdirectly.caption msgid "di&rectly after filename" msgstr "" #: tfrmoptionsbriefview.rbuseautosize.caption msgid "Auto" msgstr "" #: tfrmoptionsbriefview.rbusefixedcount.caption msgid "Fixed columns count" msgstr "" #: tfrmoptionsbriefview.rbusefixedwidth.caption msgid "Fixed columns width" msgstr "" #: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption msgid "Cut &text to column width" msgstr "" #: tfrmoptionscolumnsview.cbextendcellwidth.caption msgid "&Extend cell width if text is not fitting into column" msgstr "" #: tfrmoptionscolumnsview.cbgridhorzline.caption msgid "&Horizontal lines" msgstr "" #: tfrmoptionscolumnsview.cbgridvertline.caption msgid "&Vertical lines" msgstr "" #: tfrmoptionscolumnsview.chkautofillcolumns.caption msgid "A&uto fill columns" msgstr "" #: tfrmoptionscolumnsview.gbshowgrid.caption msgid "Show grid" msgstr "" #: tfrmoptionscolumnsview.grpautosizecolumns.caption msgid "Auto-size columns" msgstr "" #: tfrmoptionscolumnsview.lblautosizecolumn.caption msgid "Auto si&ze column:" msgstr "" #: tfrmoptionsconfiguration.btnconfigapply.caption msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION" msgid "A&pply" msgstr "" #: tfrmoptionsconfiguration.btnconfigedit.caption msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION" msgid "&Edit" msgstr "" #: tfrmoptionsconfiguration.cbcmdlinehistory.caption msgid "Co&mmand line history" msgstr "" #: tfrmoptionsconfiguration.cbdirhistory.caption msgid "&Directory history" msgstr "" #: tfrmoptionsconfiguration.cbfilemaskhistory.caption msgid "&File mask history" msgstr "" #: tfrmoptionsconfiguration.chksaveconfiguration.caption msgid "Sa&ve configuration" msgstr "" #: tfrmoptionsconfiguration.chksearchreplacehistory.caption msgid "Searc&h/Replace history" msgstr "" #: tfrmoptionsconfiguration.gbdirectories.caption msgctxt "TFRMOPTIONSCONFIGURATION.GBDIRECTORIES.CAPTION" msgid "Directories" msgstr "" #: tfrmoptionsconfiguration.gblocconfigfiles.caption msgid "Location of configuration files" msgstr "" #: tfrmoptionsconfiguration.gbsaveonexit.caption msgid "Save on exit" msgstr "" #: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption msgid "Sort order of configuration order in left tree" msgstr "" #: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption msgid "Set on command line" msgstr "" #: tfrmoptionsconfiguration.lbliconthemes.caption msgid "Icon themes:" msgstr "" #: tfrmoptionsconfiguration.lblthumbcache.caption msgid "Thumbnails cache:" msgstr "" #: tfrmoptionsconfiguration.rbprogramdir.caption msgid "P&rogram directory (portable version)" msgstr "" #: tfrmoptionsconfiguration.rbuserhomedir.caption msgid "&User home directory" msgstr "" #: tfrmoptionscustomcolumns.btnallallowovercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallallowovercolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallbackcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallbackcolor2.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallcursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallcursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallcursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallcursortext.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallfont.caption msgctxt "tfrmoptionscustomcolumns.btnallfont.caption" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallfont.hint msgctxt "tfrmoptionscustomcolumns.btnallfont.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallforecolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnallmarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION" msgid "All" msgstr "" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btnbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btncursorbordercolor.caption msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btncursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btncursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION" msgid "&Delete" msgstr "" #: tfrmoptionscustomcolumns.btnfont.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION" msgid "..." msgstr "" #: tfrmoptionscustomcolumns.btnforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btngotosetdefault.caption msgid "Go to set default" msgstr "" #: tfrmoptionscustomcolumns.btngotosetdefault.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btninactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btninactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btnmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionscustomcolumns.btnnewconfig.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION" msgid "New" msgstr "" #: tfrmoptionscustomcolumns.btnnext.caption msgid "Next" msgstr "" #: tfrmoptionscustomcolumns.btnprev.caption msgid "Previous" msgstr "" #: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION" msgid "Rename" msgstr "" #: tfrmoptionscustomcolumns.btnresetallowovercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetallowovercolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetbackcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetbackcolor2.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursorborder.caption msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursorborder.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursortext.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetfont.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetfont.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetforecolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetframecursor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetframecursor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetmarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION" msgid "R" msgstr "" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION" msgid "Save as" msgstr "" #: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION" msgid "Save" msgstr "" #: tfrmoptionscustomcolumns.cballowovercolor.caption msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption" msgid "Allow Overcolor" msgstr "" #: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption msgid "When clicking to change something, change for all columns" msgstr "" #: tfrmoptionscustomcolumns.cbconfigcolumns.text msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT" msgid "General" msgstr "" #: tfrmoptionscustomcolumns.cbcursorborder.caption msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption" msgid "Cursor border" msgstr "" #: tfrmoptionscustomcolumns.cbuseframecursor.caption msgid "Use Frame Cursor" msgstr "" #: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption msgid "Use Inactive Selection Color" msgstr "" #: tfrmoptionscustomcolumns.cbuseinvertedselection.caption msgid "Use Inverted Selection" msgstr "" #: tfrmoptionscustomcolumns.chkusecustomview.caption msgid "Use custom font and color for this view" msgstr "" #: tfrmoptionscustomcolumns.lblbackcolor.caption msgid "BackGround:" msgstr "" #: tfrmoptionscustomcolumns.lblbackcolor2.caption msgid "Background 2:" msgstr "" #: tfrmoptionscustomcolumns.lblconfigcolumns.caption msgid "Con&figure columns view:" msgstr "" #: tfrmoptionscustomcolumns.lblcurrentcolumn.caption msgid "[Current Column Name]" msgstr "" #: tfrmoptionscustomcolumns.lblcursorcolor.caption msgid "Cursor Color:" msgstr "" #: tfrmoptionscustomcolumns.lblcursortext.caption msgid "Cursor Text:" msgstr "" #: tfrmoptionscustomcolumns.lblfontname.caption msgid "Font:" msgstr "" #: tfrmoptionscustomcolumns.lblfontsize.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION" msgid "Size:" msgstr "" #: tfrmoptionscustomcolumns.lblforecolor.caption msgid "Text Color:" msgstr "" #: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption" msgid "Inactive Cursor Color:" msgstr "" #: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption" msgid "Inactive Mark Color:" msgstr "" #: tfrmoptionscustomcolumns.lblmarkcolor.caption msgid "Mark Color:" msgstr "" #: tfrmoptionscustomcolumns.lblpreviewtop.caption msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "" #: tfrmoptionscustomcolumns.lblworkingcolumn.caption msgid "Settings for column:" msgstr "" #: tfrmoptionscustomcolumns.miaddcolumn.caption msgid "Add column" msgstr "" #: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption msgid "Position of frame panel after the comparison:" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption msgid "Add directory of the &active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption msgid "Add &directories of the active && inactive frames" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption msgid "Add directory I will bro&wse to" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption" msgid "Add a copy of the selected entry" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption msgid "Add current &selected or active directories of active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddseparator.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption" msgid "Add a separator" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption msgid "Add a sub menu" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption" msgid "Add directory I will type" msgstr "" #: tfrmoptionsdirectoryhotlist.actcollapseall.caption msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption" msgid "Collapse all" msgstr "" #: tfrmoptionsdirectoryhotlist.actcollapseitem.caption msgid "Collapse item" msgstr "" #: tfrmoptionsdirectoryhotlist.actcut.caption msgid "Cut selection of entries" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeleteall.caption msgid "Delete all!" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption" msgid "Delete selected item" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption msgid "Delete sub-menu and all its elements" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption msgid "Delete just sub-menu but keep elements" msgstr "" #: tfrmoptionsdirectoryhotlist.actexpanditem.caption msgid "Expand item" msgstr "" #: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption msgid "Focus tree window" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption msgid "Goto first item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotolastitem.caption msgid "Goto last item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotonextitem.caption msgid "Go to next item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption msgid "Go to previous item" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption msgid "Insert directory of the &active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption msgid "Insert &directories of the active && inactive frames" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption msgid "Insert directory I will bro&wse to" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption msgid "Insert a copy of the selected entry" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption msgid "Insert current &selected or active directories of active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertseparator.caption msgid "Insert a separator" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption msgid "Insert sub menu" msgstr "" #: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption" msgid "Insert directory I will type" msgstr "" #: tfrmoptionsdirectoryhotlist.actmovetonext.caption msgid "Move to next" msgstr "" #: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption msgid "Move to previous" msgstr "" #: tfrmoptionsdirectoryhotlist.actopenallbranches.caption msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption" msgid "Open all branches" msgstr "" #: tfrmoptionsdirectoryhotlist.actpaste.caption msgid "Paste what was cut" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption msgid "Search && replace in &path" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption msgid "Search && replace in both path and target" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption msgid "Search && replace in &target path" msgstr "" #: tfrmoptionsdirectoryhotlist.acttweakpath.caption msgid "Tweak path" msgstr "" #: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption msgid "Tweak target path" msgstr "" #: tfrmoptionsdirectoryhotlist.btnadd.caption msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption" msgid "A&dd..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnbackup.caption msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption" msgid "Bac&kup..." msgstr "" #: tfrmoptionsdirectoryhotlist.btndelete.caption msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption" msgid "De&lete..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnexport.caption msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption" msgid "E&xport..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnhelp.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION" msgid "&Help" msgstr "" #: tfrmoptionsdirectoryhotlist.btnimport.caption msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption" msgid "Impo&rt..." msgstr "" #: tfrmoptionsdirectoryhotlist.btninsert.caption msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption" msgid "&Insert..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption msgid "&Miscellaneous..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnrelativepath.hint msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint msgid "Some functions to select appropriate target" msgstr "" #: tfrmoptionsdirectoryhotlist.btnsort.caption msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption" msgid "&Sort..." msgstr "" #: tfrmoptionsdirectoryhotlist.cbaddtarget.caption msgid "&When adding directory, add also target" msgstr "" #: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption" msgid "Alwa&ys expand tree" msgstr "" #: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption msgid "Show only &valid environment variables" msgstr "" #: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption msgid "In pop&up, show [path also]" msgstr "" #: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text" msgid "Name, a-z" msgstr "" #: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT" msgid "Name, a-z" msgstr "" #: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption msgid "Directory Hotlist (reorder by drag && drop)" msgstr "" #: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption" msgid "Other options" msgstr "" #: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION" msgid "Name:" msgstr "" #: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION" msgid "Path:" msgstr "" #: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption msgid "&Target:" msgstr "" #: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption" msgid "...current le&vel of item(s) selected only" msgstr "" #: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption msgid "Scan all &hotdir's path to validate the ones that actually exist" msgstr "" #: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption msgid "&Scan all hotdir's path && target to validate the ones that actually exist" msgstr "" #: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption msgid "to a Directory &Hotlist file (.hotlist)" msgstr "" #: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption" msgid "to a \"wincmd.ini\" of TC (&keep existing)" msgstr "" #: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption" msgid "to a \"wincmd.ini\" of TC (&erase existing)" msgstr "" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption" msgid "Go to &configure TC related info" msgstr "" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION" msgid "Go to &configure TC related info" msgstr "" #: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption msgid "HotDirTestMenu" msgstr "" #: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption msgid "from a Directory &Hotlist file (.hotlist)" msgstr "" #: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption msgid "from \"&wincmd.ini\" of TC" msgstr "" #: tfrmoptionsdirectoryhotlist.minavigate.caption msgid "&Navigate..." msgstr "" #: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption msgid "&Restore a backup of Directory Hotlist" msgstr "" #: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption msgid "&Save a backup of current Directory Hotlist" msgstr "" #: tfrmoptionsdirectoryhotlist.misearchandreplace.caption msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption" msgid "Search and &replace..." msgstr "" #: tfrmoptionsdirectoryhotlist.misorteverything.caption msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption" msgid "...everything, from A to &Z!" msgstr "" #: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption" msgid "...single &group of item(s) only" msgstr "" #: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption" msgid "...&content of submenu(s) selected, no sublevel" msgstr "" #: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption" msgid "...content of submenu(s) selected and &all sublevels" msgstr "" #: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption" msgid "Test resultin&g menu" msgstr "" #: tfrmoptionsdirectoryhotlist.mitweakpath.caption msgid "Tweak &path" msgstr "" #: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption msgid "Tweak &target path" msgstr "" #: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption msgid "Addition from main panel" msgstr "" #: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption msgid "From all the supported formats, ask which one to use every time" msgstr "" #: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)" msgstr "" #: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption msgid "When dropping text, generate filename automatically (otherwise will prompt the user)" msgstr "" #: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption msgid "&Show confirmation dialog after drop" msgstr "" #: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption msgid "When drag && dropping text into panels:" msgstr "" #: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption msgid "Place the most desired format on top of list (use dag && drop):" msgstr "" #: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption msgid "(if the most desired is not present, we'll take second one and so on)" msgstr "" #: tfrmoptionsdragdrop.lblwarningforaskformat.caption msgid "(will not work with some source application, so try to uncheck if problem)" msgstr "" #: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption msgid "Show &file system" msgstr "" #: tfrmoptionsdriveslistbutton.cbshowfreespace.caption msgid "Show fr&ee space" msgstr "" #: tfrmoptionsdriveslistbutton.cbshowlabel.caption msgid "Show &label" msgstr "" #: tfrmoptionsdriveslistbutton.gbdriveslist.caption msgid "Drives list" msgstr "" #: tfrmoptionseditor.chkscrollpastendline.caption msgid "Caret past end of line" msgstr "" #: tfrmoptionseditor.chkshowspecialchars.caption msgid "Show special characters" msgstr "" #: tfrmoptionseditor.gbinternaleditor.caption msgid "Internal editor options" msgstr "" #: tfrmoptionseditorcolors.backgroundlabel.caption msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption" msgid "Bac&kground" msgstr "" #: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION" msgid "Bac&kground" msgstr "" #: tfrmoptionseditorcolors.btnresetmask.hint msgid "Reset" msgstr "" #: tfrmoptionseditorcolors.btnsavemask.hint msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT" msgid "Save" msgstr "" #: tfrmoptionseditorcolors.bvlattributesection.caption msgid "Element Attributes" msgstr "" #: tfrmoptionseditorcolors.foregroundlabel.caption msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption" msgid "Fo®round" msgstr "" #: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION" msgid "Fo®round" msgstr "" #: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption msgid "&Text-mark" msgstr "" #: tfrmoptionseditorcolors.tbtnglobal.caption msgid "Use (and edit) &global scheme settings" msgstr "" #: tfrmoptionseditorcolors.tbtnlocal.caption msgid "Use &local scheme settings" msgstr "" #: tfrmoptionseditorcolors.textboldcheckbox.caption msgid "&Bold" msgstr "" #: tfrmoptionseditorcolors.textboldradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION" msgid "In&vert" msgstr "" #: tfrmoptionseditorcolors.textboldradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION" msgid "O&ff" msgstr "" #: tfrmoptionseditorcolors.textboldradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION" msgid "O&n" msgstr "" #: tfrmoptionseditorcolors.textitaliccheckbox.caption msgid "&Italic" msgstr "" #: tfrmoptionseditorcolors.textitalicradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION" msgid "In&vert" msgstr "" #: tfrmoptionseditorcolors.textitalicradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION" msgid "O&ff" msgstr "" #: tfrmoptionseditorcolors.textitalicradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION" msgid "O&n" msgstr "" #: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption msgid "&Strike Out" msgstr "" #: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION" msgid "In&vert" msgstr "" #: tfrmoptionseditorcolors.textstrikeoutradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION" msgid "O&ff" msgstr "" #: tfrmoptionseditorcolors.textstrikeoutradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION" msgid "O&n" msgstr "" #: tfrmoptionseditorcolors.textunderlinecheckbox.caption msgid "&Underline" msgstr "" #: tfrmoptionseditorcolors.textunderlineradioinvert.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption" msgid "In&vert" msgstr "" #: tfrmoptionseditorcolors.textunderlineradiooff.caption msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption" msgid "O&ff" msgstr "" #: tfrmoptionseditorcolors.textunderlineradioon.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption" msgid "O&n" msgstr "" #: tfrmoptionsfavoritetabs.btnadd.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION" msgid "Add..." msgstr "" #: tfrmoptionsfavoritetabs.btndelete.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION" msgid "Delete..." msgstr "" #: tfrmoptionsfavoritetabs.btnimportexport.caption msgid "Import/Export" msgstr "" #: tfrmoptionsfavoritetabs.btninsert.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION" msgid "Insert..." msgstr "" #: tfrmoptionsfavoritetabs.btnrename.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION" msgid "Rename" msgstr "" #: tfrmoptionsfavoritetabs.btnsort.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION" msgid "Sort..." msgstr "" #: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text" msgid "None" msgstr "" #: tfrmoptionsfavoritetabs.cbfullexpandtree.caption msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION" msgid "Always expand tree" msgstr "" #: tfrmoptionsfavoritetabs.cbsavedirhistory.text msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text" msgid "No" msgstr "" #: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text" msgid "Left" msgstr "" #: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text" msgid "Right" msgstr "" #: tfrmoptionsfavoritetabs.gbfavoritetabs.caption msgid "Favorite Tabs list (reorder by drag && drop)" msgstr "" #: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION" msgid "Other options" msgstr "" #: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption msgid "What to restore where for the selected entry:" msgstr "" #: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption msgid "Existing tabs to keep:" msgstr "" #: tfrmoptionsfavoritetabs.lblsavedirhistory.caption msgid "Save dir history:" msgstr "" #: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption msgid "Tabs saved on left to be restored to:" msgstr "" #: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption msgid "Tabs saved on right to be restored to:" msgstr "" #: tfrmoptionsfavoritetabs.menuitem1.caption msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.menuitem2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.miaddseparator.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION" msgid "a separator" msgstr "" #: tfrmoptionsfavoritetabs.miaddseparator2.caption msgid "Add separator" msgstr "" #: tfrmoptionsfavoritetabs.miaddsubmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION" msgid "sub-menu" msgstr "" #: tfrmoptionsfavoritetabs.miaddsubmenu2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION" msgid "Add sub-menu" msgstr "" #: tfrmoptionsfavoritetabs.micollapseall.caption msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION" msgid "Collapse all" msgstr "" #: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION" msgid "...current level of item(s) selected only" msgstr "" #: tfrmoptionsfavoritetabs.micutselection.caption msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION" msgid "Cut" msgstr "" #: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION" msgid "delete all!" msgstr "" #: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION" msgid "sub-menu and all its elements" msgstr "" #: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION" msgid "just sub-menu but keep elements" msgstr "" #: tfrmoptionsfavoritetabs.mideleteselectedentry.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION" msgid "selected item" msgstr "" #: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION" msgid "Delete selected item" msgstr "" #: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption msgid "Export selection to legacy .tab file(s)" msgstr "" #: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption msgid "FavoriteTabsTestMenu" msgstr "" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption msgid "Import legacy .tab file(s) according to default setting" msgstr "" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION" msgid "Import legacy .tab file(s) at selected position" msgstr "" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption" msgid "Import legacy .tab file(s) at selected position" msgstr "" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption msgid "Import legacy .tab file(s) at selected position in a sub menu" msgstr "" #: tfrmoptionsfavoritetabs.miinsertseparator.caption msgid "Insert separator" msgstr "" #: tfrmoptionsfavoritetabs.miinsertsubmenu.caption msgid "Insert sub-menu" msgstr "" #: tfrmoptionsfavoritetabs.miopenallbranches.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION" msgid "Open all branches" msgstr "" #: tfrmoptionsfavoritetabs.mipasteselection.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION" msgid "Paste" msgstr "" #: tfrmoptionsfavoritetabs.mirename.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION" msgid "Rename" msgstr "" #: tfrmoptionsfavoritetabs.miseparator1.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR1.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.miseparator10.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR10.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.miseparator11.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR11.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.miseparator2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR2.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.miseparator3.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR3.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.miseparator7.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR7.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.miseparator8.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR8.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.miseparator9.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR9.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfavoritetabs.misorteverything.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTEVERYTHING.CAPTION" msgid "...everything, from A to Z!" msgstr "" #: tfrmoptionsfavoritetabs.misortsinglegroup.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP.CAPTION" msgid "...single group of item(s) only" msgstr "" #: tfrmoptionsfavoritetabs.misortsinglegroup2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP2.CAPTION" msgid "Sort single group of item(s) only" msgstr "" #: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLESUBMENU.CAPTION" msgid "...content of submenu(s) selected, no sublevel" msgstr "" #: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSUBMENUANDSUBLEVEL.CAPTION" msgid "...content of submenu(s) selected and all sublevels" msgstr "" #: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MITESTRESULTINGFAVORITETABSMENU.CAPTION" msgid "Test resulting menu" msgstr "" #: tfrmoptionsfileassoc.btnaddact.caption msgid "Add" msgstr "" #: tfrmoptionsfileassoc.btnaddext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION" msgid "&Add" msgstr "" #: tfrmoptionsfileassoc.btnaddnewtype.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION" msgid "A&dd" msgstr "" #: tfrmoptionsfileassoc.btncloneact.caption msgid "Clone" msgstr "" #: tfrmoptionsfileassoc.btndownact.caption msgid "&Down" msgstr "" #: tfrmoptionsfileassoc.btneditext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION" msgid "Edit" msgstr "" #: tfrmoptionsfileassoc.btninsertact.caption msgctxt "tfrmoptionsfileassoc.btninsertact.caption" msgid "Insert" msgstr "" #: tfrmoptionsfileassoc.btninsertext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION" msgid "Insert" msgstr "" #: tfrmoptionsfileassoc.btnremoveact.caption msgid "Remo&ve" msgstr "" #: tfrmoptionsfileassoc.btnremoveext.caption msgid "Re&move" msgstr "" #: tfrmoptionsfileassoc.btnremovetype.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION" msgid "&Remove" msgstr "" #: tfrmoptionsfileassoc.btnrenametype.caption msgctxt "tfrmoptionsfileassoc.btnrenametype.caption" msgid "R&ename" msgstr "" #: tfrmoptionsfileassoc.btnupact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION" msgid "&Up" msgstr "" #: tfrmoptionsfileassoc.destartpath.hint msgid "Starting path of the command. Never quote this string." msgstr "" #: tfrmoptionsfileassoc.edbactionname.hint msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you" msgstr "" #: tfrmoptionsfileassoc.edtparams.hint msgid "Parameter to pass to the command. Long filename with spaces should be quoted." msgstr "" #: tfrmoptionsfileassoc.fnecommand.hint msgid "Command to execute. Long filename with space should be quoted." msgstr "" #: tfrmoptionsfileassoc.gbactiondescription.caption msgid "Action description:" msgstr "" #: tfrmoptionsfileassoc.gbactions.caption msgctxt "tfrmoptionsfileassoc.gbactions.caption" msgid "Actions" msgstr "" #: tfrmoptionsfileassoc.gbexts.caption msgid "Extensions" msgstr "" #: tfrmoptionsfileassoc.gbexts.hint msgid "Can be sorted by drag & drop" msgstr "" #: tfrmoptionsfileassoc.gbfiletypes.caption msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption" msgid "File types" msgstr "" #: tfrmoptionsfileassoc.gbicon.caption msgid "Icon" msgstr "" #: tfrmoptionsfileassoc.lbactions.hint msgid "Actions may be sorted by drag & drop" msgstr "" #: tfrmoptionsfileassoc.lbexts.hint msgid "Extensions may be sorted by drag & drop" msgstr "" #: tfrmoptionsfileassoc.lbfiletypes.hint msgid "File types may be sorted by drag & drop" msgstr "" #: tfrmoptionsfileassoc.lblaction.caption msgid "Action name:" msgstr "" #: tfrmoptionsfileassoc.lblcommand.caption msgid "&Command:" msgstr "" #: tfrmoptionsfileassoc.lblexternalparameters.caption msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption" msgid "Parameter&s:" msgstr "" #: tfrmoptionsfileassoc.lblstartpath.caption msgctxt "tfrmoptionsfileassoc.lblstartpath.caption" msgid "Start pat&h:" msgstr "" #: tfrmoptionsfileassoc.menuitem1.caption msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfileassoc.menuitem3.caption msgid "Custom with..." msgstr "" #: tfrmoptionsfileassoc.micustom.caption msgid "Custom" msgstr "" #: tfrmoptionsfileassoc.miedit.caption msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION" msgid "Edit" msgstr "" #: tfrmoptionsfileassoc.mieditor.caption msgid "Open in Editor" msgstr "" #: tfrmoptionsfileassoc.mieditwith.caption msgid "Edit with..." msgstr "" #: tfrmoptionsfileassoc.migetoutputfromcommand.caption msgid "Get output from command" msgstr "" #: tfrmoptionsfileassoc.miinternaleditor.caption msgid "Open in Internal Editor" msgstr "" #: tfrmoptionsfileassoc.miinternalviewer.caption msgid "Open in Internal Viewer" msgstr "" #: tfrmoptionsfileassoc.miopen.caption msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION" msgid "Open" msgstr "" #: tfrmoptionsfileassoc.miopenwith.caption msgid "Open with..." msgstr "" #: tfrmoptionsfileassoc.miseparator.caption msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION" msgid "-" msgstr "" #: tfrmoptionsfileassoc.mishell.caption msgid "Run in terminal" msgstr "" #: tfrmoptionsfileassoc.miview.caption msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION" msgid "View" msgstr "" #: tfrmoptionsfileassoc.miviewer.caption msgid "Open in Viewer" msgstr "" #: tfrmoptionsfileassoc.miviewwith.caption msgid "View with..." msgstr "" #: tfrmoptionsfileassoc.sbtnicon.hint msgid "Click me to change icon!" msgstr "" #: tfrmoptionsfileassocextra.cbexecuteviashell.caption msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption" msgid "Execute via shell" msgstr "" #: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption msgid "Extended context menu" msgstr "" #: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXTENDEDCONTEXTMENU.HINT" msgid "When accessing file association, offer to add current selected file if not already included in a configured file type" msgstr "" #: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption msgid "File association configuration" msgstr "" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption msgid "Offer to add selection to file association when not included already" msgstr "" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint" msgid "When accessing file association, offer to add current selected file if not already included in a configured file type" msgstr "" #: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption" msgid "Execute via terminal and close" msgstr "" #: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption" msgid "Execute via terminal and stay open" msgstr "" #: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption msgid "Extended options items:" msgstr "" #: tfrmoptionsfileoperations.bvlconfirmations.caption msgid "Show confirmation window for:" msgstr "" #: tfrmoptionsfileoperations.cbcopyconfirmation.caption msgid "Cop&y operation" msgstr "" #: tfrmoptionsfileoperations.cbdeleteconfirmation.caption msgid "&Delete operation" msgstr "" #: tfrmoptionsfileoperations.cbdeletetotrash.caption msgid "Dele&te to recycle bin (Shift key reverses this setting)" msgstr "" #: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption msgid "D&elete to trash operation" msgstr "" #: tfrmoptionsfileoperations.cbdropreadonlyflag.caption msgid "D&rop readonly flag" msgstr "" #: tfrmoptionsfileoperations.cbmoveconfirmation.caption msgid "&Move operation" msgstr "" #: tfrmoptionsfileoperations.cbprocesscomments.caption msgid "&Process comments with files/folders" msgstr "" #: tfrmoptionsfileoperations.cbrenameselonlyname.caption msgid "Select &file name without extension when renaming" msgstr "" #: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption msgid "Sho&w tab select panel in copy/move dialog" msgstr "" #: tfrmoptionsfileoperations.cbskipfileoperror.caption msgid "S&kip file operations errors and write them to log window" msgstr "" #: tfrmoptionsfileoperations.gbexecutingoperations.caption msgid "Executing operations" msgstr "" #: tfrmoptionsfileoperations.gbuserinterface.caption msgid "User interface" msgstr "" #: tfrmoptionsfileoperations.lblbuffersize.caption msgid "&Buffer size for file operations (in KB):" msgstr "" #: tfrmoptionsfileoperations.lblhashbuffersize.caption msgid "Buffer size for &hash calculation (in KB):" msgstr "" #: tfrmoptionsfileoperations.lblprogresskind.caption msgid "Show operations progress &initially in" msgstr "" #: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption msgid "Duplicated name auto-rename style:" msgstr "" #: tfrmoptionsfileoperations.lblwipepassnumber.caption msgid "&Number of wipe passes:" msgstr "" #: tfrmoptionsfilepanelscolors.btnbackcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btnbackcolor2.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btncursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btncursortext.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btnforecolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btnindbackcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btnindcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btnmarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption msgid "Reset to DC default" msgstr "" #: tfrmoptionsfilepanelscolors.cballowovercolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION" msgid "Allow Overcolor" msgstr "" #: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption msgid "Use &Frame Cursor" msgstr "" #: tfrmoptionsfilepanelscolors.cbbusegradientind.caption msgid "Use &Gradient Indicator" msgstr "" #: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption msgid "Use Inactive Sel Color" msgstr "" #: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption msgid "U&se Inverted Selection" msgstr "" #: tfrmoptionsfilepanelscolors.cbusecursorborder.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION" msgid "Cursor border" msgstr "" #: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption msgid "Drive Free Space Indicator" msgstr "" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption msgid "Bac&kground:" msgstr "" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption msgid "Backg&round 2:" msgstr "" #: tfrmoptionsfilepanelscolors.lblcursorcolor.caption msgid "C&ursor Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblcursortext.caption msgid "Cursor Te&xt:" msgstr "" #: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION" msgid "Inactive Cursor Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION" msgid "Inactive Mark Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption msgid "&Brightness level of inactive panel" msgstr "" #: tfrmoptionsfilepanelscolors.lblindbackcolor.caption msgid "In&dicator Back Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblindcolor.caption msgid "&Indicator Fore Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblmarkcolor.caption msgid "&Mark Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblpreview.caption msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings." msgstr "" #: tfrmoptionsfilepanelscolors.lbltextcolor.caption msgid "T&ext Color:" msgstr "" #: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption msgid "When launching file search, clear file mask filter" msgstr "" #: tfrmoptionsfilesearch.cbpartialnamesearch.caption msgid "&Search for part of file name" msgstr "" #: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption msgid "Show menu bar in \"Find files\"" msgstr "" #: tfrmoptionsfilesearch.dbtextsearch.caption msgid "Text search in files" msgstr "" #: tfrmoptionsfilesearch.gbfilesearch.caption msgctxt "TFRMOPTIONSFILESEARCH.GBFILESEARCH.CAPTION" msgid "File search" msgstr "" #: tfrmoptionsfilesearch.lblnewsearchfilters.caption msgid "Current filters with \"New search\" button:" msgstr "" #: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption msgid "Default search template:" msgstr "" #: tfrmoptionsfilesearch.rbusemmapinsearch.caption msgid "Use memory mapping for search te&xt in files" msgstr "" #: tfrmoptionsfilesearch.rbusestreaminsearch.caption msgid "&Use stream for search text in files" msgstr "" #: tfrmoptionsfilesviews.btnaddattribute.caption msgctxt "TFRMOPTIONSFILESVIEWS.BTNADDATTRIBUTE.CAPTION" msgid "&Add" msgstr "" #: tfrmoptionsfilesviews.btnattrshelp.caption msgctxt "TFRMOPTIONSFILESVIEWS.BTNATTRSHELP.CAPTION" msgid "&Help" msgstr "" #: tfrmoptionsfilesviews.cbdblclicktoparent.caption msgid "Enable changing to &parent folder when double-clicking on empty part of file view" msgstr "" #: tfrmoptionsfilesviews.cbdelayloadingtabs.caption msgid "Do&n't load file list until a tab is activated" msgstr "" #: tfrmoptionsfilesviews.cbdirbrackets.caption msgid "S&how square brackets around directories" msgstr "" #: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption msgid "Hi&ghlight new and updated files" msgstr "" #: tfrmoptionsfilesviews.cbinplacerename.caption msgid "Enable inplace &renaming when clicking twice on a name" msgstr "" #: tfrmoptionsfilesviews.cblistfilesinthread.caption msgid "Load &file list in separate thread" msgstr "" #: tfrmoptionsfilesviews.cbloadiconsseparately.caption msgid "Load icons af&ter file list" msgstr "" #: tfrmoptionsfilesviews.cbshowsystemfiles.caption msgid "Show s&ystem and hidden files" msgstr "" #: tfrmoptionsfilesviews.cbspacemovesdown.caption msgid "&When selecting files with , move down to next file (as with )" msgstr "" #: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)" msgstr "" #: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption msgid "Use an independant attribute filter in mask input dialog each time" msgstr "" #: tfrmoptionsfilesviews.gbformatting.caption msgid "Formatting" msgstr "" #: tfrmoptionsfilesviews.gbmarking.caption msgid "Marking/Unmarking entries" msgstr "" #: tfrmoptionsfilesviews.gbsorting.caption msgid "Sorting" msgstr "" #: tfrmoptionsfilesviews.lbattributemask.caption msgid "Default attribute mask value to use:" msgstr "" #: tfrmoptionsfilesviews.lblcasesensitivity.caption msgid "Case s&ensitivity:" msgstr "" #: tfrmoptionsfilesviews.lbldatetimeexample.caption msgid "Incorrect format" msgstr "" #: tfrmoptionsfilesviews.lbldatetimeformat.caption msgid "&Date and time format:" msgstr "" #: tfrmoptionsfilesviews.lblfilesizeformat.caption msgid "File si&ze format:" msgstr "" #: tfrmoptionsfilesviews.lblnewfilesposition.caption msgid "&Insert new files:" msgstr "" #: tfrmoptionsfilesviews.lblsortfoldermode.caption msgid "So&rting directories:" msgstr "" #: tfrmoptionsfilesviews.lblsortmethod.caption msgid "&Sort method:" msgstr "" #: tfrmoptionsfilesviews.lblupdatedfilesposition.caption msgid "&Move updated files:" msgstr "" #: tfrmoptionsfiletypescolors.btnaddcategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION" msgid "A&dd" msgstr "" #: tfrmoptionsfiletypescolors.btnapplycategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION" msgid "A&pply" msgstr "" #: tfrmoptionsfiletypescolors.btncategorycolor.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsfiletypescolors.btndeletecategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION" msgid "D&elete" msgstr "" #: tfrmoptionsfiletypescolors.btnsearchtemplate.hint msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint" msgid "Template..." msgstr "" #: tfrmoptionsfiletypescolors.gbfiletypescolors.caption msgid "File types colors (sort by drag&&drop)" msgstr "" #: tfrmoptionsfiletypescolors.lblcategoryattr.caption msgid "Category a&ttributes:" msgstr "" #: tfrmoptionsfiletypescolors.lblcategorycolor.caption msgid "Category co&lor:" msgstr "" #: tfrmoptionsfiletypescolors.lblcategorymask.caption msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption" msgid "Category &mask:" msgstr "" #: tfrmoptionsfiletypescolors.lblcategoryname.caption msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption" msgid "Category &name:" msgstr "" #: tfrmoptionsfonts.btnpatheditfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNPATHEDITFNT.CAPTION" msgid "..." msgstr "" #: tfrmoptionsfonts.btnsearchresultsfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSEARCHRESULTSFNT.CAPTION" msgid "..." msgstr "" #: tfrmoptionsfonts.btnselconsolefnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION" msgid "..." msgstr "" #: tfrmoptionsfonts.btnseleditfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION" msgid "..." msgstr "" #: tfrmoptionsfonts.btnsellogfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION" msgid "..." msgstr "" #: tfrmoptionsfonts.btnselmainfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION" msgid "..." msgstr "" #: tfrmoptionsfonts.btnselviewerbookfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION" msgid "..." msgstr "" #: tfrmoptionsfonts.btnselviewfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION" msgid "..." msgstr "" #: tfrmoptionsfonts.lblconsolefont.caption msgid "&Console font" msgstr "" #: tfrmoptionsfonts.lbleditorfont.caption msgid "&Editor font" msgstr "" #: tfrmoptionsfonts.lbllogfont.caption msgid "&Log font" msgstr "" #: tfrmoptionsfonts.lblmainfont.caption msgid "Main &font" msgstr "" #: tfrmoptionsfonts.lblpatheditfont.caption msgid "Path font" msgstr "" #: tfrmoptionsfonts.lblsearchresultsfont.caption msgid "Search results font" msgstr "" #: tfrmoptionsfonts.lblviewerbookfont.caption msgid "Viewer&Book Font" msgstr "" #: tfrmoptionsfonts.lblviewerfont.caption msgid "&Viewer font" msgstr "" #: tfrmoptionshotkeys.actaddhotkey.caption msgctxt "TFRMOPTIONSHOTKEYS.ACTADDHOTKEY.CAPTION" msgid "Add &hotkey" msgstr "" #: tfrmoptionshotkeys.actcopy.caption msgctxt "TFRMOPTIONSHOTKEYS.ACTCOPY.CAPTION" msgid "Copy" msgstr "" #: tfrmoptionshotkeys.actdelete.caption msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETE.CAPTION" msgid "Delete" msgstr "" #: tfrmoptionshotkeys.actdeletehotkey.caption msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETEHOTKEY.CAPTION" msgid "&Delete hotkey" msgstr "" #: tfrmoptionshotkeys.actedithotkey.caption msgctxt "TFRMOPTIONSHOTKEYS.ACTEDITHOTKEY.CAPTION" msgid "&Edit hotkey" msgstr "" #: tfrmoptionshotkeys.actnextcategory.caption msgid "Next category" msgstr "" #: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption msgid "Make popup the file related menu" msgstr "" #: tfrmoptionshotkeys.actpreviouscategory.caption msgid "Previous category" msgstr "" #: tfrmoptionshotkeys.actrename.caption msgctxt "TFRMOPTIONSHOTKEYS.ACTRENAME.CAPTION" msgid "Rename" msgstr "" #: tfrmoptionshotkeys.actrestoredefault.caption msgid "Restore DC default" msgstr "" #: tfrmoptionshotkeys.actsavenow.caption msgid "Save now" msgstr "" #: tfrmoptionshotkeys.actsortbycommand.caption msgid "Sort by command name" msgstr "" #: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption msgid "Sort by hotkeys (grouped)" msgstr "" #: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption msgid "Sort by hotkeys (one per row)" msgstr "" #: tfrmoptionshotkeys.lbfilter.caption msgid "&Filter" msgstr "" #: tfrmoptionshotkeys.lblcategories.caption msgid "C&ategories:" msgstr "" #: tfrmoptionshotkeys.lblcommands.caption msgid "Co&mmands:" msgstr "" #: tfrmoptionshotkeys.lblscfiles.caption msgid "&Shortcut files:" msgstr "" #: tfrmoptionshotkeys.lblsortorder.caption msgid "So&rt order:" msgstr "" #: tfrmoptionshotkeys.micategories.caption msgid "Categories" msgstr "" #: tfrmoptionshotkeys.micommands.caption msgctxt "TFRMOPTIONSHOTKEYS.MICOMMANDS.CAPTION" msgid "Command" msgstr "" #: tfrmoptionshotkeys.miseparator1.caption msgctxt "TFRMOPTIONSHOTKEYS.MISEPARATOR1.CAPTION" msgid "-" msgstr "" #: tfrmoptionshotkeys.misortorder.caption msgid "Sort order" msgstr "" #: tfrmoptionsicons.cbiconsexclude.caption msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION" msgid "For the following &paths and their subdirectories:" msgstr "" #: tfrmoptionsicons.cbiconsinmenus.caption msgid "Show icons for actions in &menus" msgstr "" #: tfrmoptionsicons.cbiconsinmenussize.text msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT" msgid "16x16" msgstr "" #: tfrmoptionsicons.cbiconsonbuttons.caption msgid "Show icons on buttons" msgstr "" #: tfrmoptionsicons.cbiconsshowoverlay.caption msgid "Show o&verlay icons, e.g. for links" msgstr "" #: tfrmoptionsicons.gbdisablespecialicons.caption msgid "Disable special icons" msgstr "" #: tfrmoptionsicons.gbiconssize.caption msgid " Icon size " msgstr "" #: tfrmoptionsicons.gbicontheme.caption msgid "Icon theme" msgstr "" #: tfrmoptionsicons.gbshowicons.caption msgid "Show icons" msgstr "" #: tfrmoptionsicons.gbshowiconsmode.caption msgid " Show icons to the left of the filename " msgstr "" #: tfrmoptionsicons.lbldiskpanel.caption msgid "Disk panel:" msgstr "" #: tfrmoptionsicons.lblfilepanel.caption msgid "File panel:" msgstr "" #: tfrmoptionsicons.rbiconsshowall.caption msgctxt "tfrmoptionsicons.rbiconsshowall.caption" msgid "A&ll" msgstr "" #: tfrmoptionsicons.rbiconsshowallandexe.caption msgid "All associated + &EXE/LNK (slow)" msgstr "" #: tfrmoptionsicons.rbiconsshownone.caption msgid "&No icons" msgstr "" #: tfrmoptionsicons.rbiconsshowstandard.caption msgid "Only &standard icons" msgstr "" #: tfrmoptionsignorelist.btnaddsel.caption msgid "A&dd selected names" msgstr "" #: tfrmoptionsignorelist.btnaddselwithpath.caption msgid "Add selected names with &full path" msgstr "" #: tfrmoptionsignorelist.btnrelativesavein.hint msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsignorelist.chkignoreenable.caption msgid "&Ignore (don't show) the following files and folders:" msgstr "" #: tfrmoptionsignorelist.lblsavein.caption msgid "&Save in:" msgstr "" #: tfrmoptionskeyboard.cblynxlike.caption msgid "Le&ft, Right arrows change directory (Lynx-like movement)" msgstr "" #: tfrmoptionskeyboard.gbtyping.caption msgid "Typing" msgstr "" #: tfrmoptionskeyboard.lblalt.caption msgid "Alt+L&etters:" msgstr "" #: tfrmoptionskeyboard.lblctrlalt.caption msgid "Ctrl+Alt+Le&tters:" msgstr "" #: tfrmoptionskeyboard.lblnomodifier.caption msgid "&Letters:" msgstr "" #: tfrmoptionslayout.cbflatdiskpanel.caption msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption" msgid "&Flat buttons" msgstr "" #: tfrmoptionslayout.cbflatinterface.caption msgid "Flat i&nterface" msgstr "" #: tfrmoptionslayout.cbflattoolbar.caption msgid "Flat b&uttons" msgstr "" #: tfrmoptionslayout.cbfreespaceind.caption msgid "Show fr&ee space indicator on drive label" msgstr "" #: tfrmoptionslayout.cblogwindow.caption msgid "Show lo&g window" msgstr "" #: tfrmoptionslayout.cbpanelofoperations.caption msgid "Show panel of operation in background" msgstr "" #: tfrmoptionslayout.cbproginmenubar.caption msgid "Show common progress in menu bar" msgstr "" #: tfrmoptionslayout.cbshowcmdline.caption msgid "Show command l&ine" msgstr "" #: tfrmoptionslayout.cbshowcurdir.caption msgid "Show current director&y" msgstr "" #: tfrmoptionslayout.cbshowdiskpanel.caption msgid "Show &drive buttons" msgstr "" #: tfrmoptionslayout.cbshowdrivefreespace.caption msgid "Show free s&pace label" msgstr "" #: tfrmoptionslayout.cbshowdriveslistbutton.caption msgid "Show drives list bu&tton" msgstr "" #: tfrmoptionslayout.cbshowkeyspanel.caption msgid "Show function &key buttons" msgstr "" #: tfrmoptionslayout.cbshowmainmenu.caption msgid "Show &main menu" msgstr "" #: tfrmoptionslayout.cbshowmaintoolbar.caption msgid "Show tool&bar" msgstr "" #: tfrmoptionslayout.cbshowshortdrivefreespace.caption msgid "Show short free space &label" msgstr "" #: tfrmoptionslayout.cbshowstatusbar.caption msgid "Show &status bar" msgstr "" #: tfrmoptionslayout.cbshowtabheader.caption msgid "S&how tabstop header" msgstr "" #: tfrmoptionslayout.cbshowtabs.caption msgid "Sho&w folder tabs" msgstr "" #: tfrmoptionslayout.cbtermwindow.caption msgid "Show te&rminal window" msgstr "" #: tfrmoptionslayout.cbtwodiskpanels.caption msgid "Show two drive button bars (fi&xed width, above file windows)" msgstr "" #: tfrmoptionslayout.gbscreenlayout.caption msgid " Screen layout " msgstr "" #: tfrmoptionslog.btnrelativelogfile.hint msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionslog.btnviewlogfile.hint msgctxt "tfrmoptionslog.btnviewlogfile.hint" msgid "View log file content" msgstr "" #: tfrmoptionslog.cbincludedateinlogfilename.caption msgid "Include date in log filename" msgstr "" #: tfrmoptionslog.cblogarcop.caption msgid "&Pack/Unpack" msgstr "" #: tfrmoptionslog.cblogcommandlineexecution.caption msgid "External command line execution" msgstr "" #: tfrmoptionslog.cblogcpmvln.caption msgid "Cop&y/Move/Create link/symlink" msgstr "" #: tfrmoptionslog.cblogdelete.caption msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION" msgid "&Delete" msgstr "" #: tfrmoptionslog.cblogdirop.caption msgid "Crea&te/Delete directories" msgstr "" #: tfrmoptionslog.cblogerrors.caption msgid "Log &errors" msgstr "" #: tfrmoptionslog.cblogfile.caption msgid "C&reate a log file:" msgstr "" #: tfrmoptionslog.cbloginfo.caption msgid "Log &information messages" msgstr "" #: tfrmoptionslog.cblogstartshutdown.caption msgid "Start/shutdown" msgstr "" #: tfrmoptionslog.cblogsuccess.caption msgid "Log &successful operations" msgstr "" #: tfrmoptionslog.cblogvfs.caption msgid "&File system plugins" msgstr "" #: tfrmoptionslog.gblogfile.caption msgid "File operation log file" msgstr "" #: tfrmoptionslog.gblogfileop.caption msgid "Log operations" msgstr "" #: tfrmoptionslog.gblogfilestatus.caption msgid "Operation status" msgstr "" #: tfrmoptionsmisc.btnoutputpathfortoolbar.caption msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsmisc.btnrelativetcconfigfile.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsmisc.btnrelativetcexecutablefile.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsmisc.btnthumbcompactcache.caption msgid "&Remove thumbnails for no longer existing files" msgstr "" #: tfrmoptionsmisc.btnviewconfigfile.hint msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT" msgid "View log file content" msgstr "" #: tfrmoptionsmisc.chkdesccreateunicode.caption msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION" msgid "Create new with the encoding:" msgstr "" #: tfrmoptionsmisc.chkgotoroot.caption msgid "Always &go to the root of a drive when changing drives" msgstr "" #: tfrmoptionsmisc.chkshowwarningmessages.caption msgid "Show &warning messages (\"OK\" button only)" msgstr "" #: tfrmoptionsmisc.chkthumbsave.caption msgid "&Save thumbnails in cache" msgstr "" #: tfrmoptionsmisc.dblthumbnails.caption msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION" msgid "Thumbnails" msgstr "" #: tfrmoptionsmisc.gbfilecomments.caption msgid "File comments (descript.ion)" msgstr "" #: tfrmoptionsmisc.gbtcexportimport.caption msgid "Regarding TC export/import:" msgstr "" #: tfrmoptionsmisc.lbldescrdefaultencoding.caption msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION" msgid "Default encoding:" msgstr "" #: tfrmoptionsmisc.lbltcconfig.caption msgid "Configuration file:" msgstr "" #: tfrmoptionsmisc.lbltcexecutable.caption msgid "TC executable:" msgstr "" #: tfrmoptionsmisc.lbltcpathfortool.caption msgid "Toolbar output path:" msgstr "" #: tfrmoptionsmisc.lblthumbpixels.caption msgid "pixels" msgstr "" #: tfrmoptionsmisc.lblthumbseparator.caption msgctxt "tfrmoptionsmisc.lblthumbseparator.caption" msgid "X" msgstr "" #: tfrmoptionsmisc.lblthumbsize.caption msgid "&Thumbnail size:" msgstr "" #: tfrmoptionsmouse.cbselectionbymouse.caption msgid "&Selection by mouse" msgstr "" #: tfrmoptionsmouse.gbscrolling.caption msgid "Scrolling" msgstr "" #: tfrmoptionsmouse.gbselection.caption msgid "Selection" msgstr "" #: tfrmoptionsmouse.lblmousemode.caption msgid "&Mode:" msgstr "" #: tfrmoptionsmouse.rbscrolllinebyline.caption msgid "&Line by line" msgstr "" #: tfrmoptionsmouse.rbscrolllinebylinecursor.caption msgid "Line by line &with cursor movement" msgstr "" #: tfrmoptionsmouse.rbscrollpagebypage.caption msgid "&Page by page" msgstr "" #: tfrmoptionsplugins.btnaddplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION" msgid "A&dd" msgstr "" #: tfrmoptionsplugins.btnconfigplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION" msgid "Con&figure" msgstr "" #: tfrmoptionsplugins.btnenableplugin.caption msgid "E&nable" msgstr "" #: tfrmoptionsplugins.btnremoveplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION" msgid "&Remove" msgstr "" #: tfrmoptionsplugins.btntweakplugin.caption msgid "&Tweak" msgstr "" #: tfrmoptionsplugins.lbldsxdescription.caption msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)" msgstr "" #: tfrmoptionsplugins.lblwcxdescription.caption msgid "Pack&er plugins are used to work with archives" msgstr "" #: tfrmoptionsplugins.lblwdxdescription.caption msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool" msgstr "" #: tfrmoptionsplugins.lblwfxdescription.caption msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC." msgstr "" #: tfrmoptionsplugins.lblwlxdescription.caption msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)" msgstr "" #: tfrmoptionsplugins.stgplugins.columns[0].title.caption msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption" msgid "Active" msgstr "" #: tfrmoptionsplugins.stgplugins.columns[1].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION" msgid "Plugin" msgstr "" #: tfrmoptionsplugins.stgplugins.columns[2].title.caption msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption" msgid "Registered for" msgstr "" #: tfrmoptionsplugins.stgplugins.columns[3].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION" msgid "File name" msgstr "" #: tfrmoptionsplugins.tsdsx.caption msgid "&Search plugins (.DSX)" msgstr "" #: tfrmoptionsplugins.tswcx.caption msgid "Pac&ker plugins (.WCX)" msgstr "" #: tfrmoptionsplugins.tswdx.caption msgid "Content pl&ugins (.WDX)" msgstr "" #: tfrmoptionsplugins.tswfx.caption msgid "F&ile system plugins (.WFX)" msgstr "" #: tfrmoptionsplugins.tswlx.caption msgid "&Viewer plugins (.WLX)" msgstr "" #: tfrmoptionsquicksearchfilter.cbexactbeginning.caption msgid "&Beginning (name must start with first typed character)" msgstr "" #: tfrmoptionsquicksearchfilter.cbexactending.caption msgid "En&ding (last character before a typed dot . must match)" msgstr "" #: tfrmoptionsquicksearchfilter.cgpoptions.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION" msgid "Options" msgstr "" #: tfrmoptionsquicksearchfilter.gbexactnamematch.caption msgid "Exact name match" msgstr "" #: tfrmoptionsquicksearchfilter.rgpsearchcase.caption msgid "Search case" msgstr "" #: tfrmoptionsquicksearchfilter.rgpsearchitems.caption msgid "Search for these items" msgstr "" #: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption msgid "Keep renamed name when unlocking a tab" msgstr "" #: tfrmoptionstabs.cbtabsactivateonclick.caption msgid "Activate target &panel when clicking on one of its Tabs" msgstr "" #: tfrmoptionstabs.cbtabsalwaysvisible.caption msgid "&Show tab header also when there is only one tab" msgstr "" #: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption msgid "Close duplicate tabs when closing application" msgstr "" #: tfrmoptionstabs.cbtabsconfirmcloseall.caption msgid "Con&firm close all tabs" msgstr "" #: tfrmoptionstabs.cbtabsconfirmcloselocked.caption msgid "Confirm close locked tabs" msgstr "" #: tfrmoptionstabs.cbtabslimitoption.caption msgid "&Limit tab title length to" msgstr "" #: tfrmoptionstabs.cbtabslockedasterisk.caption msgid "Show locked tabs &with an asterisk *" msgstr "" #: tfrmoptionstabs.cbtabsmultilines.caption msgid "&Tabs on multiple lines" msgstr "" #: tfrmoptionstabs.cbtabsopenforeground.caption msgid "Ctrl+&Up opens new tab in foreground" msgstr "" #: tfrmoptionstabs.cbtabsopennearcurrent.caption msgid "Open &new tabs near current tab" msgstr "" #: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption msgid "Reuse existing tab when possible" msgstr "" #: tfrmoptionstabs.cbtabsshowclosebutton.caption msgid "Show ta&b close button" msgstr "" #: tfrmoptionstabs.cbtabsshowdriveletter.caption msgid "Always show drive letter in tab title" msgstr "" #: tfrmoptionstabs.gbtabs.caption msgid "Folder tabs headers" msgstr "" #: tfrmoptionstabs.lblchar.caption msgid "characters" msgstr "" #: tfrmoptionstabs.lbltabsactionondoubleclick.caption msgid "Action to do when double click on a tab:" msgstr "" #: tfrmoptionstabs.lbltabsposition.caption msgid "Ta&bs position" msgstr "" #: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTEXISTINGTABSTOKEEP.TEXT" msgid "None" msgstr "" #: tfrmoptionstabsextra.cbdefaultsavedirhistory.text msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTSAVEDIRHISTORY.TEXT" msgid "No" msgstr "" #: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELLEFTSAVED.TEXT" msgid "Left" msgstr "" #: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELRIGHTSAVED.TEXT" msgid "Right" msgstr "" #: tfrmoptionstabsextra.cbgotoconfigafterresave.caption msgid "Goto to Favorite Tabs Configuration after resaving" msgstr "" #: tfrmoptionstabsextra.cbgotoconfigaftersave.caption msgid "Goto to Favorite Tabs Configuration after saving a new one" msgstr "" #: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)" msgstr "" #: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption msgid "Default extra settings when saving new Favorite Tabs:" msgstr "" #: tfrmoptionstabsextra.gbtabs.caption msgid "Folder tabs headers extra" msgstr "" #: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption msgid "When restoring tab, existing tabs to keep:" msgstr "" #: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption msgid "Tabs saved on left will be restored to:" msgstr "" #: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption msgid "Tabs saved on right will be restored to:" msgstr "" #: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption" msgid "Keep saving dir history with Favorite Tabs:" msgstr "" #: tfrmoptionstabsextra.rgwheretoadd.caption msgid "Default position in menu when saving a new Favorite Tabs:" msgstr "" #: tfrmoptionsterminal.edrunintermcloseparams.hint msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "" #: tfrmoptionsterminal.edrunintermstayopenparams.hint msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "" #: tfrmoptionsterminal.edruntermparams.hint msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "" #: tfrmoptionsterminal.gbjustrunterminal.caption msgid "Command for just running terminal:" msgstr "" #: tfrmoptionsterminal.gbruninterminalclose.caption msgid "Command for running a command in terminal and close after:" msgstr "" #: tfrmoptionsterminal.gbruninterminalstayopen.caption msgid "Command for running a command in terminal and stay open:" msgstr "" #: tfrmoptionsterminal.lbrunintermclosecmd.caption msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION" msgid "Command:" msgstr "" #: tfrmoptionsterminal.lbrunintermcloseparams.caption msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION" msgid "Parameters:" msgstr "" #: tfrmoptionsterminal.lbrunintermstayopencmd.caption msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION" msgid "Command:" msgstr "" #: tfrmoptionsterminal.lbrunintermstayopenparams.caption msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION" msgid "Parameters:" msgstr "" #: tfrmoptionsterminal.lbruntermcmd.caption msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION" msgid "Command:" msgstr "" #: tfrmoptionsterminal.lbruntermparams.caption msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION" msgid "Parameters:" msgstr "" #: tfrmoptionstoolbar.btnclonebutton.caption msgid "C&lone button" msgstr "" #: tfrmoptionstoolbar.btndeletebutton.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION" msgid "&Delete" msgstr "" #: tfrmoptionstoolbar.btnedithotkey.caption msgid "Edit hot&key" msgstr "" #: tfrmoptionstoolbar.btninsertbutton.caption msgid "&Insert new button" msgstr "" #: tfrmoptionstoolbar.btnopencmddlg.caption msgid "Select" msgstr "" #: tfrmoptionstoolbar.btnopenfile.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstoolbar.btnother.caption msgctxt "tfrmoptionstoolbar.btnother.caption" msgid "Other..." msgstr "" #: tfrmoptionstoolbar.btnremovehotkey.caption msgid "Remove hotke&y" msgstr "" #: tfrmoptionstoolbar.btnstartpath.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstoolbar.btnsuggestiontooltip.caption msgid "Suggest" msgstr "" #: tfrmoptionstoolbar.btnsuggestiontooltip.hint msgid "Have DC suggest the tooltip based on button type, command and parameters" msgstr "" #: tfrmoptionstoolbar.cbflatbuttons.caption msgctxt "TFRMOPTIONSTOOLBAR.CBFLATBUTTONS.CAPTION" msgid "&Flat buttons" msgstr "" #: tfrmoptionstoolbar.cbreporterrorwithcommands.caption msgid "Report errors with commands" msgstr "" #: tfrmoptionstoolbar.edtinternalparameters.hint msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters." msgstr "" #: tfrmoptionstoolbar.gbgroupbox.caption msgid "Appearance" msgstr "" #: tfrmoptionstoolbar.lblbarsize.caption msgid "&Bar size:" msgstr "" #: tfrmoptionstoolbar.lblexternalcommand.caption msgid "Comman&d:" msgstr "" #: tfrmoptionstoolbar.lblexternalparameters.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION" msgid "Parameter&s:" msgstr "" #: tfrmoptionstoolbar.lblhelponinternalcommand.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION" msgid "Help" msgstr "" #: tfrmoptionstoolbar.lblhotkey.caption msgid "Hot key:" msgstr "" #: tfrmoptionstoolbar.lbliconfile.caption msgid "Ico&n:" msgstr "" #: tfrmoptionstoolbar.lbliconsize.caption msgid "Icon si&ze:" msgstr "" #: tfrmoptionstoolbar.lblinternalcommand.caption msgid "Co&mmand:" msgstr "" #: tfrmoptionstoolbar.lblinternalparameters.caption msgid "&Parameters:" msgstr "" #: tfrmoptionstoolbar.lblstartpath.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLSTARTPATH.CAPTION" msgid "Start pat&h:" msgstr "" #: tfrmoptionstoolbar.lbltooltip.caption msgid "&Tooltip:" msgstr "" #: tfrmoptionstoolbar.miaddallcmds.caption msgid "Add toolbar with ALL DC commands" msgstr "" #: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption msgid "for an external command" msgstr "" #: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption msgid "for an internal command" msgstr "" #: tfrmoptionstoolbar.miaddseparatorsubmenu.caption msgid "for a separator" msgstr "" #: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption msgid "for a sub-tool bar" msgstr "" #: tfrmoptionstoolbar.mibackup.caption msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION" msgid "Backup..." msgstr "" #: tfrmoptionstoolbar.miexport.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION" msgid "Export..." msgstr "" #: tfrmoptionstoolbar.miexportcurrent.caption msgid "Current toolbar..." msgstr "" #: tfrmoptionstoolbar.miexportcurrenttodcbar.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION" msgid "to a Toolbar File (.toolbar)" msgstr "" #: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION" msgid "to a TC .BAR file (keep existing)" msgstr "" #: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION" msgid "to a TC .BAR file (erase existing)" msgstr "" #: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "" #: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "" #: tfrmoptionstoolbar.miexportseparator1.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miexportseparator2.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miexportseparator3.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miexportseparator4.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miexporttop.caption msgid "Top toolbar..." msgstr "" #: tfrmoptionstoolbar.miexporttoptobackup.caption msgid "Save a backup of Toolbar" msgstr "" #: tfrmoptionstoolbar.miexporttoptodcbar.caption msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption" msgid "to a Toolbar File (.toolbar)" msgstr "" #: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption" msgid "to a TC .BAR file (keep existing)" msgstr "" #: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption" msgid "to a TC .BAR file (erase existing)" msgstr "" #: tfrmoptionstoolbar.miexporttoptotcinikeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "" #: tfrmoptionstoolbar.miexporttoptotcininokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "" #: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "" #: tfrmoptionstoolbar.miexternalcommandfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "" #: tfrmoptionstoolbar.miexternalcommandlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION" msgid "as last element" msgstr "" #: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "" #: tfrmoptionstoolbar.miimport.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION" msgid "Import..." msgstr "" #: tfrmoptionstoolbar.miimportbackup.caption msgid "Restore a backup of Toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupaddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupaddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupaddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupreplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbar.caption msgid "from a Toolbar File (.toolbar)" msgstr "" #: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption" msgid "to add to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbaraddtop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption" msgid "to add to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbarreplacetop.caption msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption" msgid "to replace top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportseparator.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miimporttcbar.caption msgid "from a single TC .BAR file" msgstr "" #: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcbaraddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcbarreplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcini.caption msgid "from \"wincmd.ini\" of TC..." msgstr "" #: tfrmoptionstoolbar.miimporttciniaddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttciniaddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttciniaddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcinireplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "" #: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "" #: tfrmoptionstoolbar.miinternalcommandfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "" #: tfrmoptionstoolbar.miinternalcommandlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION" msgid "as last element" msgstr "" #: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "" #: tfrmoptionstoolbar.misearchandreplace.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION" msgid "Search and replace..." msgstr "" #: tfrmoptionstoolbar.miseparator1.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator10.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator11.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator13.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator14.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator2.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator6.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator7.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator8.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparator9.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.miseparatoraftercurrent.caption msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption" msgid "just after current selection" msgstr "" #: tfrmoptionstoolbar.miseparatorfirstitem.caption msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption" msgid "as first element" msgstr "" #: tfrmoptionstoolbar.miseparatorlastelement.caption msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption" msgid "as last element" msgstr "" #: tfrmoptionstoolbar.miseparatorpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption" msgid "just prior current selection" msgstr "" #: tfrmoptionstoolbar.misrcrplallofall.caption msgid "in all of all the above..." msgstr "" #: tfrmoptionstoolbar.misrcrplclickseparator.caption msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION" msgid "-" msgstr "" #: tfrmoptionstoolbar.misrcrplcommands.caption msgid "in all commands..." msgstr "" #: tfrmoptionstoolbar.misrcrpliconnames.caption msgid "in all icon names..." msgstr "" #: tfrmoptionstoolbar.misrcrplparameters.caption msgid "in all parameters..." msgstr "" #: tfrmoptionstoolbar.misrcrplstartpath.caption msgid "in all start path..." msgstr "" #: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "" #: tfrmoptionstoolbar.misubtoolbarfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "" #: tfrmoptionstoolbar.misubtoolbarlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION" msgid "as last element" msgstr "" #: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "" #: tfrmoptionstoolbar.rgtoolitemtype.caption msgid "Button type" msgstr "" #: tfrmoptionstoolbase.btnrelativetoolpath.hint msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption msgid "&Keep terminal window open after executing program" msgstr "" #: tfrmoptionstoolbase.cbtoolsruninterminal.caption msgid "&Execute in terminal" msgstr "" #: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption msgid "&Use external program" msgstr "" #: tfrmoptionstoolbase.lbltoolsparameters.caption msgid "A&dditional parameters" msgstr "" #: tfrmoptionstoolbase.lbltoolspath.caption msgid "&Path to program to execute" msgstr "" #: tfrmoptionstooltips.btnaddfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION" msgid "A&dd" msgstr "" #: tfrmoptionstooltips.btnapplyfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION" msgid "A&pply" msgstr "" #: tfrmoptionstooltips.btndeletefields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION" msgid "D&elete" msgstr "" #: tfrmoptionstooltips.btnfieldslist.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstooltips.btnfieldssearchtemplate.hint msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT" msgid "Template..." msgstr "" #: tfrmoptionstooltips.chkshowtooltip.caption msgid "&Show tooltip for files in the file panel" msgstr "" #: tfrmoptionstooltips.gbcustomfields.caption msgid "Custom fields by file type" msgstr "" #: tfrmoptionstooltips.lblfieldslist.caption msgid "Category &hint:" msgstr "" #: tfrmoptionstooltips.lblfieldsmask.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION" msgid "Category &mask:" msgstr "" #: tfrmoptionstooltips.lblfieldsname.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION" msgid "Category &name:" msgstr "" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption msgid "With double-click on the bar on top of a file panel" msgstr "" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption" msgid "With the menu and internal command" msgstr "" #: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption msgid "Double click in tree select and exit" msgstr "" #: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION" msgid "With the menu and internal command" msgstr "" #: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption msgid "With double-click on a tab (if configured for it)" msgstr "" #: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption msgid "When using the keyboard shortcut, it will exit the window returning the current choice" msgstr "" #: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption msgid "Single mouse click in tree select and exit" msgstr "" #: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption msgid "Use it for Command Line History" msgstr "" #: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption msgid "Use it for the Dir History" msgstr "" #: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption msgid "Use it for the View History (Visited paths for active view)" msgstr "" #: tfrmoptionstreeviewmenu.gbbehavior.caption msgid "Behavior regarding selection:" msgstr "" #: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption msgid "Tree View Menus related options:" msgstr "" #: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption msgid "Where to use Tree View Menus:" msgstr "" #: tfrmoptionstreeviewmenu.lblnote.caption msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another." msgstr "" #: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption msgid "With Directory Hotlist:" msgstr "" #: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption msgid "With Favorite Tabs:" msgstr "" #: tfrmoptionstreeviewmenu.lblusewithhistory.caption msgid "With History:" msgstr "" #: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btncursorcolor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption msgid "Use and display keyboard shortcut for choosing items" msgstr "" #: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption msgid "Layout and colors options:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption msgid "Background color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption msgid "Cursor color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption msgid "Found text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption msgid "Found text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption msgid "Normal text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption msgid "Normal text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblpreview.caption msgid "Tree View Menu Preview:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption msgid "Secondary text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption msgid "Secondary text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption msgid "Shortcut color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption msgid "Shortcut under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption msgid "Unselectable text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption msgid "Unselectable under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample." msgstr "" #: tfrmoptionsviewer.btnbackviewercolor.caption msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsviewer.btnfontviewercolor.caption msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION" msgid ">>" msgstr "" #: tfrmoptionsviewer.gbviewerbookmode.caption msgid "Viewer Book Mode" msgstr "" #: tfrmoptionsviewer.gbviewerexample.caption msgid "Example" msgstr "" #: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption msgid "&Background color in book viewer" msgstr "" #: tfrmoptionsviewer.lblfontcolorviewerbook.caption msgid "&Font color in book viewer" msgstr "" #: tfrmoptionsviewer.lblnumbercolumnsviewer.caption msgid "&Number of columns in book viewer" msgstr "" #: tfrmpackdlg.btnconfig.caption msgctxt "tfrmpackdlg.btnconfig.caption" msgid "Con&figure" msgstr "" #: tfrmpackdlg.caption msgid "Pack files" msgstr "" #: tfrmpackdlg.cbcreateseparatearchives.caption msgid "C&reate separate archives, one per selected file/dir" msgstr "" #: tfrmpackdlg.cbcreatesfx.caption msgid "Create self e&xtracting archive" msgstr "" #: tfrmpackdlg.cbencrypt.caption msgid "Encr&ypt" msgstr "" #: tfrmpackdlg.cbmovetoarchive.caption msgid "Mo&ve to archive" msgstr "" #: tfrmpackdlg.cbmultivolume.caption msgid "&Multiple disk archive" msgstr "" #: tfrmpackdlg.cbotherplugins.caption msgid "=>" msgstr "" #: tfrmpackdlg.cbputintarfirst.caption msgid "P&ut in the TAR archive first" msgstr "" #: tfrmpackdlg.cbstoredir.caption msgid "Also &pack path names (only recursed)" msgstr "" #: tfrmpackdlg.lblprompt.caption msgid "Pack file(s) to the file:" msgstr "" #: tfrmpackdlg.rgpacker.caption msgid "Packer" msgstr "" #: tfrmpackinfodlg.btnclose.caption msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION" msgid "&Close" msgstr "" #: tfrmpackinfodlg.btnunpackallandexec.caption msgid "Unpack &all and execute" msgstr "" #: tfrmpackinfodlg.btnunpackandexec.caption msgid "&Unpack and execute" msgstr "" #: tfrmpackinfodlg.caption msgid "Properties of packed file" msgstr "" #: tfrmpackinfodlg.lblattributes.caption msgid "Attributes:" msgstr "" #: tfrmpackinfodlg.lblcompressionratio.caption msgid "Compression ratio:" msgstr "" #: tfrmpackinfodlg.lbldate.caption msgid "Date:" msgstr "" #: tfrmpackinfodlg.lblmethod.caption msgid "Method:" msgstr "" #: tfrmpackinfodlg.lbloriginalsize.caption msgid "Original size:" msgstr "" #: tfrmpackinfodlg.lblpackedfile.caption msgid "File:" msgstr "" #: tfrmpackinfodlg.lblpackedsize.caption msgid "Packed size:" msgstr "" #: tfrmpackinfodlg.lblpacker.caption msgid "Packer:" msgstr "" #: tfrmpackinfodlg.lbltime.caption msgid "Time:" msgstr "" #: tfrmquicksearch.btncancel.caption msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION" msgid "X" msgstr "" #: tfrmquicksearch.btncancel.hint msgid "Close filter panel" msgstr "" #: tfrmquicksearch.edtsearch.hint msgid "Enter text to search for or filter by" msgstr "" #: tfrmquicksearch.sbcasesensitive.caption msgid "Aa" msgstr "" #: tfrmquicksearch.sbcasesensitive.hint msgid "Case Sensitive" msgstr "" #: tfrmquicksearch.sbdirectories.caption msgid "D" msgstr "" #: tfrmquicksearch.sbdirectories.hint msgctxt "TFRMQUICKSEARCH.SBDIRECTORIES.HINT" msgid "Directories" msgstr "" #: tfrmquicksearch.sbfiles.caption msgid "F" msgstr "" #: tfrmquicksearch.sbfiles.hint msgctxt "TFRMQUICKSEARCH.SBFILES.HINT" msgid "Files" msgstr "" #: tfrmquicksearch.sbmatchbeginning.caption msgid "{" msgstr "" #: tfrmquicksearch.sbmatchbeginning.hint msgid "Match Beginning" msgstr "" #: tfrmquicksearch.sbmatchending.caption msgid "}" msgstr "" #: tfrmquicksearch.sbmatchending.hint msgid "Match Ending" msgstr "" #: tfrmquicksearch.tglfilter.caption msgid "Filter" msgstr "" #: tfrmquicksearch.tglfilter.hint msgid "Toggle between search or filter" msgstr "" #: tfrmsearchplugin.btnadd.caption msgid "&More rules" msgstr "" #: tfrmsearchplugin.btndelete.caption msgid "L&ess rules" msgstr "" #: tfrmsearchplugin.chkuseplugins.caption msgid "Use &content plugins, combine with:" msgstr "" #: tfrmsearchplugin.headercontrol.sections[0].text msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT" msgid "Plugin" msgstr "" #: tfrmsearchplugin.headercontrol.sections[1].text msgid "Field" msgstr "" #: tfrmsearchplugin.headercontrol.sections[2].text msgid "Operator" msgstr "" #: tfrmsearchplugin.headercontrol.sections[3].text msgctxt "tfrmsearchplugin.headercontrol.sections[3].text" msgid "Value" msgstr "" #: tfrmsearchplugin.rband.caption msgid "&AND (all match)" msgstr "" #: tfrmsearchplugin.rbor.caption msgid "&OR (any match)" msgstr "" #: tfrmselecttextrange.btppanel.cancelbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION" msgid "Cancel" msgstr "" #: tfrmselecttextrange.btppanel.closebutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION" msgid "&Close" msgstr "" #: tfrmselecttextrange.btppanel.helpbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION" msgid "&Help" msgstr "" #: tfrmselecttextrange.btppanel.okbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION" msgid "&OK" msgstr "" #: tfrmselecttextrange.lblselecttext.caption msgid "&Select the characters to insert:" msgstr "" #: tfrmsetfileproperties.btncancel.caption msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmsetfileproperties.btnok.caption msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmsetfileproperties.caption msgid "Change attributes" msgstr "" #: tfrmsetfileproperties.cbsgid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "" #: tfrmsetfileproperties.cbsticky.caption msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "" #: tfrmsetfileproperties.cbsuid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "" #: tfrmsetfileproperties.chkarchive.caption msgid "Archive" msgstr "" #: tfrmsetfileproperties.chkcreationtime.caption msgid "Created:" msgstr "" #: tfrmsetfileproperties.chkhidden.caption msgid "Hidden" msgstr "" #: tfrmsetfileproperties.chklastaccesstime.caption msgid "Accessed:" msgstr "" #: tfrmsetfileproperties.chklastwritetime.caption msgid "Modified:" msgstr "" #: tfrmsetfileproperties.chkreadonly.caption msgid "Read only" msgstr "" #: tfrmsetfileproperties.chkrecursive.caption msgid "Including subfolders" msgstr "" #: tfrmsetfileproperties.chksystem.caption msgid "System" msgstr "" #: tfrmsetfileproperties.gbtimesamp.caption msgid "Timestamp properties" msgstr "" #: tfrmsetfileproperties.gbunixattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION" msgid "Attributes" msgstr "" #: tfrmsetfileproperties.gbwinattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION" msgid "Attributes" msgstr "" #: tfrmsetfileproperties.lblattrbitsstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "" #: tfrmsetfileproperties.lblattrgroupstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "" #: tfrmsetfileproperties.lblattrinfo.caption msgctxt "tfrmsetfileproperties.lblattrinfo.caption" msgid "(gray field means unchanged value)" msgstr "" #: tfrmsetfileproperties.lblattrotherstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "" #: tfrmsetfileproperties.lblattrownerstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "" #: tfrmsetfileproperties.lblattrtext.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "" #: tfrmsetfileproperties.lblattrtextstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "" #: tfrmsetfileproperties.lblexec.caption msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "" #: tfrmsetfileproperties.lblmodeinfo.caption msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION" msgid "(gray field means unchanged value)" msgstr "" #: tfrmsetfileproperties.lbloctal.caption msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "" #: tfrmsetfileproperties.lblread.caption msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "" #: tfrmsetfileproperties.lblwrite.caption msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "" #: tfrmsplitter.btncancel.caption msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmsplitter.btnftchoice.caption msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION" msgid "..." msgstr "" #: tfrmsplitter.btnok.caption msgctxt "TFRMSPLITTER.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmsplitter.btnrelativeftchoice.hint msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT" msgid "Some functions to select appropriate path" msgstr "" #: tfrmsplitter.caption msgid "Splitter" msgstr "" #: tfrmsplitter.cbrequireacrc32verificationfile.caption msgid "Require a CRC32 verification file" msgstr "" #: tfrmsplitter.cmbxsize.text msgid "1457664B - 3.5\"" msgstr "" #: tfrmsplitter.grbxfile.caption msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION" msgid "File name" msgstr "" #: tfrmsplitter.grbxsize.caption msgid "Size and number of parts" msgstr "" #: tfrmsplitter.lbdirtarget.caption msgid "Directory &target" msgstr "" #: tfrmsplitter.lbfilesource.caption msgid "File &source" msgstr "" #: tfrmsplitter.lblnumberparts.caption msgid "&Number of parts" msgstr "" #: tfrmsplitter.rbtnbyte.caption msgid "&Bytes" msgstr "" #: tfrmsplitter.rbtngigab.caption msgid "&Gigabytes" msgstr "" #: tfrmsplitter.rbtnkilob.caption msgid "&Kilobytes" msgstr "" #: tfrmsplitter.rbtnmegab.caption msgid "&Megabytes" msgstr "" #: tfrmstartingsplash.caption msgctxt "TFRMSTARTINGSPLASH.CAPTION" msgid "Double Commander" msgstr "" #: tfrmstartingsplash.lblbuild.caption msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION" msgid "Build" msgstr "" #: tfrmstartingsplash.lblfreepascalver.caption msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION" msgid "Free Pascal" msgstr "" #: tfrmstartingsplash.lbllazarusver.caption msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION" msgid "Lazarus" msgstr "" #: tfrmstartingsplash.lbloperatingsystem.caption msgid "Operating System" msgstr "" #: tfrmstartingsplash.lblplatform.caption msgid "Platform" msgstr "" #: tfrmstartingsplash.lblrevision.caption msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION" msgid "Revision" msgstr "" #: tfrmstartingsplash.lbltitle.caption msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION" msgid "Double Commander" msgstr "" #: tfrmstartingsplash.lblversion.caption msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION" msgid "Version" msgstr "" #: tfrmstartingsplash.lblwidgetsetver.caption msgid "WidgetsetVer" msgstr "" #: tfrmsymlink.btncancel.caption msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmsymlink.btnok.caption msgctxt "TFRMSYMLINK.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmsymlink.caption msgid "Create symbolic link" msgstr "" #: tfrmsymlink.lblexistingfile.caption msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "" #: tfrmsymlink.lbllinktocreate.caption msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "" #: tfrmsyncdirsdlg.btnclose.caption msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION" msgid "Close" msgstr "" #: tfrmsyncdirsdlg.btncompare.caption msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION" msgid "Compare" msgstr "" #: tfrmsyncdirsdlg.btnseldir1.caption msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION" msgid ">>" msgstr "" #: tfrmsyncdirsdlg.btnseldir2.caption msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION" msgid ">>" msgstr "" #: tfrmsyncdirsdlg.btnsynchronize.caption msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption" msgid "Synchronize" msgstr "" #: tfrmsyncdirsdlg.caption msgid "Synchronize directories" msgstr "" #: tfrmsyncdirsdlg.cbextfilter.text msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT" msgid "*.*" msgstr "" #: tfrmsyncdirsdlg.chkasymmetric.caption msgid "asymmetric" msgstr "" #: tfrmsyncdirsdlg.chkbycontent.caption msgid "by content" msgstr "" #: tfrmsyncdirsdlg.chkignoredate.caption msgid "ignore date" msgstr "" #: tfrmsyncdirsdlg.chkonlyselected.caption msgid "only selected" msgstr "" #: tfrmsyncdirsdlg.chksubdirs.caption msgid "Subdirs" msgstr "" #: tfrmsyncdirsdlg.groupbox1.caption msgid "Show:" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[0].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION" msgid "Name" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[1].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION" msgid "Size" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[2].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION" msgid "Date" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[3].title.caption msgid "<=>" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[4].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION" msgid "Date" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[5].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION" msgid "Size" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[6].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION" msgid "Name" msgstr "" #: tfrmsyncdirsdlg.label1.caption msgid "(in main window)" msgstr "" #: tfrmsyncdirsdlg.menuitemcompare.caption msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION" msgid "Compare" msgstr "" #: tfrmsyncdirsdlg.menuitemviewleft.caption msgid "View left" msgstr "" #: tfrmsyncdirsdlg.menuitemviewright.caption msgid "View right" msgstr "" #: tfrmsyncdirsdlg.sbcopyleft.caption msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION" msgid "<" msgstr "" #: tfrmsyncdirsdlg.sbcopyright.caption msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION" msgid ">" msgstr "" #: tfrmsyncdirsdlg.sbduplicates.caption msgid "duplicates" msgstr "" #: tfrmsyncdirsdlg.sbequal.caption msgid "=" msgstr "" #: tfrmsyncdirsdlg.sbnotequal.caption msgid "!=" msgstr "" #: tfrmsyncdirsdlg.sbsingles.caption msgid "singles" msgstr "" #: tfrmsyncdirsdlg.statusbar1.panels[0].text msgid "Please press \"Compare\" to start" msgstr "" #: tfrmsyncdirsperformdlg.caption msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION" msgid "Synchronize" msgstr "" #: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption msgid "Confirm overwrites" msgstr "" #: tfrmtreeviewmenu.caption msgctxt "tfrmtreeviewmenu.caption" msgid "Tree View Menu" msgstr "" #: tfrmtreeviewmenu.lblsearchingentry.caption msgid "Select your hot directory:" msgstr "" #: tfrmtreeviewmenu.pmicasesensitive.caption msgid "Search is case sensitive" msgstr "" #: tfrmtreeviewmenu.pmifullcollapse.caption msgid "Full collapse" msgstr "" #: tfrmtreeviewmenu.pmifullexpand.caption msgid "Full expand" msgstr "" #: tfrmtreeviewmenu.pmiignoreaccents.caption msgid "Search ignore accents and ligatures" msgstr "" #: tfrmtreeviewmenu.pminotcasesensitive.caption msgid "Search is not case sensitive" msgstr "" #: tfrmtreeviewmenu.pminotignoreaccents.caption msgid "Search is strict regarding accents and ligatures" msgstr "" #: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption msgid "Don't show the branch content \"just\" because the searched string is found in the branche name" msgstr "" #: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption msgid "If searched string is found in a branch name, show the whole branch even if elements don't match" msgstr "" #: tfrmtreeviewmenu.tbcancelandquit.hint msgid "Close Tree View Menu" msgstr "" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT" msgid "Configuration of Tree View Menu" msgstr "" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT" msgid "Configuration of Tree View Menu Colors" msgstr "" #: tfrmtweakplugin.btnadd.caption msgid "A&dd new" msgstr "" #: tfrmtweakplugin.btncancel.caption msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "" #: tfrmtweakplugin.btnchange.caption msgid "C&hange" msgstr "" #: tfrmtweakplugin.btndefault.caption msgid "De&fault" msgstr "" #: tfrmtweakplugin.btnok.caption msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION" msgid "&OK" msgstr "" #: tfrmtweakplugin.btnremove.caption msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION" msgid "&Remove" msgstr "" #: tfrmtweakplugin.caption msgid "Tweak plugin" msgstr "" #: tfrmtweakplugin.cbpk_caps_by_content.caption msgid "De&tect archive type by content" msgstr "" #: tfrmtweakplugin.cbpk_caps_delete.caption msgid "Can de&lete files" msgstr "" #: tfrmtweakplugin.cbpk_caps_encrypt.caption msgid "Supports e&ncryption" msgstr "" #: tfrmtweakplugin.cbpk_caps_hide.caption msgid "Sho&w as normal files (hide packer icon)" msgstr "" #: tfrmtweakplugin.cbpk_caps_mempack.caption msgid "Supports pac&king in memory" msgstr "" #: tfrmtweakplugin.cbpk_caps_modify.caption msgid "Can &modify existing archives" msgstr "" #: tfrmtweakplugin.cbpk_caps_multiple.caption msgid "&Archive can contain multiple files" msgstr "" #: tfrmtweakplugin.cbpk_caps_new.caption msgid "Can create new archi&ves" msgstr "" #: tfrmtweakplugin.cbpk_caps_options.caption msgid "S&upports the options dialogbox" msgstr "" #: tfrmtweakplugin.cbpk_caps_searchtext.caption msgid "Allow searchin&g for text in archives" msgstr "" #: tfrmtweakplugin.lbldescription.caption msgid "&Description:" msgstr "" #: tfrmtweakplugin.lbldetectstr.caption msgid "D&etect string:" msgstr "" #: tfrmtweakplugin.lblextension.caption msgid "&Extension:" msgstr "" #: tfrmtweakplugin.lblflags.caption msgid "Flags:" msgstr "" #: tfrmtweakplugin.lblname.caption msgctxt "tfrmtweakplugin.lblname.caption" msgid "&Name:" msgstr "" #: tfrmtweakplugin.lblplugin.caption msgctxt "tfrmtweakplugin.lblplugin.caption" msgid "&Plugin:" msgstr "" #: tfrmtweakplugin.lblplugin1.caption msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION" msgid "&Plugin:" msgstr "" #: tfrmviewer.actabout.caption msgid "About Viewer..." msgstr "" #: tfrmviewer.actabout.hint msgid "Displays the About message" msgstr "" #: tfrmviewer.actchangeencoding.caption msgid "Change encoding" msgstr "" #: tfrmviewer.actcopyfile.caption msgctxt "tfrmviewer.actcopyfile.caption" msgid "Copy File" msgstr "" #: tfrmviewer.actcopyfile.hint msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT" msgid "Copy File" msgstr "" #: tfrmviewer.actcopytoclipboard.caption msgctxt "TFRMVIEWER.ACTCOPYTOCLIPBOARD.CAPTION" msgid "Copy To Clipboard" msgstr "" #: tfrmviewer.actcopytoclipboardformatted.caption msgid "Copy To Clipboard Formatted" msgstr "" #: tfrmviewer.actdeletefile.caption msgctxt "tfrmviewer.actdeletefile.caption" msgid "Delete File" msgstr "" #: tfrmviewer.actdeletefile.hint msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT" msgid "Delete File" msgstr "" #: tfrmviewer.actexitviewer.caption msgctxt "TFRMVIEWER.ACTEXITVIEWER.CAPTION" msgid "E&xit" msgstr "" #: tfrmviewer.actfind.caption msgctxt "TFRMVIEWER.ACTFIND.CAPTION" msgid "Find" msgstr "" #: tfrmviewer.actfindnext.caption msgctxt "TFRMVIEWER.ACTFINDNEXT.CAPTION" msgid "Find next" msgstr "" #: tfrmviewer.actfindprev.caption msgctxt "TFRMVIEWER.ACTFINDPREV.CAPTION" msgid "Find previous" msgstr "" #: tfrmviewer.actfullscreen.caption msgctxt "TFRMVIEWER.ACTFULLSCREEN.CAPTION" msgid "Full Screen" msgstr "" #: tfrmviewer.actimagecenter.caption msgid "Center" msgstr "" #: tfrmviewer.actloadnextfile.caption msgid "&Next" msgstr "" #: tfrmviewer.actloadnextfile.hint msgid "Load Next File" msgstr "" #: tfrmviewer.actloadprevfile.caption msgid "&Previous" msgstr "" #: tfrmviewer.actloadprevfile.hint msgid "Load Previous File" msgstr "" #: tfrmviewer.actmirrorhorz.caption msgid "Mirror Horizontally" msgstr "" #: tfrmviewer.actmirrorhorz.hint msgid "Mirror" msgstr "" #: tfrmviewer.actmirrorvert.caption msgid "Mirror Vertically" msgstr "" #: tfrmviewer.actmovefile.caption msgctxt "tfrmviewer.actmovefile.caption" msgid "Move File" msgstr "" #: tfrmviewer.actmovefile.hint msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT" msgid "Move File" msgstr "" #: tfrmviewer.actpreview.caption msgctxt "tfrmviewer.actpreview.caption" msgid "Preview" msgstr "" #: tfrmviewer.actreload.caption msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION" msgid "Reload" msgstr "" #: tfrmviewer.actreload.hint msgid "Reload current file" msgstr "" #: tfrmviewer.actrotate180.caption msgid "+ 180" msgstr "" #: tfrmviewer.actrotate180.hint msgid "Rotate 180 degrees" msgstr "" #: tfrmviewer.actrotate270.caption msgid "- 90" msgstr "" #: tfrmviewer.actrotate270.hint msgid "Rotate -90 degrees" msgstr "" #: tfrmviewer.actrotate90.caption msgid "+ 90" msgstr "" #: tfrmviewer.actrotate90.hint msgid "Rotate +90 degrees" msgstr "" #: tfrmviewer.actsave.caption msgctxt "TFRMVIEWER.ACTSAVE.CAPTION" msgid "Save" msgstr "" #: tfrmviewer.actsaveas.caption msgid "Save As..." msgstr "" #: tfrmviewer.actsaveas.hint msgid "Save File As..." msgstr "" #: tfrmviewer.actscreenshot.caption msgctxt "TFRMVIEWER.ACTSCREENSHOT.CAPTION" msgid "Screenshot" msgstr "" #: tfrmviewer.actscreenshotdelay3sec.caption msgid "Delay 3 sec" msgstr "" #: tfrmviewer.actscreenshotdelay5sec.caption msgid "Delay 5 sec" msgstr "" #: tfrmviewer.actselectall.caption msgctxt "TFRMVIEWER.ACTSELECTALL.CAPTION" msgid "Select All" msgstr "" #: tfrmviewer.actshowasbin.caption msgid "Show as &Bin" msgstr "" #: tfrmviewer.actshowasbook.caption msgid "Show as B&ook" msgstr "" #: tfrmviewer.actshowasdec.caption msgid "Show as &Dec" msgstr "" #: tfrmviewer.actshowashex.caption msgid "Show as &Hex" msgstr "" #: tfrmviewer.actshowastext.caption msgid "Show as &Text" msgstr "" #: tfrmviewer.actshowaswraptext.caption msgid "Show as &Wrap text" msgstr "" #: tfrmviewer.actshowgraphics.caption msgid "Graphics" msgstr "" #: tfrmviewer.actshowplugins.caption msgctxt "TFRMVIEWER.ACTSHOWPLUGINS.CAPTION" msgid "Plugins" msgstr "" #: tfrmviewer.actstretchimage.caption msgid "Stretch" msgstr "" #: tfrmviewer.actstretchimage.hint msgid "Stretch Image" msgstr "" #: tfrmviewer.actstretchonlylarge.caption msgid "Stretch only large" msgstr "" #: tfrmviewer.actzoom.caption msgid "Zoom" msgstr "" #: tfrmviewer.actzoomin.caption msgid "Zoom In" msgstr "" #: tfrmviewer.actzoomout.caption msgid "Zoom Out" msgstr "" #: tfrmviewer.btncopyfile.hint msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT" msgid "Copy" msgstr "" #: tfrmviewer.btncopyfile1.hint msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT" msgid "Copy" msgstr "" #: tfrmviewer.btncuttuimage.hint msgid "Crop" msgstr "" #: tfrmviewer.btndeletefile.hint msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT" msgid "Delete" msgstr "" #: tfrmviewer.btndeletefile1.hint msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT" msgid "Delete" msgstr "" #: tfrmviewer.btnfullscreen.hint msgctxt "tfrmviewer.btnfullscreen.hint" msgid "Full Screen" msgstr "" #: tfrmviewer.btngifmove.caption msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION" msgid "||" msgstr "" #: tfrmviewer.btngiftobmp.caption msgid "S" msgstr "" #: tfrmviewer.btnhightlight.hint msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT" msgid "Highlight" msgstr "" #: tfrmviewer.btnmovefile.hint msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT" msgid "Move" msgstr "" #: tfrmviewer.btnmovefile1.hint msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT" msgid "Move" msgstr "" #: tfrmviewer.btnnextgifframe.caption msgid "||>" msgstr "" #: tfrmviewer.btnpaint.hint msgctxt "TFRMVIEWER.BTNPAINT.HINT" msgid "Paint" msgstr "" #: tfrmviewer.btnprevgifframe.caption msgid "<||" msgstr "" #: tfrmviewer.btnredeye.hint msgid "Red Eyes" msgstr "" #: tfrmviewer.btnresize.hint msgid "Resize" msgstr "" #: tfrmviewer.btnundo.hint msgctxt "TFRMVIEWER.BTNUNDO.HINT" msgid "Undo" msgstr "" #: tfrmviewer.caption msgctxt "tfrmviewer.caption" msgid "Viewer" msgstr "" #: tfrmviewer.cbslideshow.caption msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "" #: tfrmviewer.comboboxpaint.text msgid "Pen" msgstr "" #: tfrmviewer.comboboxwidth.text msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT" msgid "1" msgstr "" #: tfrmviewer.gboxhightlight.caption msgctxt "tfrmviewer.gboxhightlight.caption" msgid "Highlight" msgstr "" #: tfrmviewer.gboxpaint.caption msgctxt "tfrmviewer.gboxpaint.caption" msgid "Paint" msgstr "" #: tfrmviewer.gboxslideshow.caption msgctxt "tfrmviewer.gboxslideshow.caption" msgid "Slide Show" msgstr "" #: tfrmviewer.gboxview.caption msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION" msgid "View" msgstr "" #: tfrmviewer.lblhightlight.caption msgid "0x0" msgstr "" #: tfrmviewer.miabout.caption msgctxt "TFRMVIEWER.MIABOUT.CAPTION" msgid "About" msgstr "" #: tfrmviewer.midiv1.caption msgctxt "TFRMVIEWER.MIDIV1.CAPTION" msgid "-" msgstr "" #: tfrmviewer.midiv2.caption msgctxt "TFRMVIEWER.MIDIV2.CAPTION" msgid "-" msgstr "" #: tfrmviewer.midiv3.caption msgctxt "TFRMVIEWER.MIDIV3.CAPTION" msgid "-" msgstr "" #: tfrmviewer.midiv4.caption msgctxt "TFRMVIEWER.MIDIV4.CAPTION" msgid "-" msgstr "" #: tfrmviewer.midiv5.caption msgctxt "TFRMVIEWER.MIDIV5.CAPTION" msgid "-" msgstr "" #: tfrmviewer.miedit.caption msgctxt "TFRMVIEWER.MIEDIT.CAPTION" msgid "&Edit" msgstr "" #: tfrmviewer.miencoding.caption msgctxt "TFRMVIEWER.MIENCODING.CAPTION" msgid "En&coding" msgstr "" #: tfrmviewer.mifile.caption msgctxt "TFRMVIEWER.MIFILE.CAPTION" msgid "&File" msgstr "" #: tfrmviewer.miimage.caption msgid "&Image" msgstr "" #: tfrmviewer.miprint.caption msgid "Print..." msgstr "" #: tfrmviewer.mirotate.caption msgid "Rotate" msgstr "" #: tfrmviewer.miscreenshot.caption msgctxt "tfrmviewer.miscreenshot.caption" msgid "Screenshot" msgstr "" #: tfrmviewer.miseparator.caption msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION" msgid "-" msgstr "" #: tfrmviewer.miview.caption msgctxt "TFRMVIEWER.MIVIEW.CAPTION" msgid "&View" msgstr "" #: tfrmviewer.pmiselectall.caption msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION" msgid "Select All" msgstr "" #: tmultiarchivecopyoperationoptionsui.lblfileexists.caption msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption" msgid "When file exists" msgstr "" #: twcxarchivecopyoperationoptionsui.lblfileexists.caption msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "" #: twfxplugincopymoveoperationoptionsui.cbcopytime.caption msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION" msgid "Copy d&ate/time" msgstr "" #: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption msgid "Work in background (separate connection)" msgstr "" #: twfxplugincopymoveoperationoptionsui.lblfileexists.caption msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "" #: uexifreader.rsdatetimeoriginal msgid "Date taken" msgstr "" #: uexifreader.rsimageheight msgctxt "uexifreader.rsimageheight" msgid "Height" msgstr "" #: uexifreader.rsimagewidth msgctxt "uexifreader.rsimagewidth" msgid "Width" msgstr "" #: uexifreader.rsmake msgid "Manufacturer" msgstr "" #: uexifreader.rsmodel msgid "Camera model" msgstr "" #: uexifreader.rsorientation msgid "Orientation" msgstr "" #: ulng.msgtrytolocatecrcfile msgid "" "This file cannot be found and could help to validate final combination of files:\n" "%s\n" "\n" "Could you make it available and press \"OK\" when ready,\n" "or press \"CANCEL\" to continue without it?\n" msgstr "" #: ulng.rscancelfilter msgid "Cancel Quick Filter" msgstr "" #: ulng.rscanceloperation msgid "Cancel Current Operation" msgstr "" #: ulng.rscaptionforaskingfilename msgid "Enter filename, with extension, for dropped text" msgstr "" #: ulng.rscaptionfortextformattoimport msgid "Text format to import" msgstr "" #: ulng.rschecksumverifybroken msgid "Broken:" msgstr "" #: ulng.rschecksumverifygeneral msgid "General:" msgstr "" #: ulng.rschecksumverifymissing msgid "Missing:" msgstr "" #: ulng.rschecksumverifyreaderror msgid "Read error:" msgstr "" #: ulng.rschecksumverifysuccess msgid "Success:" msgstr "" #: ulng.rschecksumverifytext msgid "Enter checksum and select algorithm:" msgstr "" #: ulng.rschecksumverifytitle msgid "Verify checksum" msgstr "" #: ulng.rschecksumverifytotal msgid "Total:" msgstr "" #: ulng.rsclearfiltersornot msgid "Do you want to clear filters for this new search?" msgstr "" #: ulng.rsclipboardcontainsinvalidtoolbardata msgid "Clipboard doesn't contain any valid toolbar data." msgstr "" #: ulng.rscmdcategorylistinorder msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log" msgstr "" #: ulng.rscmdkindofsort msgid "Legacy sorted;A-Z sorted" msgstr "" #: ulng.rscolattr msgid "Attr" msgstr "" #: ulng.rscoldate msgctxt "ulng.rscoldate" msgid "Date" msgstr "" #: ulng.rscolext msgid "Ext" msgstr "" #: ulng.rscolname msgctxt "ulng.rscolname" msgid "Name" msgstr "" #: ulng.rscolsize msgctxt "ulng.rscolsize" msgid "Size" msgstr "" #: ulng.rsconfcolalign msgid "Align" msgstr "" #: ulng.rsconfcolcaption msgid "Caption" msgstr "" #: ulng.rsconfcoldelete msgctxt "ulng.rsconfcoldelete" msgid "Delete" msgstr "" #: ulng.rsconfcolfieldcont msgid "Field contents" msgstr "" #: ulng.rsconfcolmove msgctxt "ulng.rsconfcolmove" msgid "Move" msgstr "" #: ulng.rsconfcolwidth msgctxt "ulng.rsconfcolwidth" msgid "Width" msgstr "" #: ulng.rsconfcustheader msgid "Customize column" msgstr "" #: ulng.rsconfigurationfileassociation msgid "Configure file association" msgstr "" #: ulng.rsconfirmexecution msgid "Confirming command line and parameters" msgstr "" #: ulng.rscopynametemplate msgid "Copy (%d) %s" msgstr "" #: ulng.rsdefaultimporteddctoolbarhint msgid "Imported DC toolbar" msgstr "" #: ulng.rsdefaultimportedtctoolbarhint msgid "Imported TC toolbar" msgstr "" #: ulng.rsdefaultsuffixdroppedtext msgid "_DroppedText" msgstr "" #: ulng.rsdefaultsuffixdroppedtexthtmlfilename msgid "_DroppedHTMLtext" msgstr "" #: ulng.rsdefaultsuffixdroppedtextrichtextfilename msgid "_DroppedRichtext" msgstr "" #: ulng.rsdefaultsuffixdroppedtextsimplefilename msgid "_DroppedSimpleText" msgstr "" #: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename msgid "_DroppedUnicodeUTF16text" msgstr "" #: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename msgid "_DroppedUnicodeUTF8text" msgstr "" #: ulng.rsdiffadds msgid " Adds: " msgstr "" #: ulng.rsdiffdeletes msgid " Deletes: " msgstr "" #: ulng.rsdifffilesidentical msgid "The two files are identical!" msgstr "" #: ulng.rsdiffmatches msgid " Matches: " msgstr "" #: ulng.rsdiffmodifies msgid " Modifies: " msgstr "" #: ulng.rsdlgbuttonabort msgid "Ab&ort" msgstr "" #: ulng.rsdlgbuttonall msgctxt "ulng.rsdlgbuttonall" msgid "A&ll" msgstr "" #: ulng.rsdlgbuttonappend msgid "A&ppend" msgstr "" #: ulng.rsdlgbuttonautorenamesource msgid "A&uto-rename source files" msgstr "" #: ulng.rsdlgbuttoncancel msgctxt "ulng.rsdlgbuttoncancel" msgid "&Cancel" msgstr "" #: ulng.rsdlgbuttoncontinue msgid "&Continue" msgstr "" #: ulng.rsdlgbuttoncopyinto msgid "&Merge" msgstr "" #: ulng.rsdlgbuttoncopyintoall msgid "Mer&ge All" msgstr "" #: ulng.rsdlgbuttonexitprogram msgid "E&xit program" msgstr "" #: ulng.rsdlgbuttonignore msgid "Ig&nore" msgstr "" #: ulng.rsdlgbuttonignoreall msgid "I&gnore All" msgstr "" #: ulng.rsdlgbuttonno msgid "&No" msgstr "" #: ulng.rsdlgbuttonnone msgid "Non&e" msgstr "" #: ulng.rsdlgbuttonok msgctxt "ulng.rsdlgbuttonok" msgid "&OK" msgstr "" #: ulng.rsdlgbuttonother msgid "Ot&her" msgstr "" #: ulng.rsdlgbuttonoverwrite msgid "&Overwrite" msgstr "" #: ulng.rsdlgbuttonoverwriteall msgid "Overwrite &All" msgstr "" #: ulng.rsdlgbuttonoverwritelarger msgid "Overwrite All &Larger" msgstr "" #: ulng.rsdlgbuttonoverwriteolder msgid "Overwrite All Ol&der" msgstr "" #: ulng.rsdlgbuttonoverwritesmaller msgid "Overwrite All S&maller" msgstr "" #: ulng.rsdlgbuttonrename msgctxt "ulng.rsdlgbuttonrename" msgid "R&ename" msgstr "" #: ulng.rsdlgbuttonresume msgid "&Resume" msgstr "" #: ulng.rsdlgbuttonretry msgid "Re&try" msgstr "" #: ulng.rsdlgbuttonretryadmin msgid "As Ad&ministrator" msgstr "" #: ulng.rsdlgbuttonskip msgid "&Skip" msgstr "" #: ulng.rsdlgbuttonskipall msgid "S&kip All" msgstr "" #: ulng.rsdlgbuttonyes msgid "&Yes" msgstr "" #: ulng.rsdlgcp msgctxt "ulng.rsdlgcp" msgid "Copy file(s)" msgstr "" #: ulng.rsdlgmv msgid "Move file(s)" msgstr "" #: ulng.rsdlgoppause msgid "Pau&se" msgstr "" #: ulng.rsdlgopstart msgctxt "ulng.rsdlgopstart" msgid "&Start" msgstr "" #: ulng.rsdlgqueue msgid "Queue" msgstr "" #: ulng.rsdlgspeed msgid "Speed %s/s" msgstr "" #: ulng.rsdlgspeedtime msgid "Speed %s/s, time remaining %s" msgstr "" #: ulng.rsdraganddroptextformat msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format" msgstr "" #: ulng.rsdrivenolabel msgid "" msgstr "" #: ulng.rsdrivenomedia msgid "" msgstr "" #: ulng.rseditabouttext msgid "Internal Editor of Double Commander." msgstr "" #: ulng.rseditgotolinequery msgid "Goto line:" msgstr "" #: ulng.rseditgotolinetitle msgid "Goto Line" msgstr "" #: ulng.rseditnewfile msgid "new.txt" msgstr "" #: ulng.rseditnewfilename msgid "Filename:" msgstr "" #: ulng.rseditnewopen msgid "Open file" msgstr "" #: ulng.rseditsearchback msgid "&Backward" msgstr "" #: ulng.rseditsearchcaption msgid "Search" msgstr "" #: ulng.rseditsearchfrw msgid "&Forward" msgstr "" #: ulng.rseditsearchreplace msgctxt "ulng.rseditsearchreplace" msgid "Replace" msgstr "" #: ulng.rseditwithexternaleditor msgid "with external editor" msgstr "" #: ulng.rseditwithinternaleditor msgid "with internal editor" msgstr "" #: ulng.rsexecuteviashell msgctxt "ulng.rsexecuteviashell" msgid "Execute via shell" msgstr "" #: ulng.rsexecuteviaterminalclose msgctxt "ulng.rsexecuteviaterminalclose" msgid "Execute via terminal and close" msgstr "" #: ulng.rsexecuteviaterminalstayopen msgctxt "ulng.rsexecuteviaterminalstayopen" msgid "Execute via terminal and stay open" msgstr "" #: ulng.rsfavtabspanelsideselection msgid "Left;Right;Active;Inactive;Both;None" msgstr "" #: ulng.rsfavtabssavedirhistory msgid "No;Yes" msgstr "" #: ulng.rsfilenameexportedtcbarprefix msgid "Exported_from_DC" msgstr "" #: ulng.rsfileopdirectoryexistsoptions msgid "Ask;Merge;Skip" msgstr "" #: ulng.rsfileopfileexistsoptions msgid "Ask;Overwrite;Overwrite Older;Skip" msgstr "" #: ulng.rsfileopsetpropertyerroroptions msgid "Ask;Don't set anymore;Ignore errors" msgstr "" #: ulng.rsfilterstatus msgid "FILTER" msgstr "" #: ulng.rsfinddefinetemplate msgid "Define template" msgstr "" #: ulng.rsfinddepth msgid "%s level(s)" msgstr "" #: ulng.rsfinddepthall msgid "all (unlimited depth)" msgstr "" #: ulng.rsfinddepthcurdir msgid "current dir only" msgstr "" #: ulng.rsfinddirnoex msgid "Directory %s does not exist!" msgstr "" #: ulng.rsfindfound msgid "Found: %d" msgstr "" #: ulng.rsfindsavetemplatecaption msgid "Save search template" msgstr "" #: ulng.rsfindsavetemplatetitle msgid "Template name:" msgstr "" #: ulng.rsfindscanned msgid "Scanned: %d" msgstr "" #: ulng.rsfindscanning msgid "Scanning" msgstr "" #: ulng.rsfindsearchfiles msgctxt "ulng.rsfindsearchfiles" msgid "Find files" msgstr "" #: ulng.rsfindtimeofscan msgid "Time of scan: " msgstr "" #: ulng.rsfindwherebeg msgid "Begin at" msgstr "" #: ulng.rsfreemsg msgid "Free %s from %s bytes" msgstr "" #: ulng.rsfreemsgshort msgid "%s bytes free" msgstr "" #: ulng.rsfuncatime msgid "Access date/time" msgstr "" #: ulng.rsfuncattr msgctxt "ulng.rsfuncattr" msgid "Attributes" msgstr "" #: ulng.rsfunccomment msgid "Comment" msgstr "" #: ulng.rsfunccompressedsize msgid "Compressed size" msgstr "" #: ulng.rsfuncctime msgid "Creation date/time" msgstr "" #: ulng.rsfuncext msgid "Extension" msgstr "" #: ulng.rsfuncgroup msgctxt "ulng.rsfuncgroup" msgid "Group" msgstr "" #: ulng.rsfunchtime msgid "Change date/time" msgstr "" #: ulng.rsfunclinkto msgid "Link to" msgstr "" #: ulng.rsfuncmtime msgid "Modification date/time" msgstr "" #: ulng.rsfuncname msgctxt "ulng.rsfuncname" msgid "Name" msgstr "" #: ulng.rsfuncnamenoext msgid "Name without extension" msgstr "" #: ulng.rsfuncowner msgctxt "ulng.rsfuncowner" msgid "Owner" msgstr "" #: ulng.rsfuncpath msgctxt "ulng.rsfuncpath" msgid "Path" msgstr "" #: ulng.rsfuncsize msgctxt "ulng.rsfuncsize" msgid "Size" msgstr "" #: ulng.rsfunctype msgid "Type" msgstr "" #: ulng.rsharderrcreate msgid "Error creating hardlink." msgstr "" #: ulng.rshotdirforcesortingorderchoices msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9" msgstr "" #: ulng.rshotdirwarningabortrestorebackup msgid "" "Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n" "\n" "Are you sure you want to proceed?\n" msgstr "" #: ulng.rshotkeycategorycopymovedialog msgid "Copy/Move Dialog" msgstr "" #: ulng.rshotkeycategorydiffer msgctxt "ulng.rshotkeycategorydiffer" msgid "Differ" msgstr "" #: ulng.rshotkeycategoryeditcommentdialog msgid "Edit Comment Dialog" msgstr "" #: ulng.rshotkeycategoryeditor msgctxt "ulng.rshotkeycategoryeditor" msgid "Editor" msgstr "" #: ulng.rshotkeycategoryfindfiles msgctxt "ulng.rshotkeycategoryfindfiles" msgid "Find files" msgstr "" #: ulng.rshotkeycategorymain msgid "Main" msgstr "" #: ulng.rshotkeycategoryviewer msgctxt "ulng.rshotkeycategoryviewer" msgid "Viewer" msgstr "" #: ulng.rshotkeyfilealreadyexists msgid "" "A setup with that name already exists.\n" "Do you want to overwrite it?\n" msgstr "" #: ulng.rshotkeyfileconfirmdefault msgid "Are you sure you want to restore default?" msgstr "" #: ulng.rshotkeyfileconfirmerasure msgid "Are you sure you want to erase setup \"%s\"?" msgstr "" #: ulng.rshotkeyfilecopyof msgid "Copy of %s" msgstr "" #: ulng.rshotkeyfileinputnewname msgid "Input your new name" msgstr "" #: ulng.rshotkeyfilemustkeepone msgid "You must keep at least one shortcut file." msgstr "" #: ulng.rshotkeyfilenewname msgid "New name" msgstr "" #: ulng.rshotkeyfilesavemodified msgid "" "\"%s\" setup has been modified.\n" "Do you want to save it now?\n" msgstr "" #: ulng.rshotkeynoscenter msgid "No shortcut with \"ENTER\"" msgstr "" #: ulng.rshotkeysortorder msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)" msgstr "" #: ulng.rsimporttoolbarproblem msgid "Cannot find reference to default bar file" msgstr "" #: ulng.rslistoffindfileswindows msgid "List of \"Find files\" windows" msgstr "" #: ulng.rsmarkminus msgid "Unselect mask" msgstr "" #: ulng.rsmarkplus msgid "Select mask" msgstr "" #: ulng.rsmaskinput msgid "Input mask:" msgstr "" #: ulng.rsmenuconfigurecolumnsalreadyexists msgid "A columns view with that name already exists." msgstr "" #: ulng.rsmenuconfigurecolumnssavetochange msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one" msgstr "" #: ulng.rsmenuconfigurecustomcolumns msgid "Configure custom columns" msgstr "" #: ulng.rsmenuconfigureentercustomcolumnname msgid "Enter new custom columns name" msgstr "" #: ulng.rsmnuactions msgctxt "ulng.rsmnuactions" msgid "Actions" msgstr "" #: ulng.rsmnucopynetnamestoclip msgid "Copy names with UNC path" msgstr "" #: ulng.rsmnudisconnectnetworkdrive msgid "Disconnect Network Drive..." msgstr "" #: ulng.rsmnuedit msgctxt "ulng.rsmnuedit" msgid "Edit" msgstr "" #: ulng.rsmnueject msgid "Eject" msgstr "" #: ulng.rsmnuextracthere msgid "Extract here..." msgstr "" #: ulng.rsmnumapnetworkdrive msgid "Map Network Drive..." msgstr "" #: ulng.rsmnumount msgid "Mount" msgstr "" #: ulng.rsmnunew msgctxt "ulng.rsmnunew" msgid "New" msgstr "" #: ulng.rsmnunomedia msgid "No media available" msgstr "" #: ulng.rsmnuopen msgctxt "ulng.rsmnuopen" msgid "Open" msgstr "" #: ulng.rsmnuopenwith msgid "Open with" msgstr "" #: ulng.rsmnuopenwithother msgctxt "ulng.rsmnuopenwithother" msgid "Other..." msgstr "" #: ulng.rsmnupackhere msgid "Pack here..." msgstr "" #: ulng.rsmnusortby msgid "Sort by" msgstr "" #: ulng.rsmnuumount msgid "Unmount" msgstr "" #: ulng.rsmnuview msgctxt "ulng.rsmnuview" msgid "View" msgstr "" #: ulng.rsmsgaccount msgid "Account:" msgstr "" #: ulng.rsmsgalldcintcmds msgid "All Double Commander internal commands" msgstr "" #: ulng.rsmsgarchivercustomparams msgid "Additional parameters for archiver command-line:" msgstr "" #: ulng.rsmsgaskquoteornot msgid "Do you want to enclose between quotes?" msgstr "" #: ulng.rsmsgbadcrc32 msgid "" "Bad CRC32 for resulting file:\n" "\"%s\"\n" "\n" "Do you want to keep the resulting corrupted file anyway?\n" msgstr "" #: ulng.rsmsgcannotcopymoveitself msgid "You can not copy/move a file \"%s\" to itself!" msgstr "" #: ulng.rsmsgcannotdeletedirectory msgid "Cannot delete directory %s" msgstr "" #: ulng.rsmsgcannotoverwritedirectory msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\"" msgstr "" #: ulng.rsmsgchdirfailed msgid "ChDir to [%s] failed!" msgstr "" #: ulng.rsmsgcloseallinactivetabs msgid "Remove all inactive tabs?" msgstr "" #: ulng.rsmsgcloselockedtab msgid "This tab (%s) is locked! Close anyway?" msgstr "" #: ulng.rsmsgcofirmuserparam msgid "Confirmation of parameter" msgstr "" #: ulng.rsmsgconfirmquit msgid "Are you sure you want to quit?" msgstr "" #: ulng.rsmsgcopybackward msgid "The file %s has changed. Do you want to copy it backward?" msgstr "" #: ulng.rsmsgcouldnotcopybackward msgid "Could not copy backward - do you want to keep the changed file?" msgstr "" #: ulng.rsmsgcpfldr msgid "Copy %d selected files/directories?" msgstr "" #: ulng.rsmsgcpsel msgid "Copy selected \"%s\"?" msgstr "" #: ulng.rsmsgcreateanewfiletype msgid "< Create a new file type \"%s files\" >" msgstr "" #: ulng.rsmsgdctoolbarwheretosave msgid "Enter location and filename where to save a DC Toolbar file" msgstr "" #: ulng.rsmsgdefaultcustomactionname msgid "Custom action" msgstr "" #: ulng.rsmsgdeletepartiallycopied msgid "Delete the partially copied file ?" msgstr "" #: ulng.rsmsgdelfldr msgid "Delete %d selected files/directories?" msgstr "" #: ulng.rsmsgdelfldrt msgid "Delete %d selected files/directories into trash can?" msgstr "" #: ulng.rsmsgdelsel msgid "Delete selected \"%s\"?" msgstr "" #: ulng.rsmsgdelselt msgid "Delete selected \"%s\" into trash can?" msgstr "" #: ulng.rsmsgdeltotrashforce msgid "Can not delete \"%s\" to trash! Delete directly?" msgstr "" #: ulng.rsmsgdisknotavail msgid "Disk is not available" msgstr "" #: ulng.rsmsgentercustomaction msgid "Enter custom action name:" msgstr "" #: ulng.rsmsgenterfileext msgid "Enter file extension:" msgstr "" #: ulng.rsmsgentername msgid "Enter name:" msgstr "" #: ulng.rsmsgenternewfiletypename msgid "Enter name of new file type to create for extension \"%s\"" msgstr "" #: ulng.rsmsgerrbadarchive msgid "CRC error in archive data" msgstr "" #: ulng.rsmsgerrbaddata msgid "Data is bad" msgstr "" #: ulng.rsmsgerrcannotconnect msgid "Can not connect to server: \"%s\"" msgstr "" #: ulng.rsmsgerrcannotcopyfile msgid "Cannot copy file %s to %s" msgstr "" #: ulng.rsmsgerrcreatefiledirectoryexists msgid "There already exists a directory named \"%s\"." msgstr "" #: ulng.rsmsgerrdatenotsupported msgid "Date %s is not supported" msgstr "" #: ulng.rsmsgerrdirexists msgid "Directory %s exists!" msgstr "" #: ulng.rsmsgerreaborted msgid "Function aborted by user" msgstr "" #: ulng.rsmsgerreclose msgid "Error closing file" msgstr "" #: ulng.rsmsgerrecreate msgid "Cannot create file" msgstr "" #: ulng.rsmsgerrendarchive msgid "No more files in archive" msgstr "" #: ulng.rsmsgerreopen msgid "Cannot open existing file" msgstr "" #: ulng.rsmsgerreread msgid "Error reading from file" msgstr "" #: ulng.rsmsgerrewrite msgid "Error writing to file" msgstr "" #: ulng.rsmsgerrforcedir msgid "Can not create directory %s!" msgstr "" #: ulng.rsmsgerrinvalidlink msgid "Invalid link" msgstr "" #: ulng.rsmsgerrnofiles msgid "No files found" msgstr "" #: ulng.rsmsgerrnomemory msgid "Not enough memory" msgstr "" #: ulng.rsmsgerrnotsupported msgid "Function not supported!" msgstr "" #: ulng.rsmsgerrorincontextmenucommand msgid "Error in context menu command" msgstr "" #: ulng.rsmsgerrorloadingconfiguration msgid "Error when loading configuration" msgstr "" #: ulng.rsmsgerrregexpsyntax msgid "Syntax error in regular expression!" msgstr "" #: ulng.rsmsgerrrename msgid "Cannot rename file %s to %s" msgstr "" #: ulng.rsmsgerrsaveassociation msgid "Can not save association!" msgstr "" #: ulng.rsmsgerrsavefile msgid "Cannot save file" msgstr "" #: ulng.rsmsgerrsetattribute msgid "Can not set attributes for \"%s\"" msgstr "" #: ulng.rsmsgerrsetdatetime msgid "Can not set date/time for \"%s\"" msgstr "" #: ulng.rsmsgerrsetownership msgid "Can not set owner/group for \"%s\"" msgstr "" #: ulng.rsmsgerrsetpermissions msgid "Can not set permissions for \"%s\"" msgstr "" #: ulng.rsmsgerrsmallbuf msgid "Buffer too small" msgstr "" #: ulng.rsmsgerrtoomanyfiles msgid "Too many files to pack" msgstr "" #: ulng.rsmsgerrunknownformat msgid "Archive format unknown" msgstr "" #: ulng.rsmsgfavoritetabsdeleteallentries msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)" msgstr "" #: ulng.rsmsgfavoritetabsdraghereentry msgid "Drag here other entries" msgstr "" #: ulng.rsmsgfavoritetabsentername msgid "Enter a name this Favorite Tabs entry" msgstr "" #: ulng.rsmsgfavoritetabsenternametitle msgid "Saving a new Favorite Tabs entry" msgstr "" #: ulng.rsmsgfavoritetabsexportedsuccessfully msgid "Number of Favorite Tabs exported successfully: %d on %d" msgstr "" #: ulng.rsmsgfavoritetabsextramode msgid "Default extra setting for save dir history for new Favorite Tabs:" msgstr "" #: ulng.rsmsgfavoritetabsimportedsuccessfully msgid "Number of file(s) imported successfully: %d on %d" msgstr "" #: ulng.rsmsgfavoritetabsimportsubmenuname msgid "Legacy tabs imported" msgstr "" #: ulng.rsmsgfavoritetabsimporttitle msgid "Select .tab file(s) to import (could be more than one at the time!)" msgstr "" #: ulng.rsmsgfavoritetabsmodifiednoimport msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?" msgstr "" #: ulng.rsmsgfavoritetabssimplemode msgctxt "ulng.rsmsgfavoritetabssimplemode" msgid "Keep saving dir history with Favorite Tabs:" msgstr "" #: ulng.rsmsgfavoritetabssubmenuname msgctxt "ulng.rsmsgfavoritetabssubmenuname" msgid "Submenu name" msgstr "" #: ulng.rsmsgfavoritetabsthiswillloadfavtabs msgid "This will load the Favorite Tabs: \"%s\"" msgstr "" #: ulng.rsmsgfavortietabssaveoverexisting msgid "Save current tabs over existing Favorite Tabs entry" msgstr "" #: ulng.rsmsgfilechangedsave msgid "File %s changed, save?" msgstr "" #: ulng.rsmsgfileexistsfileinfo msgid "%s bytes, %s" msgstr "" #: ulng.rsmsgfileexistsoverwrite msgid "Overwrite:" msgstr "" #: ulng.rsmsgfileexistsrwrt msgid "File %s exists, overwrite?" msgstr "" #: ulng.rsmsgfileexistswithfile msgid "With file:" msgstr "" #: ulng.rsmsgfilenotfound msgid "File \"%s\" not found." msgstr "" #: ulng.rsmsgfileoperationsactive msgid "File operations active" msgstr "" #: ulng.rsmsgfileoperationsactivelong msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss." msgstr "" #: ulng.rsmsgfilepathovermaxpath msgid "" "The target name length (%d) is more than %d characters!\n" "%s\n" "Most programs will not be able to access a file/directory with such a long name!\n" msgstr "" #: ulng.rsmsgfilereadonly msgid "File %s is marked as read-only/hidden/system. Delete it?" msgstr "" #: ulng.rsmsgfilesizetoobig msgid "The file size of \"%s\" is too big for destination file system!" msgstr "" #: ulng.rsmsgfolderexistsrwrt msgid "Folder %s exists, merge?" msgstr "" #: ulng.rsmsgfollowsymlink msgid "Follow symlink \"%s\"?" msgstr "" #: ulng.rsmsgfortextformattoimport msgid "Select the text format to import" msgstr "" #: ulng.rsmsghotdiraddselecteddirectories msgid "Add %d selected dirs" msgstr "" #: ulng.rsmsghotdiraddselecteddirectory msgid "Add selected dir: " msgstr "" #: ulng.rsmsghotdiraddthisdirectory msgid "Add current dir: " msgstr "" #: ulng.rsmsghotdircommandname msgid "Do command" msgstr "" #: ulng.rsmsghotdircommandsample msgid "cm_somthing" msgstr "" #: ulng.rsmsghotdirconfighotlist msgctxt "ulng.rsmsghotdirconfighotlist" msgid "Configuration of Directory Hotlist" msgstr "" #: ulng.rsmsghotdirdeleteallentries msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)" msgstr "" #: ulng.rsmsghotdirdemocommand msgid "This will execute the following command:" msgstr "" #: ulng.rsmsghotdirdemoname msgid "This is hot dir named " msgstr "" #: ulng.rsmsghotdirdemopath msgid "This will change active frame to the following path:" msgstr "" #: ulng.rsmsghotdirdemotarget msgid "And inactive frame would change to the following path:" msgstr "" #: ulng.rsmsghotdirerrorbackuping msgid "Error backuping entries..." msgstr "" #: ulng.rsmsghotdirerrorexporting msgid "Error exporting entries..." msgstr "" #: ulng.rsmsghotdirexportall msgid "Export all!" msgstr "" #: ulng.rsmsghotdirexporthotlist msgid "Export Directory Hotlist - Select the entries you want to export" msgstr "" #: ulng.rsmsghotdirexportsel msgid "Export selected" msgstr "" #: ulng.rsmsghotdirimportall msgctxt "ulng.rsmsghotdirimportall" msgid "Import all!" msgstr "" #: ulng.rsmsghotdirimporthotlist msgid "Import Directory Hotlist - Select the entries you want to import" msgstr "" #: ulng.rsmsghotdirimportsel msgctxt "ulng.rsmsghotdirimportsel" msgid "Import selected" msgstr "" #: ulng.rsmsghotdirjustpath msgctxt "ulng.rsmsghotdirjustpath" msgid "&Path:" msgstr "" #: ulng.rsmsghotdirlocatehotlistfile msgid "Locate \".hotlist\" file to import" msgstr "" #: ulng.rsmsghotdirname msgid "Hotdir name" msgstr "" #: ulng.rsmsghotdirnbnewentries msgid "Number of new entries: %d" msgstr "" #: ulng.rsmsghotdirnothingtoexport msgid "Nothing selected to export!" msgstr "" #: ulng.rsmsghotdirpath msgid "Hotdir path" msgstr "" #: ulng.rsmsghotdirreaddselecteddirectory msgid "Re-Add selected dir: " msgstr "" #: ulng.rsmsghotdirreaddthisdirectory msgid "Re-Add current dir: " msgstr "" #: ulng.rsmsghotdirrestorewhat msgid "Enter location and filename of Directory Hotlist to restore" msgstr "" #: ulng.rsmsghotdirsimplecommand msgctxt "ulng.rsmsghotdirsimplecommand" msgid "Command:" msgstr "" #: ulng.rsmsghotdirsimpleendofmenu msgctxt "ulng.rsmsghotdirsimpleendofmenu" msgid "(end of sub menu)" msgstr "" #: ulng.rsmsghotdirsimplemenu msgctxt "ulng.rsmsghotdirsimplemenu" msgid "Menu &name:" msgstr "" #: ulng.rsmsghotdirsimplename msgctxt "ulng.rsmsghotdirsimplename" msgid "&Name:" msgstr "" #: ulng.rsmsghotdirsimpleseparator msgctxt "ulng.rsmsghotdirsimpleseparator" msgid "(separator)" msgstr "" #: ulng.rsmsghotdirsubmenuname msgctxt "ulng.rsmsghotdirsubmenuname" msgid "Submenu name" msgstr "" #: ulng.rsmsghotdirtarget msgid "Hotdir target" msgstr "" #: ulng.rsmsghotdirtiporderpath msgid "Determine if you want the active frame to be sorted in a specified order after changing directory" msgstr "" #: ulng.rsmsghotdirtipordertarget msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory" msgstr "" #: ulng.rsmsghotdirtipspecialdirbut msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc." msgstr "" #: ulng.rsmsghotdirtotalbackuped msgid "" "Total entries saved: %d\n" "\n" "Backup filename: %s\n" msgstr "" #: ulng.rsmsghotdirtotalexported msgid "Total entries exported: " msgstr "" #: ulng.rsmsghotdirwhattodelete msgid "" "Do you want to delete all elements inside the sub-menu [%s]?\n" "Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n" msgstr "" #: ulng.rsmsghotdirwheretosave msgid "Enter location and filename where to save a Directory Hotlist file" msgstr "" #: ulng.rsmsgincorrectfilelength msgid "Incorrect resulting filelength for file : \"%s\"" msgstr "" #: ulng.rsmsginsertnextdisk msgid "" "Please insert next disk or something similar.\n" "\n" "It is to allow writing this file:\n" "\"%s\"\n" "\n" "Number of bytes still to write: %d\n" msgstr "" #: ulng.rsmsginvalidcommandline msgid "Error in command line" msgstr "" #: ulng.rsmsginvalidfilename msgid "Invalid filename" msgstr "" #: ulng.rsmsginvalidformatofconfigurationfile msgid "Invalid format of configuration file" msgstr "" #: ulng.rsmsginvalidpath msgid "Invalid path" msgstr "" #: ulng.rsmsginvalidpathlong msgid "Path %s contains forbidden characters." msgstr "" #: ulng.rsmsginvalidplugin msgid "This is not a valid plugin!" msgstr "" #: ulng.rsmsginvalidpluginarchitecture msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!" msgstr "" #: ulng.rsmsginvalidquoting msgid "Invalid quoting" msgstr "" #: ulng.rsmsginvalidselection msgid "Invalid selection." msgstr "" #: ulng.rsmsgloadingfilelist msgid "Loading file list..." msgstr "" #: ulng.rsmsglocatetcconfiguation msgid "Locate TC configuration file (wincmd.ini)" msgstr "" #: ulng.rsmsglocatetcexecutable msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)" msgstr "" #: ulng.rsmsglogcopy msgid "Copy file %s" msgstr "" #: ulng.rsmsglogdelete msgid "Delete file %s" msgstr "" #: ulng.rsmsglogerror msgid "Error: " msgstr "" #: ulng.rsmsglogextcmdlaunch msgid "Launch external" msgstr "" #: ulng.rsmsglogextcmdresult msgid "Result external" msgstr "" #: ulng.rsmsglogextract msgid "Extract file %s" msgstr "" #: ulng.rsmsgloginfo msgid "Info: " msgstr "" #: ulng.rsmsgloglink msgid "Create link %s" msgstr "" #: ulng.rsmsglogmkdir msgid "Create directory %s" msgstr "" #: ulng.rsmsglogmove msgid "Move file %s" msgstr "" #: ulng.rsmsglogpack msgid "Pack to file %s" msgstr "" #: ulng.rsmsglogrmdir msgid "Remove directory %s" msgstr "" #: ulng.rsmsglogsuccess msgid "Done: " msgstr "" #: ulng.rsmsglogsymlink msgid "Create symlink %s" msgstr "" #: ulng.rsmsglogtest msgid "Test file integrity %s" msgstr "" #: ulng.rsmsglogwipe msgid "Wipe file %s" msgstr "" #: ulng.rsmsglogwipedir msgid "Wipe directory %s" msgstr "" #: ulng.rsmsgmasterpassword msgid "Master Password" msgstr "" #: ulng.rsmsgmasterpasswordenter msgid "Please enter the master password:" msgstr "" #: ulng.rsmsgnewfile msgid "New file" msgstr "" #: ulng.rsmsgnextvolunpack msgid "Next volume will be unpacked" msgstr "" #: ulng.rsmsgnofiles msgid "No files" msgstr "" #: ulng.rsmsgnofilesselected msgid "No files selected." msgstr "" #: ulng.rsmsgnofreespacecont msgid "No enough free space on target drive, Continue?" msgstr "" #: ulng.rsmsgnofreespaceretry msgid "No enough free space on target drive, Retry?" msgstr "" #: ulng.rsmsgnotdelete msgid "Can not delete file %s" msgstr "" #: ulng.rsmsgnotimplemented msgid "Not implemented." msgstr "" #: ulng.rsmsgobjectnotexists msgid "Object does not exist!" msgstr "" #: ulng.rsmsgpanelpreview msgctxt "ulng.rsmsgpanelpreview" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "" #: ulng.rsmsgpassword msgid "Password:" msgstr "" #: ulng.rsmsgpassworddiff msgid "Passwords are different!" msgstr "" #: ulng.rsmsgpasswordenter msgid "Please enter the password:" msgstr "" #: ulng.rsmsgpasswordfirewall msgid "Password (Firewall):" msgstr "" #: ulng.rsmsgpasswordverify msgid "Please re-enter the password for verification:" msgstr "" #: ulng.rsmsgpopuphotdelete msgid "&Delete %s" msgstr "" #: ulng.rsmsgpresetalreadyexists msgid "Preset \"%s\" already exists. Overwrite?" msgstr "" #: ulng.rsmsgproblemexecutingcommand msgid "Problem executing command (%s)" msgstr "" #: ulng.rsmsgpromptaskingfilename msgid "Filename for dropped text:" msgstr "" #: ulng.rsmsgprovidethisfile msgid "Please, make this file available. Retry?" msgstr "" #: ulng.rsmsgrenamefavtabs msgid "Enter new friendly name for this Favorite Tabs" msgstr "" #: ulng.rsmsgrenamefavtabsmenu msgid "Enter new name for this menu" msgstr "" #: ulng.rsmsgrenfldr msgid "Rename/move %d selected files/directories?" msgstr "" #: ulng.rsmsgrensel msgid "Rename/move selected \"%s\"?" msgstr "" #: ulng.rsmsgrestartforapplychanges msgid "Please, restart Double Commander in order to apply changes" msgstr "" #: ulng.rsmsgsekectfiletype msgid "Select to which file type to add extension \"%s\"" msgstr "" #: ulng.rsmsgselectedinfo msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d" msgstr "" #: ulng.rsmsgselectexecutablefile msgid "Select executable file for" msgstr "" #: ulng.rsmsgselectonlychecksumfiles msgid "Please select only checksum files!" msgstr "" #: ulng.rsmsgsellocnextvol msgid "Please select location of next volume" msgstr "" #: ulng.rsmsgsetvolumelabel msgid "Set volume label" msgstr "" #: ulng.rsmsgspecialdir msgid "Special Dirs" msgstr "" #: ulng.rsmsgspecialdiraddacti msgid "Add path from active frame" msgstr "" #: ulng.rsmsgspecialdiraddnonacti msgid "Add path from inactive frame" msgstr "" #: ulng.rsmsgspecialdirbrowssel msgid "Browse and use selected path" msgstr "" #: ulng.rsmsgspecialdirenvvar msgid "Use environment variable..." msgstr "" #: ulng.rsmsgspecialdirgotodc msgid "Go to Double Commander special path..." msgstr "" #: ulng.rsmsgspecialdirgotoenvvar msgid "Go to environment variable..." msgstr "" #: ulng.rsmsgspecialdirgotoother msgid "Go to other Windows special folder..." msgstr "" #: ulng.rsmsgspecialdirgototc msgid "Go to Windows special folder (TC)..." msgstr "" #: ulng.rsmsgspecialdirmakereltohotdir msgid "Make relative to hotdir path" msgstr "" #: ulng.rsmsgspecialdirmkabso msgid "Make path absolute" msgstr "" #: ulng.rsmsgspecialdirmkdcrel msgid "Make relative to Double Commander special path..." msgstr "" #: ulng.rsmsgspecialdirmkenvrel msgid "Make relative to environment variable..." msgstr "" #: ulng.rsmsgspecialdirmktctel msgid "Make relative to Windows special folder (TC)..." msgstr "" #: ulng.rsmsgspecialdirmkwnrel msgid "Make relative to other Windows special folder..." msgstr "" #: ulng.rsmsgspecialdirusedc msgid "Use Double Commander special path..." msgstr "" #: ulng.rsmsgspecialdirusehotdir msgid "Use hotdir path" msgstr "" #: ulng.rsmsgspecialdiruseother msgid "Use other Windows special folder..." msgstr "" #: ulng.rsmsgspecialdirusetc msgid "Use Windows special folder (TC)..." msgstr "" #: ulng.rsmsgtabforopeninginnewtab msgid "This tab (%s) is locked! Open directory in another tab?" msgstr "" #: ulng.rsmsgtabrenamecaption msgid "Rename tab" msgstr "" #: ulng.rsmsgtabrenameprompt msgid "New tab name:" msgstr "" #: ulng.rsmsgtargetdir msgid "Target path:" msgstr "" #: ulng.rsmsgtcconfignotfound msgid "" "Error! Cannot find the TC configuration file:\n" "%s\n" msgstr "" #: ulng.rsmsgtcexecutablenotfound msgid "" "Error! Cannot find the TC configuration executable:\n" "%s\n" msgstr "" #: ulng.rsmsgtcisrunning msgid "" "Error! TC is still running but it should be closed for this operation.\n" "Close it and press OK or press CANCEL to abort.\n" msgstr "" #: ulng.rsmsgtctoolbarnotfound msgid "" "Error! Cannot find the desired wanted TC toolbar output folder:\n" "%s\n" msgstr "" #: ulng.rsmsgtctoolbarwheretosave msgid "Enter location and filename where to save a TC Toolbar file" msgstr "" #: ulng.rsmsgthisisnowinclipboard msgid "\"%s\" is now in the clipboard" msgstr "" #: ulng.rsmsgtitleextnotinfiletype msgid "Extension of selected file is not in any recognized file types" msgstr "" #: ulng.rsmsgtoolbarlocatedctoolbarfile msgid "Locate \".toolbar\" file to import" msgstr "" #: ulng.rsmsgtoolbarlocatetctoolbarfile msgid "Locate \".BAR\" file to import" msgstr "" #: ulng.rsmsgtoolbarrestorewhat msgid "Enter location and filename of Toolbar to restore" msgstr "" #: ulng.rsmsgtoolbarsaved msgid "" "Saved!\n" "Toolbar filename: %s\n" msgstr "" #: ulng.rsmsgtoomanyfilesselected msgid "Too many files selected." msgstr "" #: ulng.rsmsgundeterminednumberoffile msgid "Undetermined" msgstr "" #: ulng.rsmsgunexpectedusagetreeviewmenu msgid "ERROR: Unexpected Tree View Menu usage!" msgstr "" #: ulng.rsmsgurl msgid "URL:" msgstr "" #: ulng.rsmsguserdidnotsetextension msgid "" msgstr "" #: ulng.rsmsguserdidnotsetname msgid "" msgstr "" #: ulng.rsmsgusername msgid "User name:" msgstr "" #: ulng.rsmsgusernamefirewall msgid "User name (Firewall):" msgstr "" #: ulng.rsmsgvolumelabel msgid "Volume label:" msgstr "" #: ulng.rsmsgvolumesizeenter msgid "Please enter the volume size:" msgstr "" #: ulng.rsmsgwipefldr msgid "Wipe %d selected files/directories?" msgstr "" #: ulng.rsmsgwipesel msgid "Wipe selected \"%s\"?" msgstr "" #: ulng.rsmsgwithactionwith msgid "with" msgstr "" #: ulng.rsmulrenautorename msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?" msgstr "" #: ulng.rsmulrenfilenamestylelist msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;" msgstr "" #: ulng.rsmulrenwarningduplicate msgid "Warning, duplicate names!" msgstr "" #: ulng.rsmulrenwronglinesnumber msgid "File contains wrong number of lines: %d, should be %d!" msgstr "" #: ulng.rsnewsearchclearfilteroptions msgid "Keep;Clear;Prompt" msgstr "" #: ulng.rsnoequivalentinternalcommand msgid "No internal equivalent command" msgstr "" #: ulng.rsnofindfileswindowyet msgid "Sorry, no \"Find files\" window yet..." msgstr "" #: ulng.rsnootherfindfileswindowtoclose msgid "Sorry, no other \"Find files\" window to close and free from memory..." msgstr "" #: ulng.rsoperaborted msgid "Aborted" msgstr "" #: ulng.rsopercalculatingchecksum msgid "Calculating checksum" msgstr "" #: ulng.rsopercalculatingchecksumin msgid "Calculating checksum in \"%s\"" msgstr "" #: ulng.rsopercalculatingchecksumof msgid "Calculating checksum of \"%s\"" msgstr "" #: ulng.rsopercalculatingstatictics msgid "Calculating" msgstr "" #: ulng.rsopercalculatingstatisticsin msgid "Calculating \"%s\"" msgstr "" #: ulng.rsopercombining msgid "Joining" msgstr "" #: ulng.rsopercombiningfromto msgid "Joining files in \"%s\" to \"%s\"" msgstr "" #: ulng.rsopercopying msgid "Copying" msgstr "" #: ulng.rsopercopyingfromto msgid "Copying from \"%s\" to \"%s\"" msgstr "" #: ulng.rsopercopyingsomethingto msgid "Copying \"%s\" to \"%s\"" msgstr "" #: ulng.rsopercreatingdirectory msgid "Creating directory" msgstr "" #: ulng.rsopercreatingsomedirectory msgid "Creating directory \"%s\"" msgstr "" #: ulng.rsoperdeleting msgid "Deleting" msgstr "" #: ulng.rsoperdeletingin msgid "Deleting in \"%s\"" msgstr "" #: ulng.rsoperdeletingsomething msgid "Deleting \"%s\"" msgstr "" #: ulng.rsoperexecuting msgid "Executing" msgstr "" #: ulng.rsoperexecutingsomething msgid "Executing \"%s\"" msgstr "" #: ulng.rsoperextracting msgid "Extracting" msgstr "" #: ulng.rsoperextractingfromto msgid "Extracting from \"%s\" to \"%s\"" msgstr "" #: ulng.rsoperfinished msgid "Finished" msgstr "" #: ulng.rsoperlisting msgid "Listing" msgstr "" #: ulng.rsoperlistingin msgid "Listing \"%s\"" msgstr "" #: ulng.rsopermoving msgid "Moving" msgstr "" #: ulng.rsopermovingfromto msgid "Moving from \"%s\" to \"%s\"" msgstr "" #: ulng.rsopermovingsomethingto msgid "Moving \"%s\" to \"%s\"" msgstr "" #: ulng.rsopernotstarted msgid "Not started" msgstr "" #: ulng.rsoperpacking msgid "Packing" msgstr "" #: ulng.rsoperpackingfromto msgid "Packing from \"%s\" to \"%s\"" msgstr "" #: ulng.rsoperpackingsomethingto msgid "Packing \"%s\" to \"%s\"" msgstr "" #: ulng.rsoperpaused msgid "Paused" msgstr "" #: ulng.rsoperpausing msgid "Pausing" msgstr "" #: ulng.rsoperrunning msgid "Running" msgstr "" #: ulng.rsopersettingproperty msgid "Setting property" msgstr "" #: ulng.rsopersettingpropertyin msgid "Setting property in \"%s\"" msgstr "" #: ulng.rsopersettingpropertyof msgid "Setting property of \"%s\"" msgstr "" #: ulng.rsopersplitting msgid "Splitting" msgstr "" #: ulng.rsopersplittingfromto msgid "Splitting \"%s\" to \"%s\"" msgstr "" #: ulng.rsoperstarting msgid "Starting" msgstr "" #: ulng.rsoperstopped msgid "Stopped" msgstr "" #: ulng.rsoperstopping msgid "Stopping" msgstr "" #: ulng.rsopertesting msgid "Testing" msgstr "" #: ulng.rsopertestingin msgid "Testing in \"%s\"" msgstr "" #: ulng.rsopertestingsomething msgid "Testing \"%s\"" msgstr "" #: ulng.rsoperverifyingchecksum msgid "Verifying checksum" msgstr "" #: ulng.rsoperverifyingchecksumin msgid "Verifying checksum in \"%s\"" msgstr "" #: ulng.rsoperverifyingchecksumof msgid "Verifying checksum of \"%s\"" msgstr "" #: ulng.rsoperwaitingforconnection msgid "Waiting for access to file source" msgstr "" #: ulng.rsoperwaitingforfeedback msgid "Waiting for user response" msgstr "" #: ulng.rsoperwiping msgid "Wiping" msgstr "" #: ulng.rsoperwipingin msgid "Wiping in \"%s\"" msgstr "" #: ulng.rsoperwipingsomething msgid "Wiping \"%s\"" msgstr "" #: ulng.rsoperworking msgid "Working" msgstr "" #: ulng.rsoptaddfrommainpanel msgid "Add at &beginning;Add at the end;Smart add" msgstr "" #: ulng.rsoptarchivedelete msgid "Delete:" msgstr "" #: ulng.rsoptarchiveextractwithoutpath msgid "Extract without path:" msgstr "" #: ulng.rsoptarchiveformmode msgid "Format parsing mode:" msgstr "" #: ulng.rsoptarchiveid msgid "ID:" msgstr "" #: ulng.rsoptarchiveidpos msgid "ID Position:" msgstr "" #: ulng.rsoptarchiveidseekrange msgid "ID Seek Range:" msgstr "" #: ulng.rsoptarchiveparam msgid "Parameter" msgstr "" #: ulng.rsoptarchivepasswordquery msgid "Password query string:" msgstr "" #: ulng.rsoptarchiveselfextract msgid "Create self extracting archive:" msgstr "" #: ulng.rsoptarchivetest msgid "Test:" msgstr "" #: ulng.rsoptarchivetypename msgid "Archive type name:" msgstr "" #: ulng.rsoptarchivevalue msgctxt "ulng.rsoptarchivevalue" msgid "Value" msgstr "" #: ulng.rsoptassocpluginwith msgid "Associate plugin \"%s\" with:" msgstr "" #: ulng.rsoptautosizecolumn msgid "First;Last;" msgstr "" #: ulng.rsoptconfigsortorder msgid "Classic, legacy order;Alphabetic order (but language still first)" msgstr "" #: ulng.rsoptdifferframeposition msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right" msgstr "" #: ulng.rsoptdisable msgid "Disable" msgstr "" #: ulng.rsoptenable msgid "Enable" msgstr "" #: ulng.rsoptenterext msgid "Enter extension" msgstr "" #: ulng.rsoptfavoritetabswheretoaddinlist msgid "Add at beginning;Add at the end;Alphabetical sort" msgstr "" #: ulng.rsoptfileoperationsprogresskind msgid "separate window;minimized separate window;operations panel" msgstr "" #: ulng.rsoptfilesizeformat msgid "float;B;K;M;G" msgstr "" #: ulng.rsopthotkeysadddeleteshortcutlong msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting." msgstr "" #: ulng.rsopthotkeysaddhotkey msgid "Add hotkey for %s" msgstr "" #: ulng.rsopthotkeysaddshortcutbutton msgid "Add shortcut" msgstr "" #: ulng.rsopthotkeyscannotsetshortcut msgid "Cannot set shortcut" msgstr "" #: ulng.rsopthotkeyschangeshortcut msgid "Change shortcut" msgstr "" #: ulng.rsopthotkeyscommand msgctxt "ulng.rsopthotkeyscommand" msgid "Command" msgstr "" #: ulng.rsopthotkeysdeletetrashcanoverrides msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?" msgstr "" #: ulng.rsopthotkeysdeletetrashcanparameterexists msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?" msgstr "" #: ulng.rsopthotkeysdescription msgctxt "ulng.rsopthotkeysdescription" msgid "Description" msgstr "" #: ulng.rsopthotkeysedithotkey msgid "Edit hotkey for %s" msgstr "" #: ulng.rsopthotkeysfixparameter msgid "Fix parameter" msgstr "" #: ulng.rsopthotkeyshotkey msgctxt "ulng.rsopthotkeyshotkey" msgid "Hotkey" msgstr "" #: ulng.rsopthotkeyshotkeys msgctxt "ulng.rsopthotkeyshotkeys" msgid "Hotkeys" msgstr "" #: ulng.rsopthotkeysnohotkey msgid "" msgstr "" #: ulng.rsopthotkeysparameters msgctxt "ulng.rsopthotkeysparameters" msgid "Parameters" msgstr "" #: ulng.rsopthotkeyssetdeleteshortcut msgid "Set shortcut to delete file" msgstr "" #: ulng.rsopthotkeysshortcutfordeletealreadyassigned msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?" msgstr "" #: ulng.rsopthotkeysshortcutfordeleteissequence msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work." msgstr "" #: ulng.rsopthotkeysshortcutused msgid "Shortcut in use" msgstr "" #: ulng.rsopthotkeysshortcutusedtext1 msgid "Shortcut %s is already used." msgstr "" #: ulng.rsopthotkeysshortcutusedtext2 msgid "Change it to %s?" msgstr "" #: ulng.rsopthotkeysusedby msgid "used for %s in %s" msgstr "" #: ulng.rsopthotkeysusedwithdifferentparams msgid "used for this command but with different parameters" msgstr "" #: ulng.rsoptionseditorarchivers msgid "Archivers" msgstr "" #: ulng.rsoptionseditorautorefresh msgid "Auto refresh" msgstr "" #: ulng.rsoptionseditorbehavior msgid "Behaviors" msgstr "" #: ulng.rsoptionseditorbriefview msgid "Brief" msgstr "" #: ulng.rsoptionseditorcolors msgid "Colors" msgstr "" #: ulng.rsoptionseditorcolumnsview msgid "Columns" msgstr "" #: ulng.rsoptionseditorconfiguration msgctxt "ulng.rsoptionseditorconfiguration" msgid "Configuration" msgstr "" #: ulng.rsoptionseditorcustomcolumns msgid "Custom columns" msgstr "" #: ulng.rsoptionseditordirectoryhotlist msgctxt "ulng.rsoptionseditordirectoryhotlist" msgid "Directory Hotlist" msgstr "" #: ulng.rsoptionseditordraganddrop msgid "Drag & drop" msgstr "" #: ulng.rsoptionseditordriveslistbutton msgid "Drives list button" msgstr "" #: ulng.rsoptionseditorfavoritetabs msgid "Favorite Tabs" msgstr "" #: ulng.rsoptionseditorfileassicextra msgid "File associations extra" msgstr "" #: ulng.rsoptionseditorfileassoc msgid "File associations" msgstr "" #: ulng.rsoptionseditorfilenewfiletypes msgctxt "ulng.rsoptionseditorfilenewfiletypes" msgid "New" msgstr "" #: ulng.rsoptionseditorfileoperations msgid "File operations" msgstr "" #: ulng.rsoptionseditorfilepanels msgid "File panels" msgstr "" #: ulng.rsoptionseditorfilesearch msgctxt "ulng.rsoptionseditorfilesearch" msgid "File search" msgstr "" #: ulng.rsoptionseditorfilesviews msgid "Files views" msgstr "" #: ulng.rsoptionseditorfiletypes msgctxt "ulng.rsoptionseditorfiletypes" msgid "File types" msgstr "" #: ulng.rsoptionseditorfoldertabs msgid "Folder tabs" msgstr "" #: ulng.rsoptionseditorfoldertabsextra msgid "Folder tabs extra" msgstr "" #: ulng.rsoptionseditorfonts msgid "Fonts" msgstr "" #: ulng.rsoptionseditorhighlighters msgid "Highlighters" msgstr "" #: ulng.rsoptionseditorhotkeys msgid "Hot keys" msgstr "" #: ulng.rsoptionseditoricons msgid "Icons" msgstr "" #: ulng.rsoptionseditorignorelist msgid "Ignore list" msgstr "" #: ulng.rsoptionseditorkeyboard msgid "Keys" msgstr "" #: ulng.rsoptionseditorlanguage msgid "Language" msgstr "" #: ulng.rsoptionseditorlayout msgid "Layout" msgstr "" #: ulng.rsoptionseditorlog msgid "Log" msgstr "" #: ulng.rsoptionseditormiscellaneous msgid "Miscellaneous" msgstr "" #: ulng.rsoptionseditormouse msgid "Mouse" msgstr "" #: ulng.rsoptionseditoroptionschanged msgid "" "Options have changed in \"%s\"\n" "\n" "Do you want to save modifications?\n" msgstr "" #: ulng.rsoptionseditorplugins msgctxt "ulng.rsoptionseditorplugins" msgid "Plugins" msgstr "" #: ulng.rsoptionseditorquicksearch msgid "Quick search/filter" msgstr "" #: ulng.rsoptionseditorterminal msgctxt "ulng.rsoptionseditorterminal" msgid "Terminal" msgstr "" #: ulng.rsoptionseditortoolbar msgid "Toolbar" msgstr "" #: ulng.rsoptionseditortools msgid "Tools" msgstr "" #: ulng.rsoptionseditortooltips msgid "Tooltips" msgstr "" #: ulng.rsoptionseditortreeviewmenu msgctxt "ulng.rsoptionseditortreeviewmenu" msgid "Tree View Menu" msgstr "" #: ulng.rsoptionseditortreeviewmenucolors msgid "Tree View Menu Colors" msgstr "" #: ulng.rsoptletters msgid "None;Command Line;Quick Search;Quick Filter" msgstr "" #: ulng.rsoptmouseselectionbutton msgid "Left button;Right button;" msgstr "" #: ulng.rsoptnewfilesposition msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list" msgstr "" #: ulng.rsoptpluginalreadyassigned msgid "Plugin %s is already assigned for the following extensions:" msgstr "" #: ulng.rsoptpluginsactive msgctxt "ulng.rsoptpluginsactive" msgid "Active" msgstr "" #: ulng.rsoptpluginsfilename msgctxt "ulng.rsoptpluginsfilename" msgid "File name" msgstr "" #: ulng.rsoptpluginsname msgctxt "ulng.rsoptpluginsname" msgid "Name" msgstr "" #: ulng.rsoptpluginsregisteredfor msgctxt "ulng.rsoptpluginsregisteredfor" msgid "Registered for" msgstr "" #: ulng.rsoptsearchcase msgid "&Sensitive;&Insensitive" msgstr "" #: ulng.rsoptsearchitems msgid "&Files;Di&rectories;Files a&nd Directories" msgstr "" #: ulng.rsoptsearchopt msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session" msgstr "" #: ulng.rsoptsortcasesens msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)" msgstr "" #: ulng.rsoptsortfoldermode msgid "sort by name and show first;sort like files and show first;sort like files" msgstr "" #: ulng.rsoptsortmethod msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers" msgstr "" #: ulng.rsopttabsposition msgid "Top;Bottom;" msgstr "" #: ulng.rsopttoolbarbuttontype msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u" msgstr "" #: ulng.rsopttypeofduplicatedrename msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext" msgstr "" #: ulng.rsoptupdatedfilesposition msgid "don't change position;use the same setting as for new files;to sorted position" msgstr "" #: ulng.rspropscontains msgid "Files: %d, folders: %d" msgstr "" #: ulng.rspropserrchmod msgid "Can not change access rights for \"%s\"" msgstr "" #: ulng.rspropserrchown msgid "Can not change owner for \"%s\"" msgstr "" #: ulng.rspropsfile msgid "File" msgstr "" #: ulng.rspropsfolder msgctxt "ulng.rspropsfolder" msgid "Directory" msgstr "" #: ulng.rspropsnmdpipe msgid "Named pipe" msgstr "" #: ulng.rspropssocket msgid "Socket" msgstr "" #: ulng.rspropsspblkdev msgid "Special block device" msgstr "" #: ulng.rspropsspchrdev msgid "Special character device" msgstr "" #: ulng.rspropssymlink msgid "Symbolic link" msgstr "" #: ulng.rspropsunknowntype msgid "Unknown type" msgstr "" #: ulng.rssearchresult msgid "Search result" msgstr "" #: ulng.rssearchstatus msgid "SEARCH" msgstr "" #: ulng.rssearchtemplateunnamed msgid "" msgstr "" #: ulng.rssearchwithdsxplugininprogress msgid "" "A file search using DSX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" #: ulng.rssearchwithwdxplugininprogress msgid "" "A file search using WDX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" #: ulng.rsselectdir msgid "Select a directory" msgstr "" #: ulng.rsselectyoufindfileswindow msgid "Select your window" msgstr "" #: ulng.rsshowhelpfor msgid "&Show help for %s" msgstr "" #: ulng.rssimplewordall msgctxt "ulng.rssimplewordall" msgid "All" msgstr "" #: ulng.rssimplewordcategory msgctxt "ulng.rssimplewordcategory" msgid "Category" msgstr "" #: ulng.rssimplewordcolumnsingular msgid "Column" msgstr "" #: ulng.rssimplewordcommand msgctxt "ulng.rssimplewordcommand" msgid "Command" msgstr "" #: ulng.rssimplewordfilename msgid "Filename" msgstr "" #: ulng.rssimplewordfiles msgid "files" msgstr "" #: ulng.rssimplewordletter msgid "Letter" msgstr "" #: ulng.rssimplewordparameter msgid "Param" msgstr "" #: ulng.rssimplewordresult msgid "Result" msgstr "" #: ulng.rssimplewordworkdir msgid "WorkDir" msgstr "" #: ulng.rssizeunitbytes msgid "Bytes" msgstr "" #: ulng.rssizeunitgbytes msgid "Gigabytes" msgstr "" #: ulng.rssizeunitkbytes msgid "Kilobytes" msgstr "" #: ulng.rssizeunitmbytes msgid "Megabytes" msgstr "" #: ulng.rssizeunittbytes msgid "Terabytes" msgstr "" #: ulng.rsspacemsg msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)" msgstr "" #: ulng.rsspliterrdirectory msgid "Unable to create target directory!" msgstr "" #: ulng.rsspliterrfilesize msgid "Incorrect file size format!" msgstr "" #: ulng.rsspliterrsplitfile msgid "Unable to split the file!" msgstr "" #: ulng.rssplitmsgmanyparts msgid "The number of parts is more than 100! Continue?" msgstr "" #: ulng.rssplitpredefinedsizes msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R" msgstr "" #: ulng.rssplitseldir msgid "Select directory:" msgstr "" #: ulng.rsstraccents msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ" msgstr "" #: ulng.rsstraccentsstripped msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE" msgstr "" #: ulng.rsstrpreviewjustpreview msgid "Just preview" msgstr "" #: ulng.rsstrpreviewothers msgid "Others" msgstr "" #: ulng.rsstrpreviewsearchingletters msgid "OU" msgstr "" #: ulng.rsstrpreviewsidenote msgid "Side note" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched1 msgid "Flat" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched2 msgid "Limited" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched3 msgid "Simple" msgstr "" #: ulng.rsstrpreviewwordwithsearched1 msgid "Fabulous" msgstr "" #: ulng.rsstrpreviewwordwithsearched2 msgid "Marvelous" msgstr "" #: ulng.rsstrpreviewwordwithsearched3 msgid "Tremendous" msgstr "" #: ulng.rsstrtvmchoosedirhistory msgid "Choose your directory from Dir History" msgstr "" #: ulng.rsstrtvmchoosefavoritetabs msgid "Choose you Favorite Tabs:" msgstr "" #: ulng.rsstrtvmchoosefromcmdlinehistory msgid "Choose your command from Command Line History" msgstr "" #: ulng.rsstrtvmchoosefrommainmenu msgid "Choose your action from Main Menu" msgstr "" #: ulng.rsstrtvmchoosefromtoolbar msgid "Choose your action from Maintool bar" msgstr "" #: ulng.rsstrtvmchoosehotdirectory msgid "Choose your directory from Hot Directory:" msgstr "" #: ulng.rsstrtvmchooseviewhistory msgid "Choose your directory from File View History" msgstr "" #: ulng.rsstrtvmchooseyourfileordir msgid "Choose your file or your directory" msgstr "" #: ulng.rssymerrcreate msgid "Error creating symlink." msgstr "" #: ulng.rssyndefaulttext msgid "Default text" msgstr "" #: ulng.rssynlangplaintext msgid "Plain text" msgstr "" #: ulng.rstabsactionondoubleclickchoices msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu" msgstr "" #: ulng.rstimeunitday msgid "Day(s)" msgstr "" #: ulng.rstimeunithour msgid "Hour(s)" msgstr "" #: ulng.rstimeunitminute msgid "Minute(s)" msgstr "" #: ulng.rstimeunitmonth msgid "Month(s)" msgstr "" #: ulng.rstimeunitsecond msgid "Second(s)" msgstr "" #: ulng.rstimeunitweek msgid "Week(s)" msgstr "" #: ulng.rstimeunityear msgid "Year(s)" msgstr "" #: ulng.rstitlerenamefavtabs msgid "Rename Favorite Tabs" msgstr "" #: ulng.rstitlerenamefavtabsmenu msgid "Rename Favorite Tabs sub-menu" msgstr "" #: ulng.rstooldiffer msgctxt "ulng.rstooldiffer" msgid "Differ" msgstr "" #: ulng.rstooleditor msgctxt "ulng.rstooleditor" msgid "Editor" msgstr "" #: ulng.rstoolerroropeningdiffer msgid "Error opening differ" msgstr "" #: ulng.rstoolerroropeningeditor msgid "Error opening editor" msgstr "" #: ulng.rstoolerroropeningterminal msgid "Error opening terminal" msgstr "" #: ulng.rstoolerroropeningviewer msgid "Error opening viewer" msgstr "" #: ulng.rstoolterminal msgctxt "ulng.rstoolterminal" msgid "Terminal" msgstr "" #: ulng.rstoolviewer msgctxt "ulng.rstoolviewer" msgid "Viewer" msgstr "" #: ulng.rsunhandledexceptionmessage msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program." msgstr "" #: ulng.rsvarbothpanelactivetoinactive msgid "Both panels, from active to inactive" msgstr "" #: ulng.rsvarbothpanellefttoright msgid "Both panels, from left to right" msgstr "" #: ulng.rsvarcurrentpath msgid "Path of panel" msgstr "" #: ulng.rsvarencloseelement msgid "Enclose each name in brackets or what you want" msgstr "" #: ulng.rsvarfilenamenoext msgid "Just filename, no extension" msgstr "" #: ulng.rsvarfullpath msgid "Complete filename (path+filename)" msgstr "" #: ulng.rsvarhelpwith msgid "Help with \"%\" variables" msgstr "" #: ulng.rsvarinputparam msgid "Will request request user to enter a parameter with a default suggested value" msgstr "" #: ulng.rsvarleftpanel msgid "Left panel" msgstr "" #: ulng.rsvarlistfilename msgid "Temporary filename of list of filenames" msgstr "" #: ulng.rsvarlistfullfilename msgid "Temporary filename of list of complete filenames (path+filename)" msgstr "" #: ulng.rsvarlistinutf16 msgid "Filenames in list in UTF-16 with BOM" msgstr "" #: ulng.rsvarlistinutf16quoted msgid "Filenames in list in UTF-16 with BOM, inside double quotes" msgstr "" #: ulng.rsvarlistinutf8 msgid "Filenames in list in UTF-8" msgstr "" #: ulng.rsvarlistinutf8quoted msgid "Filenames in list in UTF-8, inside double quotes" msgstr "" #: ulng.rsvarlistrelativefilename msgid "Temporary filename of list of filenames with relative path" msgstr "" #: ulng.rsvaronlyextension msgid "Only file extension" msgstr "" #: ulng.rsvaronlyfilename msgid "Only filename" msgstr "" #: ulng.rsvarotherexamples msgid "Other example of what's possible" msgstr "" #: ulng.rsvarpath msgid "Path, without ending delimiter" msgstr "" #: ulng.rsvarpercentchangetopound msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign" msgstr "" #: ulng.rsvarpercentsign msgid "Return the percent sign" msgstr "" #: ulng.rsvarpoundchangetopercent msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign" msgstr "" #: ulng.rsvarprependelement msgid "Prepend each name with \"-a \" or what you want" msgstr "" #: ulng.rsvarpromptuserforparam msgid "%[Prompt user for param;Default value proposed]" msgstr "" #: ulng.rsvarrelativepathandfilename msgid "Filename with relative path" msgstr "" #: ulng.rsvarrightpanel msgid "Right panel" msgstr "" #: ulng.rsvarsecondelementrightpanel msgid "Full path of second selected file in right panel" msgstr "" #: ulng.rsvarshowcommandprior msgid "Show command prior execute" msgstr "" #: ulng.rsvarsimplemessage msgid "%[Simple message]" msgstr "" #: ulng.rsvarsimpleshowmessage msgid "Will show a simple message" msgstr "" #: ulng.rsvarsourcepanel msgid "Active panel (source)" msgstr "" #: ulng.rsvartargetpanel msgid "Inactive panel (target)" msgstr "" #: ulng.rsvarwillbequoted msgid "Filenames will be quoted from here (default)" msgstr "" #: ulng.rsvarwilldointerminal msgid "Command will be done in terminal, remaining opened at the end" msgstr "" #: ulng.rsvarwillhaveendingdelimiter msgid "Paths will have ending delimiter" msgstr "" #: ulng.rsvarwillnotbequoted msgid "Filenames will not be quoted from here" msgstr "" #: ulng.rsvarwillnotdointerminal msgid "Command will be done in terminal, closed at the end" msgstr "" #: ulng.rsvarwillnothaveendingdelimiter msgid "Paths will not have ending delimiter (default)" msgstr "" #: ulng.rsvfsnetwork msgctxt "ulng.rsvfsnetwork" msgid "Network" msgstr "" #: ulng.rsviewabouttext msgid "Internal Viewer of Double Commander." msgstr "" #: ulng.rsviewbadquality msgid "Bad Quality" msgstr "" #: ulng.rsviewencoding msgctxt "ulng.rsviewencoding" msgid "Encoding" msgstr "" #: ulng.rsviewimagetype msgid "Image Type" msgstr "" #: ulng.rsviewnewsize msgctxt "ulng.rsviewnewsize" msgid "New Size" msgstr "" #: ulng.rsviewnotfound msgid "%s not found!" msgstr "" #: ulng.rsviewwithexternalviewer msgid "with external viewer" msgstr "" #: ulng.rsviewwithinternalviewer msgid "with internal viewer" msgstr "" #: ulng.rsxreplacements msgid "Number of replacement: %d" msgstr "" #: ulng.rszeroreplacement msgid "No replacement took place." msgstr ""