msgid "" msgstr "" "Project-Id-Version: Double Commander 0.8.0 alpha\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: 2008-01-17 23:08+0300\n" "PO-Revision-Date: 2017-12-05 19:49+0100\n" "Last-Translator: Anastasios Kazakis \n" "Language-Team: Anastasios Kazakis \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Native-Language: ελληνικά\n" "X-Generator: Poedit 1.8.7.1\n" "Language: el\n" "Plural-Forms: nplurals=2; plural=(n != 1);\n" "X-Language: el_GR\n" "X-Source-Language: el\n" #: fsyncdirsdlg.rscomparingpercent msgid "Comparing... %d%% (ESC to cancel)" msgstr "Σύγκριση... %d%% (ESC για ακύρωση)" #: fsyncdirsdlg.rsdeleteright msgid "Right: Delete %d file(s)" msgstr "Δεξιά: Διαγραφή %d αρχείο(α)" #: fsyncdirsdlg.rsfilesfound #, fuzzy,badformat msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)" msgstr "Ευρεθέντα αρχεία: %d (Όμοια: %d, : %d, Διαφορετικά: %d, Μοναδικά αριστερά: %d, Μοναδικά δεξιά: %d)" #: fsyncdirsdlg.rslefttorightcopy msgid "Left to Right: Copy %d files, total size: %d bytes" msgstr "Αριστερά προς Δεξιά: Αντιγραφή %d αρχεία, συνολικό μέγεθος: %d bytes" #: fsyncdirsdlg.rsrighttoleftcopy msgid "Right to Left: Copy %d files, total size: %d bytes" msgstr "Δεξιά προς Αριστερά: Αντιγραφή %d αρχεία, συνολικό μέγεθος: %d bytes" #: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint msgid "Choose template..." msgstr "Επιλογή προτύπου..." #: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption msgid "C&heck free space" msgstr "Έλεγχος ελεύθερου χώρου" #: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption msgid "Cop&y attributes" msgstr "Αποθήκευση ιδιοτήτων" #: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption msgid "Copy o&wnership" msgstr "Αντιγραφή ιδιοκτησίας" #: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption msgid "Copy &permissions" msgstr "Αντιγραφή αδειών" #: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "Αντιγραφή ημερομηνίας/ώρας" #: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption msgid "Correct lin&ks" msgstr "Διόρθωση δεσμών" #: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION" msgid "Drop readonly fla&g" msgstr "Κατέβασμα σημαίας μόνο για ανάγνωση" #: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption msgid "E&xclude empty directories" msgstr "Αποκλεισμός άδειων καταλόγων" #: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption msgid "Fo&llow links" msgstr "Ακολουθείστε τους δεσμούς" #: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption msgid "&Reserve space" msgstr "Κράτηση Χώρου" #: tfilesystemcopymoveoperationoptionsui.chkverify.caption msgid "&Verify" msgstr "Επαλήθευση" #: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint msgid "What to do when cannot set file time, attributes, etc." msgstr "Τι να κάνετε όταν δεν μπορείτε να ορίσετε στα αρχεία χρόνο, ιδιότητες, κ.α" #: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption msgid "Use file template" msgstr "Χρησιμοποιείστε πρότυπο αρχείου" #: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption msgid "When dir&ectory exists" msgstr "Όταν ο κατάλογος υπάρχει" #: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When &file exists" msgstr "Όταν το &αρχείο υπάρχει" #: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption msgid "When ca&nnot set property" msgstr "Όταν υπάρχει αδυναμία καθορισμού ιδιότητας" #: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption msgid "" msgstr "<Χωρίς πρότυπο>" #: tfrmabout.btnclose.caption msgctxt "TFRMABOUT.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Κλείσιμο" #: tfrmabout.btncopytoclipboard.caption msgid "Copy to clipboard" msgstr "Αντιγραφή στο πρόχειρο" #: tfrmabout.caption msgctxt "TFRMABOUT.CAPTION" msgid "About" msgstr "Σχετικά" #: tfrmabout.lblbuild.caption msgctxt "tfrmabout.lblbuild.caption" msgid "Build" msgstr "Εσωτερική έκδοση" #: tfrmabout.lblfreepascalver.caption msgctxt "tfrmabout.lblfreepascalver.caption" msgid "Free Pascal" msgstr "Free Pascal" #: tfrmabout.lblhomepage.caption msgid "Home Page:" msgstr "Ιστοσελίδα προγράμματος" #: tfrmabout.lblhomepageaddress.caption msgid "http://doublecmd.sourceforge.net" msgstr "http://doublecmd.sourceforge.net" #: tfrmabout.lbllazarusver.caption msgctxt "tfrmabout.lbllazarusver.caption" msgid "Lazarus" msgstr "Lazarus" #: tfrmabout.lblrevision.caption msgctxt "TFRMABOUT.LBLREVISION.CAPTION" msgid "Revision" msgstr "Αναθεωρημένη έκδοση" #: tfrmabout.lbltitle.caption msgctxt "TFRMABOUT.LBLTITLE.CAPTION" msgid "Double Commander" msgstr "Double Commander" #: tfrmabout.lblversion.caption msgctxt "tfrmabout.lblversion.caption" msgid "Version" msgstr "Έκδοση" #: tfrmattributesedit.btncancel.caption msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmattributesedit.btnok.caption msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION" msgid "&OK" msgstr "&OK" #: tfrmattributesedit.btnreset.caption msgid "&Reset" msgstr "Επαναφορά" #: tfrmattributesedit.caption msgid "Choose attributes" msgstr "Επιλογή ιδιοτήτων" #: tfrmattributesedit.cbarchive.caption msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION" msgid "&Archive" msgstr "Αρχειοθήκη" #: tfrmattributesedit.cbcompressed.caption msgid "Co&mpressed" msgstr "Συμπιεσμένο" #: tfrmattributesedit.cbdirectory.caption msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION" msgid "&Directory" msgstr "Κατάλογος" #: tfrmattributesedit.cbencrypted.caption msgid "&Encrypted" msgstr "Κρυπτογραφημένο" #: tfrmattributesedit.cbhidden.caption msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION" msgid "&Hidden" msgstr "Κρυφό" #: tfrmattributesedit.cbreadonly.caption msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION" msgid "Read o&nly" msgstr "Μόνο για Ανάγνωση" #: tfrmattributesedit.cbsgid.caption msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmattributesedit.cbsparse.caption msgid "S&parse" msgstr "Αραίωση" #: tfrmattributesedit.cbsticky.caption msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Κολημμένα" #: tfrmattributesedit.cbsuid.caption msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmattributesedit.cbsymlink.caption msgid "&Symlink" msgstr "Συμβολοδεσμός" #: tfrmattributesedit.cbsystem.caption msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION" msgid "S&ystem" msgstr "Σύστημα" #: tfrmattributesedit.cbtemporary.caption msgid "&Temporary" msgstr "Προσωρινά Αρχεία" #: tfrmattributesedit.gbntfsattributes.caption msgid "NTFS attributes" msgstr "NTFS ιδιότητες" #: tfrmattributesedit.gbwingeneral.caption msgid "General attributes" msgstr "Γενικές ιδιότητες" #: tfrmattributesedit.lblattrbitsstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bits:" #: tfrmattributesedit.lblattrgroupstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Γκρουπ" #: tfrmattributesedit.lblattrotherstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Άλλοι" #: tfrmattributesedit.lblattrownerstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Ιδιοκτήτης" #: tfrmattributesedit.lblexec.caption msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION" msgid "Execute" msgstr "Εκτέλεση" #: tfrmattributesedit.lblread.caption msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION" msgid "Read" msgstr "Ανάγνωση" #: tfrmattributesedit.lbltextattrs.caption msgid "As te&xt:" msgstr "Ως Κείμενο:" #: tfrmattributesedit.lblwrite.caption msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION" msgid "Write" msgstr "Εγγραφή" #: tfrmbenchmark.caption msgid "Benchmark" msgstr "" #: tfrmbenchmark.lblbenchmarksize.caption msgid "Benchmark data size: %d MB" msgstr "" #: tfrmbenchmark.stgresult.columns[0].title.caption msgid "Hash" msgstr "" #: tfrmbenchmark.stgresult.columns[1].title.caption msgid "Time (ms)" msgstr "" #: tfrmbenchmark.stgresult.columns[2].title.caption msgid "Speed (MB/s)" msgstr "" #: tfrmchecksumcalc.caption msgctxt "TFRMCHECKSUMCALC.CAPTION" msgid "Calculate checksum..." msgstr "Υπολογισμός αθροίσματος ελέγχου..." #: tfrmchecksumcalc.cbopenafterjobiscomplete.caption msgid "Open checksum file after job is completed" msgstr "Άνοιγμα αρχείου αθροίσματος ελέγχου μετά την ολοκλήρωση της εργασίας" #: tfrmchecksumcalc.cbseparatefile.caption msgid "C&reate separate checksum file for each file" msgstr "Δημιουργία ξεχωριστού αρχείου αθροίσματος ελέγχου για κάθε αρχείο" #: tfrmchecksumcalc.lblsaveto.caption msgid "&Save checksum file(s) to:" msgstr "Αποθήκευση αρχείου(ων) αθροίσματος ελέγχου στο:" #: tfrmchecksumverify.btnclose.caption msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Κλείσιμο" #: tfrmchecksumverify.caption msgctxt "TFRMCHECKSUMVERIFY.CAPTION" msgid "Verify checksum..." msgstr "Επιβεβαίωση αθροίσματος ελέγχου..." #: tfrmconnectionmanager.btnadd.caption msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION" msgid "A&dd" msgstr "Προσθήκη" #: tfrmconnectionmanager.btncancel.caption msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmconnectionmanager.btnconnect.caption msgid "C&onnect" msgstr "Σύνδεση" #: tfrmconnectionmanager.btndelete.caption msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION" msgid "&Delete" msgstr "Διαγραφή" #: tfrmconnectionmanager.btnedit.caption msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION" msgid "&Edit" msgstr "Επεξεργασία" #: tfrmconnectionmanager.caption msgid "Connection manager" msgstr "Διαχειριστής συνδέσεων" #: tfrmconnectionmanager.gbconnectto.caption msgid "Connect to:" msgstr "Σύνδεση σε:" #: tfrmcopydlg.btnaddtoqueue.caption msgid "A&dd To Queue" msgstr "Προσθήκη στην Ουρά" #: tfrmcopydlg.btncancel.caption msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmcopydlg.btnoptions.caption msgid "O&ptions" msgstr "Επιλογές" #: tfrmcopydlg.btnsaveoptions.caption msgid "Sa&ve these options as default" msgstr "αποθήκευση αυτών των ιδιοτήτων ως προκαθορισμένες" #: tfrmcopydlg.caption msgctxt "TFRMCOPYDLG.CAPTION" msgid "Copy file(s)" msgstr "Αντιγραφή αρχείου(ων)" #: tfrmcopydlg.mnunewqueue.caption msgctxt "tfrmcopydlg.mnunewqueue.caption" msgid "New queue" msgstr "Νέα ουρά" #: tfrmcopydlg.mnuqueue1.caption msgctxt "tfrmcopydlg.mnuqueue1.caption" msgid "Queue 1" msgstr "Ουρά 1" #: tfrmcopydlg.mnuqueue2.caption msgctxt "tfrmcopydlg.mnuqueue2.caption" msgid "Queue 2" msgstr "Ουρά 2" #: tfrmcopydlg.mnuqueue3.caption msgctxt "tfrmcopydlg.mnuqueue3.caption" msgid "Queue 3" msgstr "Ουρά 3" #: tfrmcopydlg.mnuqueue4.caption msgctxt "tfrmcopydlg.mnuqueue4.caption" msgid "Queue 4" msgstr "Ουρά 4" #: tfrmcopydlg.mnuqueue5.caption msgctxt "tfrmcopydlg.mnuqueue5.caption" msgid "Queue 5" msgstr "Ουρά 5" #: tfrmdescredit.actsavedescription.caption msgid "Save Description" msgstr "Αποθήκευση Περιγραφής" #: tfrmdescredit.btncancel.caption msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmdescredit.btnok.caption msgctxt "TFRMDESCREDIT.BTNOK.CAPTION" msgid "&OK" msgstr "OK" #: tfrmdescredit.caption msgid "File/folder comment" msgstr "Σχόλιο αρχείου/φακέλου" #: tfrmdescredit.lbleditcommentfor.caption msgid "E&dit comment for:" msgstr "Επεξεργασία σχολίου για:" #: tfrmdescredit.lblencoding.caption msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION" msgid "&Encoding:" msgstr "Κωδικοποίηση:" #: tfrmdescredit.lblfilename.caption msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION" msgid "???" msgstr ";;;" #: tfrmdiffer.actabout.caption msgctxt "TFRMDIFFER.ACTABOUT.CAPTION" msgid "About" msgstr "Σχετικά" #: tfrmdiffer.actautocompare.caption msgid "Auto Compare" msgstr "Αυτόματη Σύγκριση" #: tfrmdiffer.actbinarycompare.caption msgid "Binary Mode" msgstr "Δυαδική Μορφή" #: tfrmdiffer.actcancelcompare.caption msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION" msgid "Cancel" msgstr "Ακύρωση" #: tfrmdiffer.actcancelcompare.hint msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT" msgid "Cancel" msgstr "Ακύρωση" #: tfrmdiffer.actcopylefttoright.caption msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION" msgid "Copy Block Right" msgstr "Αντιγραφή Block Δεξιά" #: tfrmdiffer.actcopylefttoright.hint msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT" msgid "Copy Block Right" msgstr "Αντιγραφή Block Δεξιά" #: tfrmdiffer.actcopyrighttoleft.caption msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION" msgid "Copy Block Left" msgstr "Αντιγραφή Block Αριστερά" #: tfrmdiffer.actcopyrighttoleft.hint msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT" msgid "Copy Block Left" msgstr "Αντιγραφή Block Αριστερά" #: tfrmdiffer.acteditcopy.caption msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "Αντιγραφή" #: tfrmdiffer.acteditcut.caption msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "Αποκοπή" #: tfrmdiffer.acteditdelete.caption msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "Διαγραφή" #: tfrmdiffer.acteditpaste.caption msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "Επικόλληση" #: tfrmdiffer.acteditredo.caption msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "Επανάληψη" #: tfrmdiffer.acteditselectall.caption msgid "Select &All" msgstr "Επιλογή όλων" #: tfrmdiffer.acteditundo.caption msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "Αναίρεση" #: tfrmdiffer.actexit.caption msgctxt "TFRMDIFFER.ACTEXIT.CAPTION" msgid "E&xit" msgstr "Έξοδος" #: tfrmdiffer.actfirstdifference.caption msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION" msgid "First Difference" msgstr "Πρώτη Διαφορά" #: tfrmdiffer.actfirstdifference.hint msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT" msgid "First Difference" msgstr "Πρώτη Διαφορά" #: tfrmdiffer.actignorecase.caption msgid "Ignore Case" msgstr "Αγνόηση Κεφαλαίων" #: tfrmdiffer.actignorewhitespace.caption msgid "Ignore Blanks" msgstr "Αγνόηση Κενών" #: tfrmdiffer.actkeepscrolling.caption msgid "Keep Scrolling" msgstr "Συνέχιση Κύλισης" #: tfrmdiffer.actlastdifference.caption msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION" msgid "Last Difference" msgstr "Τελευταία Διαφορά" #: tfrmdiffer.actlastdifference.hint msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT" msgid "Last Difference" msgstr "Τελευταία Διαφορά" #: tfrmdiffer.actlinedifferences.caption msgid "Line Differences" msgstr "Διαφορές Γραμμής" #: tfrmdiffer.actnextdifference.caption msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION" msgid "Next Difference" msgstr "Επόμενη Διαφορά" #: tfrmdiffer.actnextdifference.hint msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT" msgid "Next Difference" msgstr "Επόμενη Διαφορά" #: tfrmdiffer.actopenleft.caption msgid "Open Left..." msgstr "Άνοιγμα Αριστερά..." #: tfrmdiffer.actopenright.caption msgid "Open Right..." msgstr "Άνοιγμα Δεξιά..." #: tfrmdiffer.actpaintbackground.caption msgid "Paint Background" msgstr "Σχεδιασμός Παρασκηνίου" #: tfrmdiffer.actprevdifference.caption msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION" msgid "Previous Difference" msgstr "Προηγούμενη Διαφορά" #: tfrmdiffer.actprevdifference.hint msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT" msgid "Previous Difference" msgstr "Προηγούμενη Διαφορά" #: tfrmdiffer.actreload.caption msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION" msgid "&Reload" msgstr "Επαναφόρτωση" #: tfrmdiffer.actreload.hint msgctxt "TFRMDIFFER.ACTRELOAD.HINT" msgid "Reload" msgstr "Επαναφόρτωση" #: tfrmdiffer.actsave.caption msgctxt "TFRMDIFFER.ACTSAVE.CAPTION" msgid "Save" msgstr "Αποθήκευση" #: tfrmdiffer.actsave.hint msgctxt "TFRMDIFFER.ACTSAVE.HINT" msgid "Save" msgstr "Αποθήκευση" #: tfrmdiffer.actsaveas.caption msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION" msgid "Save as..." msgstr "Αποθήκευση ως..." #: tfrmdiffer.actsaveas.hint msgctxt "TFRMDIFFER.ACTSAVEAS.HINT" msgid "Save as..." msgstr "Αποθήκευση ως..." #: tfrmdiffer.actsaveleft.caption msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION" msgid "Save Left" msgstr "Αποθήκευση Αριστερά" #: tfrmdiffer.actsaveleft.hint msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT" msgid "Save Left" msgstr "Αποθήκευση Αριστερά" #: tfrmdiffer.actsaveleftas.caption msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION" msgid "Save Left As..." msgstr "Αποθήκευση Αριστερά Ως..." #: tfrmdiffer.actsaveleftas.hint msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT" msgid "Save Left As..." msgstr "Αποθήκευση Αριστερά Ως..." #: tfrmdiffer.actsaveright.caption msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION" msgid "Save Right" msgstr "Αποθήκευση Δεξιά" #: tfrmdiffer.actsaveright.hint msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT" msgid "Save Right" msgstr "Αποθήκευση Δεξιά" #: tfrmdiffer.actsaverightas.caption msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION" msgid "Save Right As..." msgstr "Αποθήκευση Δεξιά Ως..." #: tfrmdiffer.actsaverightas.hint msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT" msgid "Save Right As..." msgstr "Αποθήκευση Δεξιά Ως..." #: tfrmdiffer.actstartcompare.caption msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION" msgid "Compare" msgstr "Σύγκριση" #: tfrmdiffer.actstartcompare.hint msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT" msgid "Compare" msgstr "Σύγκριση" #: tfrmdiffer.btnleftencoding.hint msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT" msgid "Encoding" msgstr "Κωδικοποίηση" #: tfrmdiffer.btnrightencoding.hint msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT" msgid "Encoding" msgstr "Κωδικοποίηση" #: tfrmdiffer.caption msgctxt "TFRMDIFFER.CAPTION" msgid "Compare files" msgstr "Σύγκριση αρχείων" #: tfrmdiffer.midivider1.caption msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider10.caption msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider2.caption msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider3.caption msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider4.caption msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider5.caption msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider6.caption msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider7.caption msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider8.caption msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider9.caption msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.miencodingleft.caption msgid "&Left" msgstr "Αριστερά" #: tfrmdiffer.miencodingright.caption msgid "&Right" msgstr "Δεξιά" #: tfrmdiffer.miseparator1.caption msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.miseparator2.caption msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.mnuactions.caption msgid "&Actions" msgstr "Ενέργειες" #: tfrmdiffer.mnuedit.caption msgctxt "TFRMDIFFER.MNUEDIT.CAPTION" msgid "&Edit" msgstr "Επεξεργασία" #: tfrmdiffer.mnuencoding.caption msgctxt "TFRMDIFFER.MNUENCODING.CAPTION" msgid "En&coding" msgstr "Κωδικοποίηση" #: tfrmdiffer.mnufile.caption msgctxt "TFRMDIFFER.MNUFILE.CAPTION" msgid "&File" msgstr "Αρχείο" #: tfrmdiffer.mnuoptions.caption msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION" msgid "&Options" msgstr "Επιλογές" #: tfrmedithotkey.btnaddshortcut.hint msgid "Add new shortcut to sequence" msgstr "Προσθήκη νέας συντόμευσης στην ακολουθία" #: tfrmedithotkey.btncancel.caption msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmedithotkey.btnok.caption msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION" msgid "&OK" msgstr "OK" #: tfrmedithotkey.btnremoveshortcut.hint msgid "Remove last shortcut from sequence" msgstr "Αφαίρεση τελευταίας μικρογραφίας από την ακολουθία" #: tfrmedithotkey.btnselectfromlist.hint msgid "Select shortcut from list of remaining free available keys" msgstr "Επιλογή συντόμευσης από τη λίστα των υπόλοιπων ελεύθερων διαθέσιμων κουμπιών" #: tfrmedithotkey.cghkcontrols.caption msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION" msgid "Only for these controls" msgstr "Μόνο για αυτά τα στοιχεία ελέγχου" #: tfrmedithotkey.lblparameters.caption msgid "&Parameters (each in a separate line):" msgstr "Παράμετροι (κάθε μια σε ξεχωριστή γραμμή):" #: tfrmedithotkey.lblshortcuts.caption msgid "Shortcuts:" msgstr "Συντομεύσεις:" #: tfrmeditor.actabout.caption msgctxt "TFRMEDITOR.ACTABOUT.CAPTION" msgid "About" msgstr "Σχετικά" #: tfrmeditor.actabout.hint msgctxt "TFRMEDITOR.ACTABOUT.HINT" msgid "About" msgstr "Σχετικά" #: tfrmeditor.actconfhigh.caption msgid "&Configuration" msgstr "Διαμόρφωση" #: tfrmeditor.actconfhigh.hint msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT" msgid "Configuration" msgstr "Διαμόρφωση" #: tfrmeditor.acteditcopy.caption msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "Αντιγραφή" #: tfrmeditor.acteditcopy.hint msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT" msgid "Copy" msgstr "Αντιγραφή" #: tfrmeditor.acteditcut.caption msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "Αποκοπή" #: tfrmeditor.acteditcut.hint msgctxt "TFRMEDITOR.ACTEDITCUT.HINT" msgid "Cut" msgstr "Αποκοπή" #: tfrmeditor.acteditdelete.caption msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "Διαγραφή" #: tfrmeditor.acteditdelete.hint msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT" msgid "Delete" msgstr "Διαγραφή" #: tfrmeditor.acteditfind.caption msgctxt "tfrmeditor.acteditfind.caption" msgid "&Find" msgstr "Εύρεση" #: tfrmeditor.acteditfind.hint msgctxt "TFRMEDITOR.ACTEDITFIND.HINT" msgid "Find" msgstr "Εύρεση" #: tfrmeditor.acteditfindnext.caption msgctxt "tfrmeditor.acteditfindnext.caption" msgid "Find next" msgstr "Εύρεση επόμενου" #: tfrmeditor.acteditfindnext.hint msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT" msgid "Find next" msgstr "Εύρεση επόμενου" #: tfrmeditor.acteditfindprevious.caption msgctxt "tfrmeditor.acteditfindprevious.caption" msgid "Find previous" msgstr "Εύρεση Προηγούμενου" #: tfrmeditor.acteditgotoline.caption msgctxt "tfrmeditor.acteditgotoline.caption" msgid "Goto Line..." msgstr "Μετάβαση στη Γραμμή..." #: tfrmeditor.acteditlineendcr.caption msgctxt "tfrmeditor.acteditlineendcr.caption" msgid "Mac (CR)" msgstr "Mac (CR)" #: tfrmeditor.acteditlineendcr.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT" msgid "Mac (CR)" msgstr "Mac (CR)" #: tfrmeditor.acteditlineendcrlf.caption msgctxt "tfrmeditor.acteditlineendcrlf.caption" msgid "Windows (CRLF)" msgstr "Windows (CRLF)" #: tfrmeditor.acteditlineendcrlf.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT" msgid "Windows (CRLF)" msgstr "Windows (CRLF)" #: tfrmeditor.acteditlineendlf.caption msgctxt "tfrmeditor.acteditlineendlf.caption" msgid "Unix (LF)" msgstr "Unix (LF)" #: tfrmeditor.acteditlineendlf.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT" msgid "Unix (LF)" msgstr "Unix (LF)" #: tfrmeditor.acteditpaste.caption msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "Επικόλληση" #: tfrmeditor.acteditpaste.hint msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT" msgid "Paste" msgstr "Επικόλληση" #: tfrmeditor.acteditredo.caption msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "Επανάληψη" #: tfrmeditor.acteditredo.hint msgctxt "TFRMEDITOR.ACTEDITREDO.HINT" msgid "Redo" msgstr "Επανάληψη" #: tfrmeditor.acteditrplc.caption msgid "&Replace" msgstr "Αντικατάσταση" #: tfrmeditor.acteditrplc.hint msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT" msgid "Replace" msgstr "Αντικατάσταση" #: tfrmeditor.acteditselectall.caption msgid "Select&All" msgstr "Επιλογή Όλων" #: tfrmeditor.acteditselectall.hint msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT" msgid "Select All" msgstr "Επιλογή Όλων" #: tfrmeditor.acteditundo.caption msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "Αναίρεση" #: tfrmeditor.acteditundo.hint msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT" msgid "Undo" msgstr "Αναίρεση" #: tfrmeditor.actfileclose.caption msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION" msgid "&Close" msgstr "Κλείσιμο" #: tfrmeditor.actfileclose.hint msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT" msgid "Close" msgstr "Κλείσιμο" #: tfrmeditor.actfileexit.caption msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION" msgid "E&xit" msgstr "Έξοδος" #: tfrmeditor.actfileexit.hint msgctxt "tfrmeditor.actfileexit.hint" msgid "Exit" msgstr "Έξοδος" #: tfrmeditor.actfilenew.caption msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION" msgid "&New" msgstr "Νέο" #: tfrmeditor.actfilenew.hint msgctxt "TFRMEDITOR.ACTFILENEW.HINT" msgid "New" msgstr "Νέο" #: tfrmeditor.actfileopen.caption msgid "&Open" msgstr "Άνοιγμα" #: tfrmeditor.actfileopen.hint msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT" msgid "Open" msgstr "Άνοιγμα" #: tfrmeditor.actfilereload.caption #, fuzzy msgctxt "tfrmeditor.actfilereload.caption" msgid "Reload" msgstr "Επαναφόρτωση" #: tfrmeditor.actfilesave.caption msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION" msgid "&Save" msgstr "Αποθήκευση" #: tfrmeditor.actfilesave.hint msgctxt "TFRMEDITOR.ACTFILESAVE.HINT" msgid "Save" msgstr "Αποθήκευση" #: tfrmeditor.actfilesaveas.caption msgid "Save &As..." msgstr "Αποθήκευση Ως..." #: tfrmeditor.actfilesaveas.hint msgid "Save As" msgstr "Αποθήκευση Ως" #: tfrmeditor.actsaveall.caption msgid "Sa&ve All" msgstr "Αποθήκευση Όλων" #: tfrmeditor.actsaveall.hint msgid "Save All" msgstr "Αποθήκευση Όλων" #: tfrmeditor.caption msgctxt "TFRMEDITOR.CAPTION" msgid "Editor" msgstr "Επεξεργαστής" #: tfrmeditor.help1.caption msgctxt "TFRMEDITOR.HELP1.CAPTION" msgid "&Help" msgstr "Βοήθεια" #: tfrmeditor.miedit.caption msgctxt "TFRMEDITOR.MIEDIT.CAPTION" msgid "&Edit" msgstr "Επεξεργασία" #: tfrmeditor.miencoding.caption msgctxt "TFRMEDITOR.MIENCODING.CAPTION" msgid "En&coding" msgstr "Κωδικοποίηση" #: tfrmeditor.miencodingin.caption msgid "Open as" msgstr "Άνοιγμα ως" #: tfrmeditor.miencodingout.caption msgctxt "tfrmeditor.miencodingout.caption" msgid "Save as" msgstr "Αποθήκευση ως" #: tfrmeditor.mifile.caption msgctxt "TFRMEDITOR.MIFILE.CAPTION" msgid "&File" msgstr "Αρχείο" #: tfrmeditor.mihighlight.caption msgid "Syntax highlight" msgstr "Υπογράμμιση Σύνταξης" #: tfrmeditor.milineendtype.caption msgid "End Of Line" msgstr "Τέλος Γραμμής" #: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmeditsearchreplace.buttonpanel.okbutton.caption msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption" msgid "&OK" msgstr "OK" #: tfrmeditsearchreplace.cbsearchcasesensitive.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION" msgid "C&ase sensitivity" msgstr "Διάκριση Πεζών-Κεφαλαίων" #: tfrmeditsearchreplace.cbsearchfromcursor.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION" msgid "S&earch from caret" msgstr "Αναζήτηση από το σημείο εισαγωγής" #: tfrmeditsearchreplace.cbsearchregexp.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION" msgid "&Regular expressions" msgstr "Συνήθεις Φράσεις" #: tfrmeditsearchreplace.cbsearchselectedonly.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION" msgid "Selected &text only" msgstr "Το Επιλεγμένο κείμενο μόνο" #: tfrmeditsearchreplace.cbsearchwholewords.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION" msgid "&Whole words only" msgstr "Ολόκληρες λέξεις μόνο" #: tfrmeditsearchreplace.gbsearchoptions.caption msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION" msgid "Option" msgstr "Ιδιότητα" #: tfrmeditsearchreplace.lblreplacewith.caption msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION" msgid "&Replace with:" msgstr "Αντικατάσταση με:" #: tfrmeditsearchreplace.lblsearchfor.caption msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION" msgid "&Search for:" msgstr "Αναζήτηση για:" #: tfrmeditsearchreplace.rgsearchdirection.caption msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION" msgid "Direction" msgstr "Κατεύθυνση" #: tfrmextractdlg.caption msgctxt "TFRMEXTRACTDLG.CAPTION" msgid "Unpack files" msgstr "Ξεπακετάρισμα αρχείων" #: tfrmextractdlg.cbextractpath.caption msgid "&Unpack path names if stored with files" msgstr "Ξεπακετάρισμα ονομάτων διαδρομών αν είναι αποθηκευμένα με τα αρχεία" #: tfrmextractdlg.cbfilemask.text msgctxt "tfrmextractdlg.cbfilemask.text" msgid "*.*" msgstr "*.*" #: tfrmextractdlg.cbinseparatefolder.caption msgid "Unpack each archive to a &separate subdir (name of the archive)" msgstr "Ξεπακετάρισμα κάθε αρχειοθήκης σε ένα ξεχωριστό υποκατάλογο (όνομα της αρχειοθήκης)" #: tfrmextractdlg.cboverwrite.caption msgid "O&verwrite existing files" msgstr "Αντικατάσταση υπάρχοντων αρχείων" #: tfrmextractdlg.lblextractto.caption msgid "To the &directory:" msgstr "Στον κατάλογο:" #: tfrmextractdlg.lblfilemask.caption msgid "&Extract files matching file mask:" msgstr "Εξαγωγή αρχείων που ταιριάζουν στη μάσκα αρχείου:" #: tfrmextractdlg.lblpassword.caption msgid "&Password for encrypted files:" msgstr "&Συνθηματικό για κρυπτογραφημένα αρχεία:" #: tfrmfileexecuteyourself.btnclose.caption msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Κλείσιμο" #: tfrmfileexecuteyourself.caption msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION" msgid "Wait..." msgstr "Αναμονή..." #: tfrmfileexecuteyourself.lblfilename.caption msgid "File name:" msgstr "Όνομα αρχείου:" #: tfrmfileexecuteyourself.lblfrompath.caption msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION" msgid "From:" msgstr "Από:" #: tfrmfileexecuteyourself.lblprompt.caption msgid "Click on Close when the temporary file can be deleted!" msgstr "Κάντε κλικ στο Κλείσιμο όταν το προσωρινό αρχείο δε μπορεί να διαγραφεί!" #: tfrmfileop.btncancel.caption msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmfileop.btnminimizetopanel.caption msgid "&To panel" msgstr "Στο πάνελ" #: tfrmfileop.btnviewoperations.caption msgid "&View all" msgstr "Προβολή όλων" #: tfrmfileop.lblcurrentoperation.caption msgid "Current operation:" msgstr "Τρέχουσα Ενέργεια:" #: tfrmfileop.lblfrom.caption msgctxt "TFRMFILEOP.LBLFROM.CAPTION" msgid "From:" msgstr "Από:" #: tfrmfileop.lblto.caption msgid "To:" msgstr "Σε:" #: tfrmfileproperties.btnclose.caption msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Κλείσιμο" #: tfrmfileproperties.btnsetproperties.caption msgid "&Set properties" msgstr "Καθορισμός Ιδιοτήτων" #: tfrmfileproperties.btnsetpropertiestoallfiles.caption msgid "Set to &all selected files" msgstr "Καθορισμός σε όλα τα επιλεγμένα αρχεία" #: tfrmfileproperties.btnskipfile.caption msgid "Ski&p this file" msgstr "Παράβλεψη αυτού του αρχείου" #: tfrmfileproperties.caption msgctxt "TFRMFILEPROPERTIES.CAPTION" msgid "Properties" msgstr "Ιδιότητες" #: tfrmfileproperties.cbsgid.caption msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmfileproperties.cbsticky.caption msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Κολημμένα" #: tfrmfileproperties.cbsuid.caption msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmfileproperties.chkexecutable.caption msgid "Allow &executing file as program" msgstr "Αποδοχή εκτέλεσης αρχείου σαν πρόγραμμα" #: tfrmfileproperties.gbowner.caption msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION" msgid "Owner" msgstr "Ιδιοκτήτης" #: tfrmfileproperties.lblattrbitsstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bits:" #: tfrmfileproperties.lblattrgroupstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Γκρουπ" #: tfrmfileproperties.lblattrotherstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Άλλοι" #: tfrmfileproperties.lblattrownerstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Ιδιοκτήτης" #: tfrmfileproperties.lblattrtext.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "-----------" #: tfrmfileproperties.lblattrtextstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "Κείμενο:" #: tfrmfileproperties.lblcontains.caption msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lblcontainsstr.caption msgid "Contains:" msgstr "Περιεχόμενα:" #: tfrmfileproperties.lblexec.caption msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "Εκτέλεση" #: tfrmfileproperties.lblexecutable.caption msgid "Execute:" msgstr "Εκτέλεση:" #: tfrmfileproperties.lblfile.caption msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION" msgid "File name" msgstr "Όνομα Αρχείου" #: tfrmfileproperties.lblfilename.caption msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lblfilestr.caption msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION" msgid "File name" msgstr "Όνομα Αρχείου" #: tfrmfileproperties.lblfolder.caption msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lblfolderstr.caption msgctxt "tfrmfileproperties.lblfolderstr.caption" msgid "Path:" msgstr "Διαδρομή:" #: tfrmfileproperties.lblgroupstr.caption msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION" msgid "&Group" msgstr "Γκρουπ" #: tfrmfileproperties.lbllastaccess.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lbllastaccessstr.caption msgid "Last access:" msgstr "Τελευταία προσπέλαση:" #: tfrmfileproperties.lbllastmodif.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lbllastmodifstr.caption msgid "Last modification:" msgstr "Τελευταία διαμόρφωση:" #: tfrmfileproperties.lbllaststchange.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lbllaststchangestr.caption msgid "Last status change:" msgstr "Τελευταία αλλαγή κατάστασης:" #: tfrmfileproperties.lbloctal.caption msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "Octal:" #: tfrmfileproperties.lblownerstr.caption msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION" msgid "O&wner" msgstr "Ιδιοκτήτης" #: tfrmfileproperties.lblread.caption msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "Ανάγνωση" #: tfrmfileproperties.lblsize.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lblsizestr.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION" msgid "Size:" msgstr "Μέγεθος:" #: tfrmfileproperties.lblsymlink.caption msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lblsymlinkstr.caption msgid "Symlink to:" msgstr "Συμβολοδεσμός στο:" #: tfrmfileproperties.lbltype.caption msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION" msgid "???" msgstr ";;;" #: tfrmfileproperties.lbltypestr.caption msgid "Type:" msgstr "Τύπος:" #: tfrmfileproperties.lblwrite.caption msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "Εγγραφή" #: tfrmfileproperties.sgimage.columns[0].title.caption msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption" msgid "Name" msgstr "Όνομα" #: tfrmfileproperties.sgimage.columns[1].title.caption msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption" msgid "Value" msgstr "Τιμή" #: tfrmfileproperties.tsattributes.caption msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Ιδιότητες" #: tfrmfileproperties.tsplugins.caption msgctxt "tfrmfileproperties.tsplugins.caption" msgid "Plugins" msgstr "Πρόσθετα" #: tfrmfileproperties.tsproperties.caption msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION" msgid "Properties" msgstr "Ιδιότητες" #: tfrmfinddlg.actcancel.caption msgctxt "tfrmfinddlg.actcancel.caption" msgid "C&ancel" msgstr "Ακύρωση" #: tfrmfinddlg.actcancelclose.caption msgid "Cancel search and close window" msgstr "Κλείσιμο" #: tfrmfinddlg.actclose.caption msgctxt "tfrmfinddlg.actclose.caption" msgid "&Close" msgstr "Κλείσιμο" #: tfrmfinddlg.actconfigfilesearchhotkeys.caption msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption" msgid "Configuration of hot keys" msgstr "Διαμόρφωση των ειδικών πλήκτρων" #: tfrmfinddlg.actedit.caption msgctxt "tfrmfinddlg.actedit.caption" msgid "&Edit" msgstr "Επεξεργασία" #: tfrmfinddlg.actfeedtolistbox.caption msgid "Feed to &listbox" msgstr "Τροφοδοσία στο listbox" #: tfrmfinddlg.actfreefrommem.caption msgid "Cancel search, close and free from memory" msgstr "Ακύρωση αναζήτησης, κλείσιμο και απελευθέρωση από τη μνήμη" #: tfrmfinddlg.actfreefrommemallothers.caption msgid "For all other \"Find files\", cancel, close and free from memory" msgstr "Για όλα τα άλλα \"Αναζήτηση Αρχείων\", ακύρωση, κλείσιμο και απελευθέρωση από τη μνήμη" #: tfrmfinddlg.actgotofile.caption msgid "&Go to file" msgstr "&Μετάβαση στο αρχείο" #: tfrmfinddlg.actintellifocus.caption msgctxt "tfrmfinddlg.actintellifocus.caption" msgid "Find Data" msgstr "Εύρεση Δεδομένων" #: tfrmfinddlg.actlastsearch.caption msgid "&Last search" msgstr "Τελευταία Αναζήτηση" #: tfrmfinddlg.actnewsearch.caption msgid "&New search" msgstr "Νέα Αναζήτηση" #: tfrmfinddlg.actnewsearchclearfilters.caption msgid "New search (clear filters)" msgstr "Νέα Αναζήτηση (καθαρισμός φίλτρων)" #: tfrmfinddlg.actpageadvanced.caption msgid "Go to page \"Advanced\"" msgstr "Μετάβαση στη σελίδα \"Για Προχωρημένους\"" #: tfrmfinddlg.actpageloadsave.caption msgid "Go to page \"Load/Save\"" msgstr "Μετάβαση στη σελίδα \"Φόρτωμα/Αποθήκευση\"" #: tfrmfinddlg.actpagenext.caption msgid "Switch to Nex&t Page" msgstr "Μετάβαση στην Επόμενη Σελίδα" #: tfrmfinddlg.actpageplugins.caption msgid "Go to page \"Plugins\"" msgstr "Μετάβαση στη σελίδα \"Πρόσθετα\"" #: tfrmfinddlg.actpageprev.caption msgid "Switch to &Previous Page" msgstr "Μετάβαση στην Προηγούμενη Σελίδα" #: tfrmfinddlg.actpageresults.caption msgid "Go to page \"Results\"" msgstr "Μετάβαση στη σελίδα \"Αποτελέσματα\"" #: tfrmfinddlg.actpagestandard.caption msgid "Go to page \"Standard\"" msgstr "Μετάβαση στη σελίδα \"Προκαθορισμένα\"" #: tfrmfinddlg.actstart.caption msgctxt "tfrmfinddlg.actstart.caption" msgid "&Start" msgstr "Εκκίνηση" #: tfrmfinddlg.actview.caption msgctxt "tfrmfinddlg.actview.caption" msgid "&View" msgstr "Προβολή" #: tfrmfinddlg.btnaddattribute.caption msgctxt "tfrmfinddlg.btnaddattribute.caption" msgid "&Add" msgstr "Προσθήκη" #: tfrmfinddlg.btnattrshelp.caption msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION" msgid "&Help" msgstr "Βοήθεια" #: tfrmfinddlg.btnsavetemplate.caption msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION" msgid "&Save" msgstr "Αποθήκευση" #: tfrmfinddlg.btnsearchdelete.caption msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION" msgid "&Delete" msgstr "Διαγραφή" #: tfrmfinddlg.btnsearchload.caption msgid "L&oad" msgstr "Φόρτωση" #: tfrmfinddlg.btnsearchsave.caption msgid "S&ave" msgstr "Αποθήκευση" #: tfrmfinddlg.btnsearchsavewithstartingpath.caption msgid "Sa&ve with \"Start in directory\"" msgstr "Αποθήκευση με \"Εκκίνηση στον κατάλογο\"" #: tfrmfinddlg.btnsearchsavewithstartingpath.hint msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory" msgstr "Αν αποθηκεύτηκε τότε \"Εκκίνηση στον κατάλογο\" θα επανέλθει όταν φορτώνεται το πρότυπο. Χρησιμοποιείστε το αν επιθυμείτε να διορθώσετε την αναζήτηση σε ένα συγκεκριμένο κατάλογο" #: tfrmfinddlg.btnusetemplate.caption msgid "Use template" msgstr "Χρήση Προτύπου" #: tfrmfinddlg.caption msgctxt "TFRMFINDDLG.CAPTION" msgid "Find files" msgstr "Εύρεση αρχείων" #: tfrmfinddlg.cbcasesens.caption msgid "Case sens&itive" msgstr "Με Διάκριση Πεζών-Κεφαλαίων" #: tfrmfinddlg.cbdatefrom.caption msgid "&Date from:" msgstr "Ημερομηνία από:" #: tfrmfinddlg.cbdateto.caption msgid "Dat&e to:" msgstr "Ημερομηνία στο:" #: tfrmfinddlg.cbfilesizefrom.caption msgid "S&ize from:" msgstr "Μέγεθος από:" #: tfrmfinddlg.cbfilesizeto.caption msgid "Si&ze to:" msgstr "Μέγεθος σε:" #: tfrmfinddlg.cbfindinarchive.caption msgid "Search in &archives" msgstr "Αναζήτηση στις αρχειοθήκες" #: tfrmfinddlg.cbfindtext.caption msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION" msgid "Find &text in file" msgstr "Εύρεση κειμένου στο αρχείο" #: tfrmfinddlg.cbfollowsymlinks.caption msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION" msgid "Follow s&ymlinks" msgstr "Ακολουθείστε τους Συμβολοδεσμούς" #: tfrmfinddlg.cbnotcontainingtext.caption msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION" msgid "Find files N&OT containing the text" msgstr "Εύρεση αρχείων που ΔΕΝ περιέχουν το κείμενο" #: tfrmfinddlg.cbnotolderthan.caption msgid "N&ot older than:" msgstr "Όχι παλαιότερο από:" #: tfrmfinddlg.cbopenedtabs.caption msgid "Opened tabs" msgstr "Ανοικτές Καρτέλες" #: tfrmfinddlg.cbpartialnamesearch.caption msgid "Searc&h for part of file name" msgstr "Αναζήτηση τμήματος του ονόματος αρχείου" #: tfrmfinddlg.cbregexp.caption msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION" msgid "&Regular expression" msgstr "Συνήθης Φράση" #: tfrmfinddlg.cbreplacetext.caption msgid "Re&place by" msgstr "Αντικατάσταση από" #: tfrmfinddlg.cbselectedfiles.caption msgid "Selected directories and &files" msgstr "Επιλεγμένοι κατάλογοι και αρχεία" #: tfrmfinddlg.cbtextregexp.caption msgid "Regular &expression" msgstr "Συνήθης Φράση" #: tfrmfinddlg.cbtimefrom.caption msgid "&Time from:" msgstr "Ώρα από:" #: tfrmfinddlg.cbtimeto.caption msgid "Ti&me to:" msgstr "Ώρα στο:" #: tfrmfinddlg.cbuseplugin.caption msgid "&Use search plugin:" msgstr "Χρήση προσθέτου αναζήτησης:" #: tfrmfinddlg.chkhex.caption msgid "Hexadecimal" msgstr "" #: tfrmfinddlg.cmbexcludedirectories.hint msgid "Enter directories names that should be excluded from search separated with \";\"" msgstr "Εισαγωγή ονομάτων καταλόγων που θα έπρεπε να αποκλειστούν από την αναζήτηση, διαχωρισμένων με \";\"" #: tfrmfinddlg.cmbexcludefiles.hint msgid "Enter files names that should be excluded from search separated with \";\"" msgstr "Εισαγωγή ονομάτων αρχείων τα οποία θα έπρεπε να εξαιρεθούν από αναζήτηση διαχωρισμένη με \";\"" #: tfrmfinddlg.cmbfindfilemask.hint msgid "Enter files names separated with \";\"" msgstr "Εισαγωγή ονομάτων αρχείων διαχωρισμένα με \";\"" #: tfrmfinddlg.gbdirectories.caption msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION" msgid "Directories" msgstr "Κατάλογοι" #: tfrmfinddlg.gbfiles.caption msgctxt "TFRMFINDDLG.GBFILES.CAPTION" msgid "Files" msgstr "Αρχεία" #: tfrmfinddlg.gbfinddata.caption msgctxt "tfrmfinddlg.gbfinddata.caption" msgid "Find Data" msgstr "Εύρεση Δεδομένων" #: tfrmfinddlg.lblattributes.caption msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION" msgid "Attri&butes" msgstr "Ιδιότητες" #: tfrmfinddlg.lblencoding.caption msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION" msgid "Encodin&g:" msgstr "Κωδικοποίηση:" #: tfrmfinddlg.lblexcludedirectories.caption msgid "E&xclude subdirectories" msgstr "Αποκλεισμός υποκαταλόγων" #: tfrmfinddlg.lblexcludefiles.caption msgid "&Exclude files" msgstr "&Εξαίρεση αρχείων" #: tfrmfinddlg.lblfindfilemask.caption msgid "&File mask" msgstr "Μάσκα Αρχείου" #: tfrmfinddlg.lblfindpathstart.caption msgid "Start in &directory" msgstr "Εκκίνηση στον κατάλογο" #: tfrmfinddlg.lblsearchdepth.caption msgid "Search su&bdirectories:" msgstr "Αναζήτηση υποκαταλόγων:" #: tfrmfinddlg.lbltemplateheader.caption msgid "&Previous searches:" msgstr "Προηγούμενες αναζητήσεις:" #: tfrmfinddlg.miaction.caption msgid "&Action" msgstr "Ενέργεια" #: tfrmfinddlg.mifreefrommemallothers.caption msgid "For all others, cancel, close and free from memory" msgstr "Για όλα τα άλλα, ακύρωση, κλείσιμο και απελευθέρωση από τη μνήμη" #: tfrmfinddlg.miopeninnewtab.caption msgid "Open In New Tab(s)" msgstr "Άνοιγμα σε Νέα Καρτέλα(ες)" #: tfrmfinddlg.mioptions.caption msgctxt "tfrmfinddlg.mioptions.caption" msgid "Options" msgstr "Επιλογές" #: tfrmfinddlg.miremovefromllist.caption msgid "Remove from list" msgstr "Απομάκρυνση από τη λίστα" #: tfrmfinddlg.miresult.caption msgid "&Result" msgstr "Αποτέλεσμα" #: tfrmfinddlg.mishowallfound.caption msgid "Show all found items" msgstr "Εμφάνιση όλων των ευρεθέντων αντικειμένων" #: tfrmfinddlg.mishowineditor.caption msgid "Show In Editor" msgstr "Εμφάνιση στον Επεξεργαστή" #: tfrmfinddlg.mishowinviewer.caption msgid "Show In Viewer" msgstr "Εμφάνιση στον Προβολέα" #: tfrmfinddlg.miviewtab.caption msgctxt "tfrmfinddlg.miviewtab.caption" msgid "&View" msgstr "Προβολή" #: tfrmfinddlg.tsadvanced.caption msgid "Advanced" msgstr "Για προχωρημένους" #: tfrmfinddlg.tsloadsave.caption msgid "Load/Save" msgstr "Φόρτωση/Αποθήκευση" #: tfrmfinddlg.tsplugins.caption msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION" msgid "Plugins" msgstr "Πρόσθετα" #: tfrmfinddlg.tsresults.caption msgid "Results" msgstr "Αποτελέσματα" #: tfrmfinddlg.tsstandard.caption msgid "Standard" msgstr "Στάνταρ" #: tfrmfindview.btnclose.caption msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmfindview.btnfind.caption msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION" msgid "&Find" msgstr "Εύρεση" #: tfrmfindview.caption msgctxt "TFRMFINDVIEW.CAPTION" msgid "Find" msgstr "Εύρεση" #: tfrmfindview.cbcasesens.caption msgid "C&ase sensitive" msgstr "Με Διάκριση Πεζών-Κεφαλαίων" #: tfrmhardlink.btncancel.caption msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmhardlink.btnok.caption msgctxt "TFRMHARDLINK.BTNOK.CAPTION" msgid "&OK" msgstr "&OK" #: tfrmhardlink.caption msgid "Create hard link" msgstr "Δημιουργία δεσμού τύπου hard link" #: tfrmhardlink.lblexistingfile.caption msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "Προορισμός τον οποίο θα υποδείξει ο δεσμός" #: tfrmhardlink.lbllinktocreate.caption msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "Όνομα Δεσμού" #: tfrmhotdirexportimport.btnselectall.caption msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTALL.CAPTION" msgid "Import all!" msgstr "Εισαγωγή όλων!" #: tfrmhotdirexportimport.btnselectiondone.caption msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTIONDONE.CAPTION" msgid "Import selected" msgstr "Εισαγωγή επιλεγμένων" #: tfrmhotdirexportimport.caption msgid "Select the entries your want to import" msgstr "Επιλέξτε τις καταχωρήσεις που επιθυμείτε να εισαγάγετε" #: tfrmhotdirexportimport.lbhint.caption msgid "When clicking a sub-menu, it will select the whole menu" msgstr "Όταν γίνεται κλικ σε ένα υπομενού, επιλέγεται ολόκληρο το μενού" #: tfrmhotdirexportimport.lblhintholdcontrol.caption msgid "Hold CTRL and click entries to select multiple ones" msgstr "Κρατείστε πατημένο το CTRL και κάντε κλικ στις καταχωρήσεις για να επιλέξετε πολλές μαζί" #: tfrmlinker.btnsave.caption msgctxt "TFRMLINKER.BTNSAVE.CAPTION" msgid "..." msgstr "..." #: tfrmlinker.caption msgctxt "TFRMLINKER.CAPTION" msgid "Linker" msgstr "Linker" #: tfrmlinker.gbsaveto.caption msgid "Save to..." msgstr "Αποθήκευση σε..." #: tfrmlinker.grbxcontrol.caption msgid "Item" msgstr "Αντικείμενο" #: tfrmlinker.lblfilename.caption msgctxt "TFRMLINKER.LBLFILENAME.CAPTION" msgid "&File name" msgstr "Όνομα Αρχείου" #: tfrmlinker.spbtndown.caption msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION" msgid "Do&wn" msgstr "Κάτω" #: tfrmlinker.spbtndown.hint msgctxt "TFRMLINKER.SPBTNDOWN.HINT" msgid "Down" msgstr "Κάτω" #: tfrmlinker.spbtnrem.caption msgctxt "TFRMLINKER.SPBTNREM.CAPTION" msgid "&Remove" msgstr "Αφαίρεση" #: tfrmlinker.spbtnrem.hint msgctxt "TFRMLINKER.SPBTNREM.HINT" msgid "Delete" msgstr "Διαγραφή" #: tfrmlinker.spbtnup.caption msgctxt "TFRMLINKER.SPBTNUP.CAPTION" msgid "&Up" msgstr "Πάνω" #: tfrmlinker.spbtnup.hint msgctxt "TFRMLINKER.SPBTNUP.HINT" msgid "Up" msgstr "Πάνω" #: tfrmmain.actabout.caption msgctxt "TFRMMAIN.ACTABOUT.CAPTION" msgid "&About" msgstr "Σχετικά" #: tfrmmain.actaddfilenametocmdline.caption msgid "Add file name to command line" msgstr "Προσθήκη ονόματος αρχείου στη γραμμή εντολών" #: tfrmmain.actaddnewsearch.caption msgid "New search instance..." msgstr "Νέο περιστατικό αναζήτησης..." #: tfrmmain.actaddpathandfilenametocmdline.caption msgid "Add path and file name to command line" msgstr "Προσθήκη διαδρομής και ονόματος αρχείου στη γραμμή εντολών" #: tfrmmain.actaddpathtocmdline.caption msgid "Copy path to command line" msgstr "Αντιγραφή διαδρομής στη γραμμή εντολών" #: tfrmmain.actbenchmark.caption msgid "&Benchmark" msgstr "" #: tfrmmain.actbriefview.caption msgctxt "tfrmmain.actbriefview.caption" msgid "Brief view" msgstr "Σύντομη προβολή" #: tfrmmain.actbriefview.hint msgid "Brief View" msgstr "Σύντομη Προβολή" #: tfrmmain.actcalculatespace.caption msgid "Calculate &Occupied Space" msgstr "Υπολογισμός του Απασχολημένου Χώρου" #: tfrmmain.actchangedir.caption msgid "Change directory" msgstr "Αλλαγή Καταλόγου" #: tfrmmain.actchangedirtohome.caption msgid "Change directory to home" msgstr "Αλλαγή Καταλόγου σε αρχικό κατάλογο" #: tfrmmain.actchangedirtoparent.caption msgid "Change Directory To Parent" msgstr "Αλλαγή Καταλόγου σε γονικό κατάλογο" #: tfrmmain.actchangedirtoroot.caption msgid "Change directory to root" msgstr "Αλλαγή Καταλόγου στον κατάλογο του root" #: tfrmmain.actchecksumcalc.caption msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION" msgid "Calculate Check&sum..." msgstr "Υπολογισμός αθροίσματος ελέγχου..." #: tfrmmain.actchecksumverify.caption msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION" msgid "&Verify Checksum..." msgstr "Επιβεβαίωση αθροίσματος ελέγχου..." #: tfrmmain.actclearlogfile.caption msgid "Clear log file" msgstr "Καθαρισμός αρχείου καταγραφών" #: tfrmmain.actclearlogwindow.caption msgid "Clear log window" msgstr "Καθαρισμός παραθύρου καταγραφής" #: tfrmmain.actclosealltabs.caption msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION" msgid "Close &All Tabs" msgstr "Κλείσιμο όλων των Καρτελών" #: tfrmmain.actcloseduplicatetabs.caption msgid "Close Duplicate Tabs" msgstr "Κλείσιμο των διπλασιασμένων καταλόγων" #: tfrmmain.actclosetab.caption msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION" msgid "&Close Tab" msgstr "Κλείσιμο Καρτέλας" #: tfrmmain.actcmdlinenext.caption msgid "Next Command Line" msgstr "Επόμενη Γραμμή Εντολών" #: tfrmmain.actcmdlinenext.hint msgid "Set command line to next command in history" msgstr "Ορισμός της γραμμής εντολών στην επόμενη εντολή στο ιστορικό" #: tfrmmain.actcmdlineprev.caption msgid "Previous Command Line" msgstr "Προηγούμενη Γραμμή Εντολών" #: tfrmmain.actcmdlineprev.hint msgid "Set command line to previous command in history" msgstr "Ορισμός της γραμμής εντολών στην προηγούμενη εντολή στο ιστορικό" #: tfrmmain.actcolumnsview.caption msgid "Full" msgstr "Πλήρες" #: tfrmmain.actcolumnsview.hint msgid "Columns View" msgstr "Προβολή Στηλών" #: tfrmmain.actcomparecontents.caption msgid "Compare by &Contents" msgstr "Σύγκριση κατά Περιεχόμενα" #: tfrmmain.actcomparedirectories.caption msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION" msgid "Compare Directories" msgstr "Σύγκριση Καταλόγων" #: tfrmmain.actcomparedirectories.hint msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT" msgid "Compare Directories" msgstr "Σύγκριση Καταλόγων" #: tfrmmain.actconfigarchivers.caption msgid "Configuration of Archivers" msgstr "" #: tfrmmain.actconfigdirhotlist.caption msgctxt "TFRMMAIN.ACTCONFIGDIRHOTLIST.CAPTION" msgid "Configuration of Directory Hotlist" msgstr "Διαμόρφωση του καταλόγου Hotlist" #: tfrmmain.actconfigfavoritetabs.caption msgid "Configuration of Favorite Tabs" msgstr "Διαμόρφωση των Αγαπημένων Καρτελών" #: tfrmmain.actconfigfoldertabs.caption msgid "Configuration of folder tabs" msgstr "Διαμόρφωση των Καρτελών Φακέλων" #: tfrmmain.actconfighotkeys.caption msgctxt "tfrmmain.actconfighotkeys.caption" msgid "Configuration of hot keys" msgstr "Διαμόρφωση των ειδικών πλήκτρων" #: tfrmmain.actconfigsavesettings.caption msgid "Save Settings" msgstr "Αποθήκευση Ρυθμίσεων" #: tfrmmain.actconfigsearches.caption msgid "Configuration of searches" msgstr "Διαμόρφωση των αναζητήσεων" #: tfrmmain.actconfigtoolbars.caption msgid "Toolbar..." msgstr "Γραμμή εργαλείων" #: tfrmmain.actconfigtreeviewmenus.caption msgctxt "tfrmmain.actconfigtreeviewmenus.caption" msgid "Configuration of Tree View Menu" msgstr "Ρύθμιση του Μενού Προβολής Δέντρου" #: tfrmmain.actconfigtreeviewmenuscolors.caption msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption" msgid "Configuration of Tree View Menu Colors" msgstr "Ρύθμιση Χρωμάτων του Μενού Προβολής Δέντρου" #: tfrmmain.actcontextmenu.caption msgid "Show context menu" msgstr "Εμφάνιση μενού περιεχομένων" #: tfrmmain.actcopy.caption msgctxt "tfrmmain.actcopy.caption" msgid "Copy" msgstr "Αντιγραφή" #: tfrmmain.actcopyalltabstoopposite.caption msgid "Copy all tabs to opposite side" msgstr "Αντιγραφή όλων των καρτελών στην απέναντι πλευρά" #: tfrmmain.actcopyfiledetailstoclip.caption msgid "Copy all shown &columns" msgstr "Αντιγραφή όλων των εμφανισμένων στηλών" #: tfrmmain.actcopyfullnamestoclip.caption msgid "Copy Filename(s) with Full &Path" msgstr "Αντιγραφή Ονόματος Αρχείου(ων) με την Πλήρη Διαδρομή" #: tfrmmain.actcopynamestoclip.caption msgid "Copy &Filename(s) to Clipboard" msgstr "Αντιγραφή Ονόματος Αρχείου(ων) στο Πρόχειρο" #: tfrmmain.actcopynoask.caption msgid "Copy files without asking for confirmation" msgstr "Αντιγραφή αρχείων χωρίς ερώτηση επιβεβαίωσης" #: tfrmmain.actcopypathnosepoffilestoclip.caption msgid "Copy Full Path of selected file(s) with no ending dir separator" msgstr "Αντιγραφή πλήρους διαδρομής του επιλεγμένου αρχείου(ων) χωρίς τελικό διαχωριστικό καταλόγου" #: tfrmmain.actcopypathoffilestoclip.caption msgid "Copy Full Path of selected file(s)" msgstr "Αντιγραφή Πλήρους Διαδρομής του αρχείου(ων)" #: tfrmmain.actcopysamepanel.caption msgid "Copy to same panel" msgstr "Αντιγραφή στο ίδιο πάνελ" #: tfrmmain.actcopytoclipboard.caption msgid "&Copy" msgstr "Αντιγραφή" #: tfrmmain.actcountdircontent.caption msgid "Sho&w Occupied Space" msgstr "Εμφάνιση Κατειλημμένου Χώρου" #: tfrmmain.actcuttoclipboard.caption msgid "Cu&t" msgstr "Αποκοπή" #: tfrmmain.actdebugshowcommandparameters.caption msgid "Show Command Parameters" msgstr "Εμφάνιση Παραμέτρων Εντολών" #: tfrmmain.actdelete.caption msgctxt "TFRMMAIN.ACTDELETE.CAPTION" msgid "Delete" msgstr "Διαγραφή" #: tfrmmain.actdeletesearches.caption msgid "For all searches, cancel, close and free memory" msgstr "Για όλες τις αναζητήσεις, ακύρωση, κλείσιμο και απελευθέρωση μνήμης" #: tfrmmain.actdirhistory.caption msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION" msgid "Directory history" msgstr "Κατάλογος Ιστορικού" #: tfrmmain.actdirhotlist.caption msgid "Directory &Hotlist" msgstr "Καταλογος &Hotlist" #: tfrmmain.actdoanycmcommand.caption msgid "Select any command and execute it" msgstr "Επιλογή κάποιας εντολής και εκτέλεσή της" #: tfrmmain.actedit.caption msgctxt "tfrmmain.actedit.caption" msgid "Edit" msgstr "Επεξεργασία" #: tfrmmain.acteditcomment.caption msgid "Edit Co&mment..." msgstr "Επεξεργασία Σχολίου..." #: tfrmmain.acteditnew.caption msgid "Edit new file" msgstr "Επεξεργασία νέου αρχείου" #: tfrmmain.acteditpath.caption msgid "Edit path field above file list" msgstr "Επεξεργασία πεδίου διαδρομής πάνω από τη λίστα αρχείων" #: tfrmmain.actexchange.caption msgid "Swap &Panels" msgstr "Εναλλαγή Πάνελ" #: tfrmmain.actexecutescript.caption msgid "Execute Script" msgstr "Εκτέλεση Σεναρίου εντολών" #: tfrmmain.actexit.caption msgctxt "TFRMMAIN.ACTEXIT.CAPTION" msgid "E&xit" msgstr "Έξοδος" #: tfrmmain.actextractfiles.caption msgid "&Extract Files..." msgstr "Εξαγωγή Αρχείων..." #: tfrmmain.actfileassoc.caption msgid "Configuration of File &Associations" msgstr "Διαμόρφωση Συσχετισμών Αρχείων..." #: tfrmmain.actfilelinker.caption msgid "Com&bine Files..." msgstr "Συνδιασμός Αρχείων..." #: tfrmmain.actfileproperties.caption msgid "Show &File Properties" msgstr "Εμφάνιση Ιδιοτήτων Αρχείων" #: tfrmmain.actfilespliter.caption msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION" msgid "Spl&it File..." msgstr "Διαμερισμός Αρχείου..." #: tfrmmain.actflatview.caption msgid "&Flat view" msgstr "Επίπεδη Προβολή" #: tfrmmain.actfocuscmdline.caption msgid "Focus command line" msgstr "Συγκέντρωση της γραμμής εντολών" #: tfrmmain.actfocusswap.caption msgid "Swap focus" msgstr "Εναλλαγή σημείου εστίασης" #: tfrmmain.actfocusswap.hint msgid "Switch between left and right file list" msgstr "Αλλαγή μεταξύ αριστερής και δεξιάς λίστας αρχείων" #: tfrmmain.actgotofirstfile.caption msgid "Place cursor on first file in list" msgstr "Τοποθέτηση του κέρσορα στο πρώτο αρχείο της λίστας" #: tfrmmain.actgotolastfile.caption msgid "Place cursor on last file in list" msgstr "Τοποθέτηση του κέρσορα στο τελευταίο αρχείο της λίστας" #: tfrmmain.acthardlink.caption msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION" msgid "Create &Hard Link..." msgstr "Δημιουργία δεσμού τύπου Hard Link..." #: tfrmmain.acthelpindex.caption msgid "&Contents" msgstr "Περιεχόμενα" #: tfrmmain.acthorizontalfilepanels.caption msgid "&Horizontal Panels Mode" msgstr "Λειτουργία οριζοντίων πάνελ" #: tfrmmain.actkeyboard.caption msgid "&Keyboard" msgstr "Πληκτρολόγιο" #: tfrmmain.actleftbriefview.caption msgid "Brief view on left panel" msgstr "Σύντομη προβολή στο αριστερό πάνελ" #: tfrmmain.actleftcolumnsview.caption msgid "Columns view on left panel" msgstr "Προβολή στηλών στο αριστερό πάνελ" #: tfrmmain.actleftequalright.caption msgid "Left &= Right" msgstr "Αριστερά = Δεξιά" #: tfrmmain.actleftflatview.caption msgid "&Flat view on left panel" msgstr "Επίπεδη Προβολή στο Αριστερό Πάνελ" #: tfrmmain.actleftopendrives.caption msgid "Open left drive list" msgstr "Άνοιγμα τη λίστα οδηγών στα αριστερά" #: tfrmmain.actleftreverseorder.caption msgid "Re&verse order on left panel" msgstr "Ανάποδη σειρά στο αριστερό πάνελ" #: tfrmmain.actleftsortbyattr.caption msgid "Sort left panel by &Attributes" msgstr "Ταξινόμηση αριστερού πάνελ κατά Ιδιότητες" #: tfrmmain.actleftsortbydate.caption msgid "Sort left panel by &Date" msgstr "Ταξινόμηση αριστερού πάνελ κατά Ημερομηνία" #: tfrmmain.actleftsortbyext.caption msgid "Sort left panel by &Extension" msgstr "Ταξινόμηση αριστερού πάνελ κατά Επέκταση" #: tfrmmain.actleftsortbyname.caption msgid "Sort left panel by &Name" msgstr "Ταξινόμηση αριστερού πάνελ κατά Όνομα" #: tfrmmain.actleftsortbysize.caption msgid "Sort left panel by &Size" msgstr "Ταξινόμηση αριστερού πάνελ κατά Μέγεθος" #: tfrmmain.actleftthumbview.caption msgid "Thumbnails view on left panel" msgstr "Προβολή μικρογραφιών στο αριστερό πάνελ" #: tfrmmain.actloadfavoritetabs.caption msgid "Load tabs from Favorite Tabs" msgstr "Φόρτωση καρτελών από Αγαπημένες Καρτέλες" #: tfrmmain.actloadselectionfromclip.caption msgid "Load Selection from Clip&board" msgstr "Φόρτωση Επιλογής από το Πρόχειρο" #: tfrmmain.actloadselectionfromfile.caption msgid "&Load Selection from File..." msgstr "Φόρτωση Επιλογής από το Αρχείο..." #: tfrmmain.actloadtabs.caption msgid "&Load Tabs from File" msgstr "Φόρτωση Καρτελών από το Αρχείο" #: tfrmmain.actmakedir.caption msgid "Create &Directory" msgstr "Δημιουργία Καταλόγου" #: tfrmmain.actmarkcurrentextension.caption msgid "Select All with the Same E&xtension" msgstr "Επιλογή όλων με την Ίδια Επέκταση" #: tfrmmain.actmarkcurrentname.caption msgid "Select all files with same name" msgstr "Επιλογή όλων των αρχείων με την ίδια ονομασία" #: tfrmmain.actmarkcurrentnameext.caption msgid "Select all files with same name and extension" msgstr "Επιλογή όλων των αρχείων με την ίδια ονομασία και επέκταση" #: tfrmmain.actmarkcurrentpath.caption msgid "Select all in same path" msgstr "Επιλογή όλων με την ίδια διαδρομή" #: tfrmmain.actmarkinvert.caption msgid "&Invert Selection" msgstr "Αντιστροφή Επιλογής" #: tfrmmain.actmarkmarkall.caption msgid "&Select All" msgstr "Επιλογή Όλων" #: tfrmmain.actmarkminus.caption msgid "Unselect a Gro&up..." msgstr "Αποεπιλογή ενός Γκρουπ..." #: tfrmmain.actmarkplus.caption msgid "Select a &Group..." msgstr "Επιλογή Γκρουπ..." #: tfrmmain.actmarkunmarkall.caption msgid "&Unselect All" msgstr "Αποεπιλογή Όλων" #: tfrmmain.actminimize.caption msgid "Minimize window" msgstr "Ελαχιστοποίηση παραθύρου" #: tfrmmain.actmultirename.caption msgid "Multi &Rename Tool" msgstr "Εργαλείο Μετονομασίας Πολλών" #: tfrmmain.actnetworkconnect.caption msgid "Network &Connect..." msgstr "Σύνδεση στο Δίκτυο..." #: tfrmmain.actnetworkdisconnect.caption msgid "Network &Disconnect" msgstr "Αποσύνδεση από το Δίκτυο" #: tfrmmain.actnetworkquickconnect.caption msgid "Network &Quick Connect..." msgstr "Δίκτυο Ταχεία Σύνδεση..." #: tfrmmain.actnewtab.caption msgid "&New Tab" msgstr "Νέα Καρτέλα" #: tfrmmain.actnextfavoritetabs.caption msgid "Load the Next Favorite Tabs in the list" msgstr "Φόρτωση της Επόμενης Αγαπημένης Καρτέλας στη λίστα" #: tfrmmain.actnexttab.caption msgid "Switch to Nex&t Tab" msgstr "Μετάβαση στην Επόμενη Καρτέλα" #: tfrmmain.actopen.caption msgctxt "TFRMMAIN.ACTOPEN.CAPTION" msgid "Open" msgstr "Άνοιγμα" #: tfrmmain.actopenarchive.caption msgid "Try open archive" msgstr "Δοκιμή ανοίγματος αρχειοθήκης" #: tfrmmain.actopenbar.caption msgid "Open bar file" msgstr "Άνοιγμα του αρχείου της γραμμής εργαλείων" #: tfrmmain.actopendirinnewtab.caption msgid "Open &Folder in a New Tab" msgstr "Άνοιγμα Φακέλου σε Νέα Καρτέλα" #: tfrmmain.actopenvirtualfilesystemlist.caption msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION" msgid "Open &VFS List" msgstr "Άνοιγμα Λίστας VFS" #: tfrmmain.actoperationsviewer.caption msgid "Operations &Viewer" msgstr "Προβολέας Λειτουργιών" #: tfrmmain.actoptions.caption msgid "&Options..." msgstr "Επιλογές..." #: tfrmmain.actpackfiles.caption msgid "&Pack Files..." msgstr "Πακετάρισμα Αρχείων..." #: tfrmmain.actpanelssplitterperpos.caption msgid "Set splitter position" msgstr "Καθορισμός θέσης Διαμεριστή" #: tfrmmain.actpastefromclipboard.caption msgid "&Paste" msgstr "Επικόλληση" #: tfrmmain.actpreviousfavoritetabs.caption msgid "Load the Previous Favorite Tabs in the list" msgstr "Φόρτωση της Προηγούμενης Αγαπημένης Καρτέλας στη λίστα" #: tfrmmain.actprevtab.caption msgid "Switch to &Previous Tab" msgstr "Αλλαγή στην προηγούμενη Καρτέλα" #: tfrmmain.actquickfilter.caption msgid "Quick filter" msgstr "Γρήγορο Φίλτρο" #: tfrmmain.actquicksearch.caption msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION" msgid "Quick search" msgstr "Ταχεία Αναζήτηση" #: tfrmmain.actquickview.caption msgid "&Quick View Panel" msgstr "Πάνελ Ταχείας Προβολής" #: tfrmmain.actrefresh.caption msgid "&Refresh" msgstr "Ανανέωση" #: tfrmmain.actreloadfavoritetabs.caption msgid "Reload the last Favorite Tabs loaded" msgstr "Επαναφόρτωση της τελευταίας φορτωμένης Αγαπημένης Καρτέλας " #: tfrmmain.actrename.caption msgctxt "tfrmmain.actrename.caption" msgid "Move" msgstr "Μετακίνηση" #: tfrmmain.actrenamenoask.caption msgid "Move/Rename files without asking for confirmation" msgstr "Μετακίνηση/μετονομασία αρχείων χωρίς ερώτηση επιβεβαίωσης" #: tfrmmain.actrenameonly.caption msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION" msgid "Rename" msgstr "Μετονομασία" #: tfrmmain.actrenametab.caption msgid "&Rename Tab" msgstr "Μετονομασία Καρτέλας" #: tfrmmain.actresavefavoritetabs.caption msgid "Resave on the last Favorite Tabs loaded" msgstr "Επαναποθήκευση στη τελευταία φορτωμένη Αγαπημένη Καρτέλα" #: tfrmmain.actrestoreselection.caption msgid "&Restore Selection" msgstr "Επαναφορά Επιλογής" #: tfrmmain.actreverseorder.caption msgid "Re&verse Order" msgstr "Ανάποδη Σειρά" #: tfrmmain.actrightbriefview.caption msgid "Brief view on right panel" msgstr "Σύντομη προβολή στο δεξιό πάνελ" #: tfrmmain.actrightcolumnsview.caption msgid "Columns view on right panel" msgstr "Προβολή στηλών στο δεξιό πάνελ" #: tfrmmain.actrightequalleft.caption msgid "Right &= Left" msgstr "Αριστερά = Δεξιά" #: tfrmmain.actrightflatview.caption msgid "&Flat view on right panel" msgstr "Επίπεδη Προβολή στο Δεξιό Πάνελ" #: tfrmmain.actrightopendrives.caption msgid "Open right drive list" msgstr "Άνοιγμα της Λίστας Οδηγών στα δεξιά" #: tfrmmain.actrightreverseorder.caption msgid "Re&verse order on right panel" msgstr "Επαναφορά σειράς στο δεξιό πάνελ" #: tfrmmain.actrightsortbyattr.caption msgid "Sort right panel by &Attributes" msgstr "Ταξινόμηση δεξιού πάνελ κατά Ιδιότητες" #: tfrmmain.actrightsortbydate.caption msgid "Sort right panel by &Date" msgstr "Ταξινόμηση δεξιού πάνελ κατά Ημερομηνία" #: tfrmmain.actrightsortbyext.caption msgid "Sort right panel by &Extension" msgstr "Ταξινόμηση δεξιού πάνελ κατά Επέκταση" #: tfrmmain.actrightsortbyname.caption msgid "Sort right panel by &Name" msgstr "Ταξινόμηση δεξιού πάνελ κατά Όνομα" #: tfrmmain.actrightsortbysize.caption msgid "Sort right panel by &Size" msgstr "Ταξινόμηση δεξιού πάνελ κατά Μέγεθος" #: tfrmmain.actrightthumbview.caption msgid "Thumbnails view on right panel" msgstr "Προβολή μικρογραφιών στο δεξιό πάνελ" #: tfrmmain.actrunterm.caption msgid "Run &Terminal" msgstr "Εκτέλεση Τερματικού" #: tfrmmain.actsavefavoritetabs.caption msgid "Save current tabs to a New Favorite Tabs" msgstr "Αποθήκευση τρέχουσας καρτέλας σε μία Νέα Αγαπημένη Καρτέλα" #: tfrmmain.actsaveselection.caption msgid "Sa&ve Selection" msgstr "Αποθήκευση Επιλογής" #: tfrmmain.actsaveselectiontofile.caption msgid "Save S&election to File..." msgstr "Αποθήκευση επιλογής στο αρχείο..." #: tfrmmain.actsavetabs.caption msgid "&Save Tabs to File" msgstr "Αποθήκευση Καρτελών στο Αρχείο" #: tfrmmain.actsearch.caption msgid "&Search..." msgstr "Αναζήτηση..." #: tfrmmain.actsetalltabsoptiondirsinnewtab.caption msgid "All tabs Locked with Dir Opened in New Tabs" msgstr "Όλες οι καρτέλες κλειδωμένες με Κατάλογο ανοικτό σε Νέες Καρτέλες" #: tfrmmain.actsetalltabsoptionnormal.caption msgid "Set all tabs to Normal" msgstr "Ορισμός όλων των καρτελών σε Κανονικές" #: tfrmmain.actsetalltabsoptionpathlocked.caption msgid "Set all tabs to Locked" msgstr "Ορισμός όλων των καρτελών σε Κλειδωμένες" #: tfrmmain.actsetalltabsoptionpathresets.caption msgid "All tabs Locked with Dir Changes Allowed" msgstr "Όλες οι καρτέλες Κλειδωμένες με ελέυθερες τις Αλλαγές Καταλόγου" #: tfrmmain.actsetfileproperties.caption msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION" msgid "Change &Attributes..." msgstr "Αλλαγή Ιδιοτήτων..." #: tfrmmain.actsettaboptiondirsinnewtab.caption msgid "Locked with Directories Opened in New &Tabs" msgstr "Κλειδωμένο με Καταλόγους Ανοικτούς σε νέες Καρτέλες" #: tfrmmain.actsettaboptionnormal.caption msgid "&Normal" msgstr "Normal" #: tfrmmain.actsettaboptionpathlocked.caption msgid "&Locked" msgstr "Κλειδωμένο" #: tfrmmain.actsettaboptionpathresets.caption msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION" msgid "Locked with &Directory Changes Allowed" msgstr "Κλειδωμένο με Επιτρεπόμενες Αλλαγές Καταλόγων " #: tfrmmain.actshellexecute.caption msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION" msgid "Open" msgstr "Άνοιγμα" #: tfrmmain.actshellexecute.hint msgid "Open using system associations" msgstr "Άνοιγμα με χρήση των συσχετισμών του συστήματος" #: tfrmmain.actshowbuttonmenu.caption msgid "Show button menu" msgstr "Εμφάνιση μενού κουμπιών" #: tfrmmain.actshowcmdlinehistory.caption msgid "Show command line history" msgstr "Εμφάνιση ιστορικού γραμμής εντολών" #: tfrmmain.actshowmainmenu.caption msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION" msgid "Menu" msgstr "Μενού" #: tfrmmain.actshowsysfiles.caption msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION" msgid "Show &Hidden/System Files" msgstr "Εμφάνιση Κρυφών Αρχείων/Αρχείων Συστήματος " #: tfrmmain.actsortbyattr.caption msgid "Sort by &Attributes" msgstr "Κατάταξη κατά Ιδιότητες" #: tfrmmain.actsortbydate.caption msgid "Sort by &Date" msgstr "Ταξινόμηση κατά Ημερομηνία" #: tfrmmain.actsortbyext.caption msgid "Sort by &Extension" msgstr "Ταξινόμηση κατά Επέκταση" #: tfrmmain.actsortbyname.caption msgid "Sort by &Name" msgstr "Ταξινόμηση κατά Όνομα" #: tfrmmain.actsortbysize.caption msgid "Sort by &Size" msgstr "Ταξινόμηση κατά Μέγεθος" #: tfrmmain.actsrcopendrives.caption msgid "Open drive list" msgstr "Άνοιγμα της Λίστας Οδηγών" #: tfrmmain.actswitchignorelist.caption msgid "Enable/disable ignore list file to not show file names" msgstr "Ενεργοποίηση/Απενεργοποίηση αρχείου λίστας αγνόησης για να μην φαίνονται ονόματα αρχείου" #: tfrmmain.actsymlink.caption msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION" msgid "Create Symbolic &Link..." msgstr "Δημιουργία Συμβολοδεσμού..." #: tfrmmain.actsyncdirs.caption msgid "Synchronize dirs..." msgstr "Συγχρονισμός καταλόγων..." #: tfrmmain.acttargetequalsource.caption msgid "Target &= Source" msgstr "Στόχος = Πηγή" #: tfrmmain.acttestarchive.caption msgid "&Test Archive(s)" msgstr "Δοκιμή Αρχείου(ων)" #: tfrmmain.actthumbnailsview.caption msgctxt "tfrmmain.actthumbnailsview.caption" msgid "Thumbnails" msgstr "Μικρογραφίες" #: tfrmmain.actthumbnailsview.hint msgid "Thumbnails View" msgstr "Προβολή Μικρογραφιών" #: tfrmmain.acttogglefullscreenconsole.caption msgid "Toggle fullscreen mode console" msgstr "εναλλαγή σε τερματικό πλήρους οθόνης" #: tfrmmain.acttransferleft.caption msgid "Transfer dir under cursor to left window" msgstr "Μεταφορά του καταλόγου κάτω από τον κέρσορα στο αριστερό παράθυρο" #: tfrmmain.acttransferright.caption msgid "Transfer dir under cursor to right window" msgstr "Μεταφορά του καταλόγου κάτω από τον κέρσορα στο δεξιό παράθυρο" #: tfrmmain.acttreeview.caption msgid "&Tree View Panel" msgstr "Πάνελ Προβολής Δέντρου" #: tfrmmain.actuniversalsingledirectsort.caption msgid "Sort according to parameters" msgstr "Ταξινόμηση βάσει παραμέτρων" #: tfrmmain.actunmarkcurrentextension.caption msgid "Unselect All with the Same Ex&tension" msgstr "Αποεπιλογή Όλων με τη ίδια Επέκταση" #: tfrmmain.actunmarkcurrentname.caption msgid "Unselect all files with same name" msgstr "Αποεπιλογή όλων των αρχείων με την ίδια ονομασία" #: tfrmmain.actunmarkcurrentnameext.caption msgid "Unselect all files with same name and extension" msgstr "Αποεπιλογή όλων των αρχείων με την ίδια ονομασία και επέκταση" #: tfrmmain.actunmarkcurrentpath.caption msgid "Unselect all in same path" msgstr "Αποεπιλογή όλων με την ίδια διαδρομή" #: tfrmmain.actview.caption msgctxt "tfrmmain.actview.caption" msgid "View" msgstr "Προβολή" #: tfrmmain.actviewhistory.caption msgid "Show history of visited paths for active view" msgstr "Εμφάνιση ιστορικού εμφανισμένων διαδρομών για ενεργή προβολή" #: tfrmmain.actviewhistorynext.caption msgid "Go to next entry in history" msgstr "Μετάβαση στην επόμενη καταχώρηση στο ιστορικό" #: tfrmmain.actviewhistoryprev.caption msgid "Go to previous entry in history" msgstr "Μετάβαση στην προηγούμενη καταχώρηση στο ιστορικό" #: tfrmmain.actviewlogfile.caption msgid "View log file" msgstr "Προβολή αρχείου καταγραφών" #: tfrmmain.actviewsearches.caption msgid "View current search instances" msgstr "Προβολή τρεχόντων περιστατικών αναζήτησης" #: tfrmmain.actvisithomepage.caption msgid "&Visit Double Commander Website" msgstr "Επισκεφθείτε την Ιστοσελίδα του Double Commander" #: tfrmmain.actwipe.caption msgid "Wipe" msgstr "Ασφαλής Διαγραφή" #: tfrmmain.actworkwithdirectoryhotlist.caption msgid "Work with Directory Hotlist and parameters" msgstr "Εργασία με Κατάλογο Hotlist και παραμέτρους" #: tfrmmain.btnf10.caption msgctxt "tfrmmain.btnf10.caption" msgid "Exit" msgstr "Έξοδος" #: tfrmmain.btnf7.caption msgctxt "TFRMMAIN.BTNF7.CAPTION" msgid "Directory" msgstr "Κατάλογος" #: tfrmmain.btnf8.caption msgctxt "TFRMMAIN.BTNF8.CAPTION" msgid "Delete" msgstr "Διαγραφή" #: tfrmmain.btnf9.caption msgctxt "tfrmmain.btnf9.caption" msgid "Terminal" msgstr "Τερματικό" #: tfrmmain.btnleftdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "*" #: tfrmmain.btnleftdirectoryhotlist.hint msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT" msgid "Directory Hotlist" msgstr "Κατάλογος Hotlist" #: tfrmmain.btnleftequalright.caption msgctxt "tfrmmain.btnleftequalright.caption" msgid "<" msgstr "<" #: tfrmmain.btnleftequalright.hint msgid "Show current directory of the right panel in the left panel" msgstr "Εμφάνιση τρέχοντος καταλόγου του δεξιού πάνελ στο αριστερό πάνελ" #: tfrmmain.btnlefthome.caption msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION" msgid "~" msgstr "~" #: tfrmmain.btnlefthome.hint msgctxt "TFRMMAIN.BTNLEFTHOME.HINT" msgid "Go to home directory" msgstr "Μετάβαση στον αρχικό κατάλογο" #: tfrmmain.btnleftroot.caption msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION" msgid "/" msgstr "/" #: tfrmmain.btnleftroot.hint msgctxt "TFRMMAIN.BTNLEFTROOT.HINT" msgid "Go to root directory" msgstr "Μετάβαση στον κατάλογο root" #: tfrmmain.btnleftup.caption msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION" msgid ".." msgstr ".." #: tfrmmain.btnleftup.hint msgctxt "TFRMMAIN.BTNLEFTUP.HINT" msgid "Go to parent directory" msgstr "Μετάβαση στον γονικό κατάλογο" #: tfrmmain.btnrightdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "*" #: tfrmmain.btnrightdirectoryhotlist.hint msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT" msgid "Directory Hotlist" msgstr "Κατάλογος Hotlist" #: tfrmmain.btnrightequalleft.caption msgctxt "tfrmmain.btnrightequalleft.caption" msgid ">" msgstr ">" #: tfrmmain.btnrightequalleft.hint msgid "Show current directory of the left panel in the right panel" msgstr "Εμφάνιση τρέχοντος καταλόγου του αριστερού πάνελ στο δεξιό πάνελ" #: tfrmmain.btnrighthome.caption msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION" msgid "~" msgstr "~" #: tfrmmain.btnrightroot.caption msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION" msgid "/" msgstr "/" #: tfrmmain.btnrightup.caption msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION" msgid ".." msgstr ".." #: tfrmmain.caption msgctxt "TFRMMAIN.CAPTION" msgid "Double Commander" msgstr "Double Commander" #: tfrmmain.lblcommandpath.caption msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION" msgid "Path" msgstr "Διαδρομή" #: tfrmmain.mi2080.caption msgid "&20/80" msgstr "&20/80" #: tfrmmain.mi3070.caption msgid "&30/70" msgstr "&30/70" #: tfrmmain.mi4060.caption msgid "&40/60" msgstr "&40/60" #: tfrmmain.mi5050.caption msgid "&50/50" msgstr "&50/50" #: tfrmmain.mi6040.caption msgid "&60/40" msgstr "&60/40" #: tfrmmain.mi7030.caption msgid "&70/30" msgstr "&70/30" #: tfrmmain.mi8020.caption msgid "&80/20" msgstr "&80/20" #: tfrmmain.micancel.caption msgctxt "TFRMMAIN.MICANCEL.CAPTION" msgid "Cancel" msgstr "Ακύρωση" #: tfrmmain.micopy.caption msgid "Copy..." msgstr "Αντιγραφή..." #: tfrmmain.mihardlink.caption msgctxt "TFRMMAIN.MIHARDLINK.CAPTION" msgid "Create link..." msgstr "Δημιουργία δεσμού..." #: tfrmmain.milogclear.caption msgid "Clear" msgstr "Καθαρισμός" #: tfrmmain.milogcopy.caption msgctxt "TFRMMAIN.MILOGCOPY.CAPTION" msgid "Copy" msgstr "Αντιγραφή" #: tfrmmain.miloghide.caption msgid "Hide" msgstr "Κρύψιμο" #: tfrmmain.milogselectall.caption msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION" msgid "Select All" msgstr "Επιλογή όλων" #: tfrmmain.mimove.caption msgid "Move..." msgstr "Μετακίνηση..." #: tfrmmain.misymlink.caption msgctxt "TFRMMAIN.MISYMLINK.CAPTION" msgid "Create symlink..." msgstr "Δημιουργία Συμβολοδεσμού..." #: tfrmmain.mitaboptions.caption msgid "Tab options" msgstr "Επιλογές Καρτελών" #: tfrmmain.mitrayiconexit.caption msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION" msgid "E&xit" msgstr "Έξοδος" #: tfrmmain.mitrayiconrestore.caption msgid "Restore" msgstr "Επαναφορά" #: tfrmmain.mnualloperpause.caption msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION" msgid "||" msgstr "||" #: tfrmmain.mnualloperstart.caption msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION" msgid "Start" msgstr "Εκκίνηση" #: tfrmmain.mnualloperstop.caption msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION" msgid "Cancel" msgstr "Ακύρωση" #: tfrmmain.mnucmd.caption msgid "&Commands" msgstr "Εντολές" #: tfrmmain.mnuconfig.caption msgid "C&onfiguration" msgstr "Διαμόρφωση" #: tfrmmain.mnufavoritetabs.caption msgid "Favorites" msgstr "Αγαπημένα" #: tfrmmain.mnufiles.caption msgid "&Files" msgstr "Αρχεία" #: tfrmmain.mnuhelp.caption msgctxt "TFRMMAIN.MNUHELP.CAPTION" msgid "&Help" msgstr "&Βοήθεια" #: tfrmmain.mnumark.caption msgid "&Mark" msgstr "Επιλογή" #: tfrmmain.mnunetwork.caption msgctxt "TFRMMAIN.MNUNETWORK.CAPTION" msgid "Network" msgstr "Δίκτυο" #: tfrmmain.mnushow.caption msgid "&Show" msgstr "Εμφάνιση" #: tfrmmain.mnutaboptions.caption msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION" msgid "Tab &Options" msgstr "Επιλογές Καρτελών" #: tfrmmain.mnutabs.caption msgid "&Tabs" msgstr "Καρτέλες" #: tfrmmain.tbchangedir.caption msgid "CD" msgstr "CD" #: tfrmmain.tbcopy.caption msgctxt "TFRMMAIN.TBCOPY.CAPTION" msgid "Copy" msgstr "Αντιγραφή" #: tfrmmain.tbcut.caption msgctxt "TFRMMAIN.TBCUT.CAPTION" msgid "Cut" msgstr "Αποκοπή" #: tfrmmain.tbdelete.caption msgctxt "TFRMMAIN.TBDELETE.CAPTION" msgid "Delete" msgstr "Διαγραφή" #: tfrmmain.tbedit.caption msgctxt "TFRMMAIN.TBEDIT.CAPTION" msgid "Edit" msgstr "Επεξεργασία" #: tfrmmain.tbpaste.caption msgctxt "TFRMMAIN.TBPASTE.CAPTION" msgid "Paste" msgstr "Επικόλληση" #: tfrmmaincommandsdlg.btncancel.caption msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmmaincommandsdlg.btnok.caption msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION" msgid "&OK" msgstr "OK" #: tfrmmaincommandsdlg.caption msgid "Select your internal command" msgstr "Επιλέξτε την εσωτερική σας εντολή" #: tfrmmaincommandsdlg.cbcategorysortornot.text msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text" msgid "Legacy sorted" msgstr "Παλαιού τύπου ταξινόμηση" #: tfrmmaincommandsdlg.cbcommandssortornot.text msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT" msgid "Legacy sorted" msgstr "Παλαιού τύπου ταξινόμηση" #: tfrmmaincommandsdlg.cbselectallcategorydefault.caption msgid "Select all categories by default" msgstr "Επιλογή όλων των κατηγοριών εξ' ορισμού" #: tfrmmaincommandsdlg.gbselection.caption msgid "Selection:" msgstr "Επιλογή:" #: tfrmmaincommandsdlg.lblcategory.caption msgid "&Categories:" msgstr "Κατηγορίες:" #: tfrmmaincommandsdlg.lblcommandname.caption msgid "Command &name:" msgstr "Όνομα εντολής:" #: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption msgid "&Filter:" msgstr "Φίλτρο:" #: tfrmmaincommandsdlg.lblhint.caption msgid "Hint:" msgstr "Συμβουλή:" #: tfrmmaincommandsdlg.lblhotkey.caption msgid "Hotkey:" msgstr "Ειδικό Πλήκτρο:" #: tfrmmaincommandsdlg.lblselectedcommand.caption msgid "cm_name" msgstr "cm_name" #: tfrmmaincommandsdlg.lblselectedcommandcategory.caption msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDCATEGORY.CAPTION" msgid "Category" msgstr "Κατηγορία" #: tfrmmaincommandsdlg.lblselectedcommandhelp.caption msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDHELP.CAPTION" msgid "Help" msgstr "Βοήθεια" #: tfrmmaincommandsdlg.lblselectedcommandhint.caption msgid "Hint" msgstr "Συμβουλή" #: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDHOTKEY.CAPTION" msgid "Hotkey" msgstr "Ειδικό Πλήκτρο" #: tfrmmaskinputdlg.btnaddattribute.caption msgctxt "tfrmmaskinputdlg.btnaddattribute.caption" msgid "&Add" msgstr "Προσθήκη" #: tfrmmaskinputdlg.btnattrshelp.caption msgctxt "tfrmmaskinputdlg.btnattrshelp.caption" msgid "&Help" msgstr "Βοήθεια" #: tfrmmaskinputdlg.btncancel.caption msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmmaskinputdlg.btndefinetemplate.caption msgid "&Define..." msgstr "Προσδιορισμός..." #: tfrmmaskinputdlg.btnok.caption msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION" msgid "&OK" msgstr "OK" #: tfrmmaskinputdlg.chkcasesensitive.caption msgid "Case sensitive" msgstr "Με διάκριση πεζών -κεφαλαίων" #: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption msgid "Ignore accents and ligatures" msgstr "Αγνόηση χρήσης τονισμού και διφθόγγων" #: tfrmmaskinputdlg.lblattributes.caption msgid "Attri&butes:" msgstr "Ιδιότητες:" #: tfrmmaskinputdlg.lblprompt.caption msgid "Input Mask:" msgstr "Μάσκα Εισαγωγής:" #: tfrmmaskinputdlg.lblsearchtemplate.caption msgid "O&r select predefined selection type:" msgstr "Ή επιλέξτε τον προκαθορισμένο τύπο επιλογής:" #: tfrmmkdir.btncancel.caption msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmmkdir.btnok.caption msgctxt "TFRMMKDIR.BTNOK.CAPTION" msgid "&OK" msgstr "OK" #: tfrmmkdir.caption msgid "Create new directory" msgstr "Δημιουργία νέου καταλόγου" #: tfrmmkdir.lblmakedir.caption msgid "&Input new directory name:" msgstr "Εισάγετε νέο όνομα καταλόγου:" #: tfrmmodview.btnpath1.caption msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath2.caption msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath3.caption msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath4.caption msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath5.caption msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.caption msgctxt "TFRMMODVIEW.CAPTION" msgid "New Size" msgstr "Νέο Μέγεθος" #: tfrmmodview.lblheight.caption msgid "Height :" msgstr "Ύψος:" #: tfrmmodview.lblpath1.caption msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION" msgid "1" msgstr "1" #: tfrmmodview.lblpath2.caption msgctxt "tfrmmodview.lblpath2.caption" msgid "2" msgstr "2" #: tfrmmodview.lblpath3.caption msgctxt "tfrmmodview.lblpath3.caption" msgid "3" msgstr "3" #: tfrmmodview.lblpath4.caption msgid "4" msgstr "4" #: tfrmmodview.lblpath5.caption msgid "5" msgstr "5" #: tfrmmodview.lblquality.caption msgid "Quality of compress to Jpg" msgstr "Ποιότητα συμπίεσης του Jpg" #: tfrmmodview.lblwidth.caption msgid "Width :" msgstr "Πλάτος :" #: tfrmmodview.rbbmp.caption msgid "BMP" msgstr "BMP" #: tfrmmodview.rbico.caption msgid "ICO" msgstr "ICO" #: tfrmmodview.rbjpg.caption msgid "JPG" msgstr "JPG" #: tfrmmodview.rbpng.caption msgid "PNG" msgstr "PNG" #: tfrmmodview.rbpnm.caption msgid "PNM" msgstr "PNM" #: tfrmmodview.teheight.text msgctxt "tfrmmodview.teheight.text" msgid "Height" msgstr "Ύψος" #: tfrmmodview.tequality.text msgid "80" msgstr "80" #: tfrmmodview.tewidth.text msgctxt "TFRMMODVIEW.TEWIDTH.TEXT" msgid "Width" msgstr "Πλάτος" #: tfrmmsg.lblmsg.caption msgid "456456465465465" msgstr "456456465465465" #: tfrmmultirename.btnclose.caption msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Κλείσιμο" #: tfrmmultirename.btndeletepreset.caption msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION" msgid "&Delete" msgstr "Διαγραφή" #: tfrmmultirename.btnedit.caption msgctxt "tfrmmultirename.btnedit.caption" msgid "&Edit" msgstr "Επεξεργασία" #: tfrmmultirename.btnextmenu.caption msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION" msgid "..." msgstr "..." #: tfrmmultirename.btnloadpreset.caption msgid "&Load" msgstr "Φόρτωση" #: tfrmmultirename.btnnamemenu.caption msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION" msgid "..." msgstr "..." #: tfrmmultirename.btnrename.caption msgctxt "tfrmmultirename.btnrename.caption" msgid "&Rename" msgstr "Μετονομασία" #: tfrmmultirename.btnrestore.caption msgid "Reset &all" msgstr "Επαναφορά όλων" #: tfrmmultirename.btnsavepreset.caption msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION" msgid "&Save" msgstr "Αποθήκευση" #: tfrmmultirename.caption msgctxt "TFRMMULTIRENAME.CAPTION" msgid "MultiRename" msgstr "Μετονομασία Πολλών" #: tfrmmultirename.cblog.caption msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION" msgid "Ena&ble" msgstr "Ενεργοποίηση" #: tfrmmultirename.cbregexp.caption msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION" msgid "Regular e&xpressions" msgstr "Συνήθεις φράσεις" #: tfrmmultirename.cbusesubs.caption msgid "&Use substitution" msgstr "Χρήση αντικατάστασης" #: tfrmmultirename.cmbxwidth.text msgid "01" msgstr "01" #: tfrmmultirename.edinterval.text msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT" msgid "1" msgstr "1" #: tfrmmultirename.edpoc.text msgctxt "TFRMMULTIRENAME.EDPOC.TEXT" msgid "1" msgstr "1" #: tfrmmultirename.extension.caption msgid "[E] Extension" msgstr "[E] Επέκταση" #: tfrmmultirename.gbcounter.caption msgid "Counter" msgstr "Μετρητής" #: tfrmmultirename.gbfindreplace.caption msgid "Find && Replace" msgstr "Αναζήτηση && Αντικατάσταση" #: tfrmmultirename.gblog.caption msgid "Log Result" msgstr "Αποτέλεσμα Καταγραφής" #: tfrmmultirename.gbmaska.caption msgid "Mask" msgstr "Μάσκα" #: tfrmmultirename.gbpresets.caption msgid "Presets" msgstr "Προρύθμιση" #: tfrmmultirename.lbext.caption msgid "&Extension" msgstr "Επέκταση" #: tfrmmultirename.lbfind.caption msgid "&Find..." msgstr "Έυρεση..." #: tfrmmultirename.lbinterval.caption msgid "&Interval" msgstr "Διάστημα" #: tfrmmultirename.lbname.caption msgid "File &Name" msgstr "Όνομα Αρχείου" #: tfrmmultirename.lbreplace.caption msgid "Re&place..." msgstr "Αντικατάσταση..." #: tfrmmultirename.lbstnb.caption msgid "S&tart Number" msgstr "Αριθμός Εκκίνησης" #: tfrmmultirename.lbwidth.caption msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION" msgid "&Width" msgstr "Πλάτος" #: tfrmmultirename.micounter.caption msgid "[C] Counter" msgstr "[C] Μετρητής" #: tfrmmultirename.miday.caption msgid "[D] Day" msgstr "[D] Ημερομηνία" #: tfrmmultirename.miday1.caption msgid "[DD] Day (2 digits)" msgstr "[ΗΗ] Ημέρα (2 ψηφία )" #: tfrmmultirename.miday2.caption msgid "[DDD] Day of the week (short, e.g., \"mon\")" msgstr "[ΗΗΗ] Ημέρα της εβδομάδας (σύντομο, π.χ., \"δευτ\")" #: tfrmmultirename.miday3.caption msgid "[DDDD] Day of the week (long, e.g., \"monday\")" msgstr "[ΗΗΗΗ] Ημέρα της εβδομάδας (μακρύ, π.χ., \"δευτέρα\")" #: tfrmmultirename.miextensionx.caption msgid "[Ex] Character at position x" msgstr "[Ex] Χαρακτήρας στη θέση x" #: tfrmmultirename.miextensionxx.caption msgid "[Ex:y] Characters from position x to y" msgstr "[Ex:y] Χαρακτήρες από την θέση x στη y" #: tfrmmultirename.mihour.caption msgid "[h] Hour" msgstr "[h] Ώρα" #: tfrmmultirename.mihour1.caption msgid "[hh] Hour (2 digits)" msgstr "[hh] Ώρα (2 ψηφία)" #: tfrmmultirename.miminute.caption msgid "[n] Minute" msgstr "[n] Λεπτό" #: tfrmmultirename.miminute1.caption msgid "[nn] Minute (2 digits)" msgstr "[nn] Λεπτό (2 ψηφία)" #: tfrmmultirename.mimonth.caption msgid "[M] Month" msgstr "[M] Μήνας" #: tfrmmultirename.mimonth1.caption msgid "[MM] Month (2 digits)" msgstr "[MM] Μήνας (2 ψηφία)" #: tfrmmultirename.mimonth2.caption msgid "[MMM] Month name (short, e.g., \"jan\")" msgstr "[ΜΜΜΜ] Όνομα Μηνός (σύντομο, π.χ., \"ιαν\")" #: tfrmmultirename.mimonth3.caption msgid "[MMMM] Month name (long, e.g., \"january\")" msgstr "[ΜΜΜΜ] Όνομα Μηνός (μακρύ, π.χ., \"ιανουάριος\")" #: tfrmmultirename.miname.caption msgid "[N] Name" msgstr "[N] Όνομα" #: tfrmmultirename.minamex.caption msgid "[Nx] Character at position x" msgstr "[Nx] Χαρακτήρας στη θέση x" #: tfrmmultirename.minamexx.caption msgid "[Nx:y] Characters from position x to y" msgstr "[Nx:y] Χαρακτήρες από τη θέση x στη y" #: tfrmmultirename.minext.caption msgid "Time..." msgstr "Χρόνος..." #: tfrmmultirename.minextextension.caption msgid "Extension..." msgstr "Επέκταση..." #: tfrmmultirename.minextname.caption msgid "Name..." msgstr "Όνομα..." #: tfrmmultirename.miplugin.caption msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION" msgid "Plugin" msgstr "Πρόσθετο" #: tfrmmultirename.misecond.caption msgid "[s] Second" msgstr "[s] Δευτερόλεπτο" #: tfrmmultirename.misecond1.caption msgid "[ss] Second (2 digits)" msgstr "[ss] Δευτερόλεπτο (2 ψηφία)" #: tfrmmultirename.miyear.caption msgid "[Y] Year (2 digits)" msgstr "[Y] Χρονιά (2 ψηφεία)" #: tfrmmultirename.miyear1.caption msgid "[YYYY] Year (4 digits)" msgstr "[YYYY] Χρονιά (4 ψηφεία)" #: tfrmmultirename.mnueditnames.caption msgid "Edit names..." msgstr "Επεξεργασία ονομάτων..." #: tfrmmultirename.mnuloadfromfile.caption msgid "Load names from file..." msgstr "Φόρτωμα ονομάτων από το αρχείο..." #: tfrmmultirename.n1.caption msgctxt "TFRMMULTIRENAME.N1.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n2.caption msgctxt "TFRMMULTIRENAME.N2.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n3.caption msgctxt "TFRMMULTIRENAME.N3.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n4.caption msgctxt "TFRMMULTIRENAME.N4.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n5.caption msgctxt "TFRMMULTIRENAME.N5.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.stringgrid.columns[0].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION" msgid "Old File Name" msgstr "Παλιό Όνομα Αρχείου" #: tfrmmultirename.stringgrid.columns[1].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION" msgid "New File Name" msgstr "Νέο Όνομα Αρχείου" #: tfrmmultirename.stringgrid.columns[2].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION" msgid "File Path" msgstr "Διαδρομή Αρχείου" #: tfrmmultirenamewait.caption msgctxt "tfrmmultirenamewait.caption" msgid "Double Commander" msgstr "Double Commander" #: tfrmmultirenamewait.lblmessage.caption msgid "Click OK when you have closed the editor to load the changed names!" msgstr "Κάντε κλικ στο ΟΚ όταν έχετε κλείσει τον επεξεργαστή για να φορτώσετε τα αλλαγμένα ονόματα!" #: tfrmopenwith.caption msgid "Choose an application" msgstr "Επιλέξτε μία εφαρμογή" #: tfrmopenwith.chkcustomcommand.caption msgid "Custom command" msgstr "Προσαρμοσμένη εντολή" #: tfrmopenwith.chksaveassociation.caption msgid "Save association" msgstr "Αποθήκευση συσχετισμού" #: tfrmopenwith.chkuseasdefault.caption msgid "Set selected application as default action" msgstr "Αποθήκευση της επιλεγμένης εφαρμογής ως εξ' ορισμού ενέργια" #: tfrmopenwith.lblmimetype.caption msgid "File type to be opened: %s" msgstr "Τύπος αρχείου προς άνοιγμα: %s" #: tfrmopenwith.milistoffiles.caption msgid "Multiple file names" msgstr "Πολλαπλά ονόματα αρχείων" #: tfrmopenwith.milistoffiles.hint msgid "%F" msgstr "%F" #: tfrmopenwith.milistofurls.caption msgid "Multiple URIs" msgstr "Πολλαπλά URIs" #: tfrmopenwith.milistofurls.hint msgid "%U" msgstr "%U" #: tfrmopenwith.misinglefilename.caption msgid "Single file name" msgstr "Μονό όνομα αρχείου" #: tfrmopenwith.misinglefilename.hint msgid "%f" msgstr "%f" #: tfrmopenwith.misingleurl.caption msgid "Single URI" msgstr "Μονό URI" #: tfrmopenwith.misingleurl.hint msgid "%u" msgstr "%u" #: tfrmoptions.btnapply.caption msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION" msgid "&Apply" msgstr "Εφαρμογή" #: tfrmoptions.btncancel.caption msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmoptions.btnok.caption msgctxt "TFRMOPTIONS.BTNOK.CAPTION" msgid "&OK" msgstr "OK" #: tfrmoptions.caption msgctxt "TFRMOPTIONS.CAPTION" msgid "Options" msgstr "Επιλογές" #: tfrmoptions.lblemptyeditor.caption msgid "Please select one of the subpages, this page does not contain any settings." msgstr "Παρακαλώ επιλέξτε μία από τις υποσελίδες, αυτή η σελίδα δεν περιέχει κάποιες ρυθμίσεις" #: tfrmoptionsarchivers.btnarchiveradd.caption msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption" msgid "A&dd" msgstr "Προσθήκη" #: tfrmoptionsarchivers.btnarchiveraddhelper.hint msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverapply.caption msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption" msgid "A&pply" msgstr "Εφαρμογή" #: tfrmoptionsarchivers.btnarchivercopy.caption msgid "Cop&y" msgstr "Αντιγραφή" #: tfrmoptionsarchivers.btnarchiverdelete.caption msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption" msgid "Delete" msgstr "Διαγραφή" #: tfrmoptionsarchivers.btnarchiverdeletehelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverextracthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverlisthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverother.caption msgid "Oth&er..." msgstr "Άλλοι..." #: tfrmoptionsarchivers.btnarchiverrelativer.hint msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmoptionsarchivers.btnarchiverrename.caption msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption" msgid "&Rename" msgstr "Μετονομασία" #: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchivertesthelper.hint msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.bvlarchiverids.caption msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption" msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:" msgstr "" #: tfrmoptionsarchivers.bvlarchiveroptions.caption msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption" msgid "Options:" msgstr "Επιλογές:" #: tfrmoptionsarchivers.bvlarchiverparsingmode.caption msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption" msgid "Format parsing mode:" msgstr "Λειτουργία ανάλυσης μορφής:" #: tfrmoptionsarchivers.chkarchiverenabled.caption msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption" msgid "E&nabled" msgstr "Ενεργοποιημένο" #: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption msgid "De&bug mode" msgstr "Λειτουργία Αποσφαλμάτωσης" #: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption" msgid "S&how console output" msgstr "Εμφάνιση αποτελέσματος στο τερματικό" #: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption msgid "Uni&x file attributes" msgstr "" #: tfrmoptionsarchivers.ckbarchiverunixpath.caption msgid "&Unix path delimiter \"/\"" msgstr "" #: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption msgid "Windows &file attributes" msgstr "" #: tfrmoptionsarchivers.ckbarchiverwindowspath.caption msgid "Windows path deli&miter \"\\\"" msgstr "" #: tfrmoptionsarchivers.lblarchiveradd.caption msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption" msgid "Add&ing:" msgstr "Προσθήκη:" #: tfrmoptionsarchivers.lblarchiverarchiver.caption msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption" msgid "Arc&hiver:" msgstr "Πρόγραμμα Συμπίεσης:" #: tfrmoptionsarchivers.lblarchiverdelete.caption msgid "De&lete:" msgstr "Διαγραφή:" #: tfrmoptionsarchivers.lblarchiverdescription.caption msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption" msgid "De&scription:" msgstr "Περιγραφή:" #: tfrmoptionsarchivers.lblarchiverextension.caption msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption" msgid "E&xtension:" msgstr "Επέκταση:" #: tfrmoptionsarchivers.lblarchiverextract.caption msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption" msgid "Ex&tract:" msgstr "Εξαγωγή:" #: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption msgid "Extract &without path:" msgstr "Εξαγωγή χωρίς διαδρομή:" #: tfrmoptionsarchivers.lblarchiveridposition.caption msgid "ID Po&sition:" msgstr "Θέση ID:" #: tfrmoptionsarchivers.lblarchiverids.caption msgid "&ID:" msgstr "ID:" #: tfrmoptionsarchivers.lblarchiveridseekrange.caption msgid "ID See&k Range:" msgstr "Διάστημα Αναζήτησης ID:" #: tfrmoptionsarchivers.lblarchiverlist.caption msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption" msgid "&List:" msgstr "Λίστα:" #: tfrmoptionsarchivers.lblarchiverlistbox.caption msgid "Archi&vers:" msgstr "Εφαρμογές Συμπίεσης:" #: tfrmoptionsarchivers.lblarchiverlistend.caption msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption" msgid "Listing &finish (optional):" msgstr "Λίστα και τέλος (προαιρετικά):" #: tfrmoptionsarchivers.lblarchiverlistformat.caption msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption" msgid "Listing for&mat:" msgstr "Μορφή Λίστας:" #: tfrmoptionsarchivers.lblarchiverliststart.caption msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption" msgid "Listin&g start (optional):" msgstr "Λίστα και εκκίνηση (προαιρετικά):" #: tfrmoptionsarchivers.lblarchiverpasswordquery.caption msgid "Password &query string:" msgstr "Γραμμή εισαγωγής συνθηματικού:" #: tfrmoptionsarchivers.lblarchiverselfextract.caption msgid "Create self extractin&g archive:" msgstr "Δημιουργία αυτοεξαγώμενου αρχείου:" #: tfrmoptionsarchivers.lblarchivertest.caption msgid "Tes&t:" msgstr "Test:" #: tfrmoptionsarchivers.miarchiverautoconfigure.caption msgid "Auto Configure" msgstr "Αυτόματη Διαμόρφωση" #: tfrmoptionsarchivers.miarchiverdisableall.caption msgid "Disable all" msgstr "" #: tfrmoptionsarchivers.miarchiverdiscardmodification.caption msgid "Discard modifications" msgstr "" #: tfrmoptionsarchivers.miarchiverenableall.caption msgid "Enable all" msgstr "" #: tfrmoptionsarchivers.miarchiverexport.caption msgctxt "tfrmoptionsarchivers.miarchiverexport.caption" msgid "Export..." msgstr "Εξαγωγή..." #: tfrmoptionsarchivers.miarchiverimport.caption msgctxt "tfrmoptionsarchivers.miarchiverimport.caption" msgid "Import..." msgstr "Εισάγετε..." #: tfrmoptionsarchivers.miarchiversortarchivers.caption msgid "Sort archivers" msgstr "" #: tfrmoptionsarchivers.tbarchiveradditional.caption msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION" msgid "Additional" msgstr "Επιπλέον:" #: tfrmoptionsarchivers.tbarchivergeneral.caption msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION" msgid "General" msgstr "Γενικά" #: tfrmoptionsautorefresh.cbwatchattributeschange.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION" msgid "When &size, date or attributes change" msgstr "Όταν μέγεθος, ημερομηνία ή ιδιότητες αλλάζουν" #: tfrmoptionsautorefresh.cbwatchexcludedirs.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION" msgid "For the following &paths and their subdirectories:" msgstr "Για τις ακόλουθες διαδρομές και τους υποκαταλόγους τους:" #: tfrmoptionsautorefresh.cbwatchfilenamechange.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION" msgid "When &files are created, deleted or renamed" msgstr "Όταν αρχεία δημιουργούνται, διαγράφονται ή μετονομάζονται" #: tfrmoptionsautorefresh.cbwatchonlyforeground.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION" msgid "When application is in the &background" msgstr "Όταν η εφαρμογή είναι στο &παρασκήνιο" #: tfrmoptionsautorefresh.gbautorefreshdisable.caption msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION" msgid "Disable auto-refresh" msgstr "Απενεργοποίηση αυτόματης ανανέωσης" #: tfrmoptionsautorefresh.gbautorefreshenable.caption msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION" msgid "Refresh file list" msgstr "Ανανέωση λίστας αρχείων" #: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION" msgid "Al&ways show tray icon" msgstr "Εμφάνιση πάντα εικονιδίου στο πλαίσιο συστήματος" #: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption msgid "Automatically &hide unmounted devices" msgstr "Αυτόματη απόκρυψη μη προσαρτημένων οδηγών" #: tfrmoptionsbehavior.cbminimizetotray.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION" msgid "Mo&ve icon to system tray when minimized" msgstr "Μετακίνηση εικονιδίου στο πλαίσιο συστήματος όταν γίνεται ελαχιστοποίηση" #: tfrmoptionsbehavior.cbonlyonce.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION" msgid "A&llow only one copy of DC at a time" msgstr "Επιτρέψτε μόνο ένα αντίγραφο του DC κάθε φορά" #: tfrmoptionsbehavior.edtdrivesblacklist.hint msgid "Here you can enter one or more drives or mount points, separated by \";\"." msgstr "Εδώ μπορείτε να εισάγετε έναν ή περισσότερους οδηγούς ή σημεία προσάρτησης, διαχωρισμένα με \";\"." #: tfrmoptionsbehavior.lbldrivesblacklist.caption msgid "Drives &blacklist" msgstr "Μαύρη Λίστα Οδηγών" #: tfrmoptionsbriefview.gbcolumns.caption msgid "Columns size" msgstr "Μέγεθος Στηλών" #: tfrmoptionsbriefview.gbshowfileext.caption msgid "Show file extensions" msgstr "Εμφάνιση επεκτάσεων αρχείου" #: tfrmoptionsbriefview.rbaligned.caption msgid "ali&gned (with Tab)" msgstr "Ευθυγραμμισμένο (με Καρτέλα)" #: tfrmoptionsbriefview.rbdirectly.caption msgid "di&rectly after filename" msgstr "Αμέσως μετά το όνομα αρχείου" #: tfrmoptionsbriefview.rbuseautosize.caption msgid "Auto" msgstr "Αυτόματα" #: tfrmoptionsbriefview.rbusefixedcount.caption msgid "Fixed columns count" msgstr "Σταθερή Άθροιση Στηλών" #: tfrmoptionsbriefview.rbusefixedwidth.caption msgid "Fixed columns width" msgstr "Σταθερό Πλάτος Στηλών" #: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption msgid "Cut &text to column width" msgstr "Αποκοπή κειμένου στο πλάτος της στήλης" #: tfrmoptionscolumnsview.cbextendcellwidth.caption msgid "&Extend cell width if text is not fitting into column" msgstr "Άυξηση πλάτους κελιού αν το κείμενο δε χωραέι στη στήλη" #: tfrmoptionscolumnsview.cbgridhorzline.caption msgid "&Horizontal lines" msgstr "Οριζόντιες γραμμές" #: tfrmoptionscolumnsview.cbgridvertline.caption msgid "&Vertical lines" msgstr "Κάθετες γραμμές" #: tfrmoptionscolumnsview.chkautofillcolumns.caption msgid "A&uto fill columns" msgstr "Αυτόματη συμπλήρωση στηλών" #: tfrmoptionscolumnsview.gbshowgrid.caption msgid "Show grid" msgstr "Εμφάνιση πλέγματος" #: tfrmoptionscolumnsview.grpautosizecolumns.caption msgid "Auto-size columns" msgstr "Αυτόματη Ρύθμιση Μεγέθους Στηλών" #: tfrmoptionscolumnsview.lblautosizecolumn.caption msgid "Auto si&ze column:" msgstr "Αυτόματη προσαρμογή μεγέθους στήλης:" #: tfrmoptionsconfiguration.btnconfigapply.caption msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION" msgid "A&pply" msgstr "Εφαρμογή" #: tfrmoptionsconfiguration.btnconfigedit.caption msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION" msgid "&Edit" msgstr "Επεξεργασία" #: tfrmoptionsconfiguration.cbcmdlinehistory.caption msgid "Co&mmand line history" msgstr "Ιστορικό Γραμμής Εντολών" #: tfrmoptionsconfiguration.cbdirhistory.caption msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION" msgid "&Directory history" msgstr "Ιστορικό Καταλόγου" #: tfrmoptionsconfiguration.cbfilemaskhistory.caption msgid "&File mask history" msgstr "Ιστορικό μάσκας αρχείου" #: tfrmoptionsconfiguration.chksaveconfiguration.caption msgid "Sa&ve configuration" msgstr "Αποθήκευση Ρυθμίσεων" #: tfrmoptionsconfiguration.chksearchreplacehistory.caption msgid "Searc&h/Replace history" msgstr "Αναζήτηση/Αντικατάσταση Ιστορικό" #: tfrmoptionsconfiguration.gbdirectories.caption msgctxt "tfrmoptionsconfiguration.gbdirectories.caption" msgid "Directories" msgstr "Κατάλογοι" #: tfrmoptionsconfiguration.gblocconfigfiles.caption msgid "Location of configuration files" msgstr "Τοποθεσία των αρχείων επεξεργασίας" #: tfrmoptionsconfiguration.gbsaveonexit.caption msgid "Save on exit" msgstr "Αποθήκευση κατά την έξοδο" #: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption msgid "Sort order of configuration order in left tree" msgstr "Καθορισμός σειράς της σειράς ρύθμισης στο αριστερό δέντρο" #: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption msgid "Set on command line" msgstr "Καθορισμός στη γραμμή εντολών" #: tfrmoptionsconfiguration.lblhighlighters.caption msgid "Highlighters:" msgstr "" #: tfrmoptionsconfiguration.lbliconthemes.caption msgid "Icon themes:" msgstr "Θέμα εικονιδίων:" #: tfrmoptionsconfiguration.lblthumbcache.caption msgid "Thumbnails cache:" msgstr "Μνήμη Μικρογραφιών:" #: tfrmoptionsconfiguration.rbprogramdir.caption msgid "P&rogram directory (portable version)" msgstr "Κατάλογος Προγράμματος (φορητή έκδοση)" #: tfrmoptionsconfiguration.rbuserhomedir.caption msgid "&User home directory" msgstr "Αρχικός Κατάλογος Χρήστη" #: tfrmoptionscustomcolumns.btnallallowovercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallallowovercolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallbackcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallbackcolor2.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallcursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallcursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallcursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallcursortext.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallfont.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFONT.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallfont.hint msgctxt "tfrmoptionscustomcolumns.btnallfont.hint" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallforecolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnallmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnallmarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION" msgid "All" msgstr "Όλα" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT" msgid "Apply modification to all columns" msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες" #: tfrmoptionscustomcolumns.btnbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursorbordercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORBORDERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION" msgid "&Delete" msgstr "Διαγραφή" #: tfrmoptionscustomcolumns.btnfont.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionscustomcolumns.btnforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btngotosetdefault.caption msgid "Go to set default" msgstr "Μετάβαση στον ορισμό προκαθορισμένου" #: tfrmoptionscustomcolumns.btngotosetdefault.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btninactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btninactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnnewconfig.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION" msgid "New" msgstr "Νέο" #: tfrmoptionscustomcolumns.btnnext.caption msgid "Next" msgstr "Επόμενο" #: tfrmoptionscustomcolumns.btnprev.caption msgid "Previous" msgstr "Προηγούμενο" #: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION" msgid "Rename" msgstr "Μετονομασία" #: tfrmoptionscustomcolumns.btnresetallowovercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetallowovercolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetbackcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetbackcolor2.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetcursorborder.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORBORDER.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursorborder.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetcursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetcursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursortext.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetfont.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetfont.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetforecolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetframecursor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetframecursor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetmarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT" msgid "Reset to default" msgstr "Επαναφορά στη προεπιλογή" #: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION" msgid "Save as" msgstr "Αποθήκευση ως" #: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION" msgid "Save" msgstr "Αποθήκευση" #: tfrmoptionscustomcolumns.cballowovercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBALLOWOVERCOLOR.CAPTION" msgid "Allow Overcolor" msgstr "Επιτρέψτε Επιχρωμάτωση" #: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption msgid "When clicking to change something, change for all columns" msgstr "Όταν γίνεται κλικ για κάποια αλλαγή, εφαρμογή της αλλαγής σε όλες τις στήλες" #: tfrmoptionscustomcolumns.cbconfigcolumns.text msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT" msgid "General" msgstr "Γενικά" #: tfrmoptionscustomcolumns.cbcursorborder.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCURSORBORDER.CAPTION" msgid "Cursor border" msgstr "Όρια κέρσορα" #: tfrmoptionscustomcolumns.cbuseframecursor.caption msgid "Use Frame Cursor" msgstr "Χρήση Κέρσορα Πλαισίου" #: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption msgid "Use Inactive Selection Color" msgstr "Χρήση Ανενεργού Χρώματος Επιλογής" #: tfrmoptionscustomcolumns.cbuseinvertedselection.caption msgid "Use Inverted Selection" msgstr "Χρήση Ανάστροφης Επιλογής" #: tfrmoptionscustomcolumns.chkusecustomview.caption msgid "Use custom font and color for this view" msgstr "Χρήση προσαρμοσμένης γραμματοσειράς και χρώματος για αυτή την προβολή" #: tfrmoptionscustomcolumns.lblbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLBACKCOLOR.CAPTION" msgid "BackGround:" msgstr "Παρασκήνιο:" #: tfrmoptionscustomcolumns.lblbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLBACKCOLOR2.CAPTION" msgid "Background 2:" msgstr "Παρασκήνιο 2:" #: tfrmoptionscustomcolumns.lblconfigcolumns.caption msgid "Con&figure columns view:" msgstr "Ρυθμίστε την προβολή στηλών:" #: tfrmoptionscustomcolumns.lblcurrentcolumn.caption msgid "[Current Column Name]" msgstr "[Όνομα Τρέχουσας Στήλης]" #: tfrmoptionscustomcolumns.lblcursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCURSORCOLOR.CAPTION" msgid "Cursor Color:" msgstr "Χρώμα Κέρσορα" #: tfrmoptionscustomcolumns.lblcursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCURSORTEXT.CAPTION" msgid "Cursor Text:" msgstr "Κείμενο Κέρσορα" #: tfrmoptionscustomcolumns.lblfontname.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTNAME.CAPTION" msgid "Font:" msgstr "Γραμματοσειρά:" #: tfrmoptionscustomcolumns.lblfontsize.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION" msgid "Size:" msgstr "Μέγεθος:" #: tfrmoptionscustomcolumns.lblforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFORECOLOR.CAPTION" msgid "Text Color:" msgstr "Χρώμα Κειμένου:" #: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption" msgid "Inactive Cursor Color:" msgstr "Ανενεργό Χρώμα Κέρσορα:" #: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption" msgid "Inactive Mark Color:" msgstr "Χρώμα Ανενεργού Επιλογέα:" #: tfrmoptionscustomcolumns.lblmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLMARKCOLOR.CAPTION" msgid "Mark Color:" msgstr "Χρώμα Επιλογέα:" #: tfrmoptionscustomcolumns.lblpreviewtop.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLPREVIEWTOP.CAPTION" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "Παρακάτω είναι μία προεπισκόπηση. Μπορείται να μετακινήσετε τον κέρσορα και να επιλέξετε αρχεία ώστε να έχετε άμεσα μία πραγματική εικόνα και αίσθηση των διαφόρων ρυθμίσεων." #: tfrmoptionscustomcolumns.lblworkingcolumn.caption msgid "Settings for column:" msgstr "Ρυθμίσεις για στήλη:" #: tfrmoptionscustomcolumns.miaddcolumn.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.MIADDCOLUMN.CAPTION" msgid "Add column" msgstr "Προσθήκη στήλης" #: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption msgid "Position of frame panel after the comparison:" msgstr "Θέση του πάνελ πλαισίου μετά την σύγκριση:" #: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption msgid "Add directory of the &active frame" msgstr "Προσθήκη καταλόγου του ενεργού πλαισίου" #: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption msgid "Add &directories of the active && inactive frames" msgstr "Προσθήκη καταλόγων των ενεργών && ανενεργών πλαισίων" #: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption msgid "Add directory I will bro&wse to" msgstr "Προσθήκη καταλόγου στην οποία θα γίνει πλοήγηση" #: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption msgid "Add a copy of the selected entry" msgstr "Προσθήκη ενός αντιγράφου της επιλεγμένης καταχώρισης" #: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption msgid "Add current &selected or active directories of active frame" msgstr "Προσθήκη τρεχόντων επιλεγμένων ή ενεργών καταλόγων του ενεργού πλαισίου" #: tfrmoptionsdirectoryhotlist.actaddseparator.caption msgid "Add a separator" msgstr "Προσθήκη ενός διαχωριστικού" #: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption msgid "Add a sub menu" msgstr "Προσθήκη ενός υπομενού" #: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption" msgid "Add directory I will type" msgstr "Προσθήκη καταλόγου που θα πληκτρολογήσω" #: tfrmoptionsdirectoryhotlist.actcollapseall.caption msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption" msgid "Collapse all" msgstr "Σύμπτυξη όλων" #: tfrmoptionsdirectoryhotlist.actcollapseitem.caption msgid "Collapse item" msgstr "Σύμπτυξη αντικειμένου" #: tfrmoptionsdirectoryhotlist.actcut.caption msgid "Cut selection of entries" msgstr "Αποκοπή επιλογής καταχωρήσεων" #: tfrmoptionsdirectoryhotlist.actdeleteall.caption msgid "Delete all!" msgstr "Διαγραφή όλων!" #: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption" msgid "Delete selected item" msgstr "Διαγραφή επιλεγμένου αντικειμένου" #: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption msgid "Delete sub-menu and all its elements" msgstr "Διαγραφή υπομενού με όλα του τα στοιχεία" #: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption msgid "Delete just sub-menu but keep elements" msgstr "Διαγραφή μόνο του υπομενού αλλά διατήρηση των στοιχείων" #: tfrmoptionsdirectoryhotlist.actexpanditem.caption msgid "Expand item" msgstr "Ανάπτυξη αντικειμένου" #: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption msgid "Focus tree window" msgstr "Εστίαση στο παράθυρο δέντρου" #: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption msgid "Goto first item" msgstr "Μετάβαση στο πρώτο αντικείμενο" #: tfrmoptionsdirectoryhotlist.actgotolastitem.caption msgid "Goto last item" msgstr "Μετάβαση στο τελευταίο αντικείμενο" #: tfrmoptionsdirectoryhotlist.actgotonextitem.caption msgid "Go to next item" msgstr "Μετάβαση στο επόμενο αντικείμενο" #: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption msgid "Go to previous item" msgstr "Μετάβαση στο προηγούμενο αντικείμενο" #: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption msgid "Insert directory of the &active frame" msgstr "Εισαγωγή καταλόγου του ενεργού πλαισίου" #: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption msgid "Insert &directories of the active && inactive frames" msgstr "Εισαγωγή καταλόγων των ενεργών && ανενεργών πλαισίων" #: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption msgid "Insert directory I will bro&wse to" msgstr "Εισαγωγή καταλόγου όπου θα γίνει πλοήγηση" #: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption msgid "Insert a copy of the selected entry" msgstr "Εισαγωγή ενός αντιγράφου της επιλεγμένης καταχώρησης" #: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption msgid "Insert current &selected or active directories of active frame" msgstr "Εισαγωγή του τρέχοντος επιλεγμένου ή ενεργού καταλόγου του ενεργού πλαισίου" #: tfrmoptionsdirectoryhotlist.actinsertseparator.caption msgid "Insert a separator" msgstr "Εισαγωγή διαχωριστικού" #: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption msgid "Insert sub menu" msgstr "Εισαγωγή υπομενού" #: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption" msgid "Insert directory I will type" msgstr "Εισαγωγή καταλόγου που θα πληκτρολογήσω" #: tfrmoptionsdirectoryhotlist.actmovetonext.caption msgid "Move to next" msgstr "Μετακίνηση στο επόμενο" #: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption msgid "Move to previous" msgstr "Μετακίνηση στο προηγούμενο" #: tfrmoptionsdirectoryhotlist.actopenallbranches.caption msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption" msgid "Open all branches" msgstr "Άνοιγμα όλων των κλάδων" #: tfrmoptionsdirectoryhotlist.actpaste.caption msgid "Paste what was cut" msgstr "Επικόλληση αυτού που είχε αποκοπεί" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption msgid "Search && replace in &path" msgstr "Αναζήτηση &&αντικατάσταση στη διαδρομή" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption msgid "Search && replace in both path and target" msgstr "Αναζήτηση &&αντικατάσταση ταυτόχρονα σε διαδρομή και στόχο" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption msgid "Search && replace in &target path" msgstr "Αναζήτηση &&αντικατάσταση στη διαδρομή στόχου" #: tfrmoptionsdirectoryhotlist.acttweakpath.caption msgid "Tweak path" msgstr "Προσαρμογή διαδρομής" #: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption msgid "Tweak target path" msgstr "Προσαρμογή διαδρομής στόχου" #: tfrmoptionsdirectoryhotlist.btnadd.caption msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption" msgid "A&dd..." msgstr "Προσθήκη..." #: tfrmoptionsdirectoryhotlist.btnbackup.caption msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption" msgid "Bac&kup..." msgstr "Αντίγραφο Ασφαλείας..." #: tfrmoptionsdirectoryhotlist.btndelete.caption msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption" msgid "De&lete..." msgstr "Διαγραφή..." #: tfrmoptionsdirectoryhotlist.btnexport.caption msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption" msgid "E&xport..." msgstr "Εξαγωγή..." #: tfrmoptionsdirectoryhotlist.btnhelp.caption msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption" msgid "&Help" msgstr "Βοήθεια" #: tfrmoptionsdirectoryhotlist.btnimport.caption msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption" msgid "Impo&rt..." msgstr "Εισαγωγή..." #: tfrmoptionsdirectoryhotlist.btninsert.caption msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption" msgid "&Insert..." msgstr "Εισάγετε..." #: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption msgid "&Miscellaneous..." msgstr "Διάφορα..." #: tfrmoptionsdirectoryhotlist.btnrelativepath.hint msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVETARGET.HINT" msgid "Some functions to select appropriate target" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλου στόχου" #: tfrmoptionsdirectoryhotlist.btnsort.caption msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption" msgid "&Sort..." msgstr "Ταξινόμηση..." #: tfrmoptionsdirectoryhotlist.cbaddtarget.caption msgid "&When adding directory, add also target" msgstr "Κατά την προσθήκη καταλόγου, προσθήκη επίσης στόχου" #: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption" msgid "Alwa&ys expand tree" msgstr "Ανάπτυξη Δέντρου Πάντα" #: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption msgid "Show only &valid environment variables" msgstr "Εμφάνιση μόνο έγκυρων μεταβλητών περιβάλλοντος" #: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption msgid "In pop&up, show [path also]" msgstr "Στο αναδυόμενο παράθυρο, εμφάνιση [διαδρομής επίσης]" #: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRPATH.TEXT" msgid "Name, a-z" msgstr "Όνομα, α-ω" #: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT" msgid "Name, a-z" msgstr "Όνομα, α-ω" #: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption msgid "Directory Hotlist (reorder by drag && drop)" msgstr "Κατάλογος Hotlist (αναδιάταξη με μεταφορά && απόθεση)" #: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption" msgid "Other options" msgstr "Άλλες Επιλογές" #: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION" msgid "Name:" msgstr "Όνομα:" #: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION" msgid "Path:" msgstr "Διαδρομή:" #: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRTARGET.EDITLABEL.CAPTION" msgid "&Target:" msgstr "Στόχος:" #: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption" msgid "...current le&vel of item(s) selected only" msgstr "...τρέχον επίπεδο του επιλεγμένου αρχείου(ων) μόνο" #: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHEXIST.CAPTION" msgid "Scan all &hotdir's path to validate the ones that actually exist" msgstr "Σάρωση όλων των διαδρομών των hotdir για επικύρωση αυτών που πραγματικά υπάρχουν" #: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHTARGETEXIST.CAPTION" msgid "&Scan all hotdir's path && target to validate the ones that actually exist" msgstr "Σάρωση όλων των διαδρομών των hotdir και στόχων για επικύρωση αυτών που πραγματικά υπάρχουν" #: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption msgid "to a Directory &Hotlist file (.hotlist)" msgstr "σε ένα αρχείου καταλόγου Hotlist (.hotlist)" #: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption" msgid "to a \"wincmd.ini\" of TC (&keep existing)" msgstr "σε ένα \"wincmd.ini\" του TC (διατήρηση υπάρχοντος)" #: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption" msgid "to a \"wincmd.ini\" of TC (&erase existing)" msgstr "σε ένα \"wincmd.ini\" του TC (διαγραφή υπάρχοντος)" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption" msgid "Go to &configure TC related info" msgstr "Μετάβαση σε διαμόρφωση πληροφοριών σχετικές με TC" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION" msgid "Go to &configure TC related info" msgstr "Μετάβαση σε διαμόρφωση πληροφοριών σχετικές με TC" #: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption msgid "HotDirTestMenu" msgstr "HotDirΜενούΔοκιμών" #: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption msgid "from a Directory &Hotlist file (.hotlist)" msgstr "Από ένα αρχείο καταλόγου Hotlist (.hotlist)" #: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption msgid "from \"&wincmd.ini\" of TC" msgstr "Από \"wincmd.ini\" του TC" #: tfrmoptionsdirectoryhotlist.minavigate.caption msgid "&Navigate..." msgstr "Πλοήγηση..." #: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption msgid "&Restore a backup of Directory Hotlist" msgstr "Επαναφορά ενός αντιγράφου ασφαλείας της Hotlist Καταλόγων" #: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption msgid "&Save a backup of current Directory Hotlist" msgstr "Αποθήκευση ενός αντιγράφου ασφαλείας της τρέχουσας Hotlist Καταλόγων" #: tfrmoptionsdirectoryhotlist.misearchandreplace.caption msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption" msgid "Search and &replace..." msgstr "Αναζήτηση και αντικατάσταση..." #: tfrmoptionsdirectoryhotlist.misorteverything.caption msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption" msgid "...everything, from A to &Z!" msgstr "...όλα, από το Α ως το Ω!" #: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption" msgid "...single &group of item(s) only" msgstr "...μονό γκρουπ από αντικείμενο(α) μόνο" #: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption" msgid "...&content of submenu(s) selected, no sublevel" msgstr "...περιεχόμενα ενός ( ή πολλών) υπομενού επιλεγμένα, όχι δευτερεύοντα επίπεδα" #: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption" msgid "...content of submenu(s) selected and &all sublevels" msgstr "...περιεχόμενα του(των) υπομενού επιλεγμένα και όλων των δευτερευόντων επιπέδων" #: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MITESTRESULTINGHOTLISTMENU.CAPTION" msgid "Test resultin&g menu" msgstr "Μενού αποτελεσμάτων Δοκιμών" #: tfrmoptionsdirectoryhotlist.mitweakpath.caption msgid "Tweak &path" msgstr "Προσαρμογή διαδρομής" #: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption msgid "Tweak &target path" msgstr "Προσαρμογή διαδρομής στόχου" #: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption msgid "Addition from main panel" msgstr "Προσθήκη από το κύριο πάνελ:" #: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption msgid "From all the supported formats, ask which one to use every time" msgstr "Από όλες τις υποστηριζόμενες μορφές, ερώτηση για ποια θα χρησιμοποιηθεί κάθε φορά" #: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)" msgstr "Κατά την αποθήκευση κειμένου Unicode, αποθήκευση σε μορφή UTF8 (αλλιώς θα είναι σε μορφή UTF16)" #: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption msgid "When dropping text, generate filename automatically (otherwise will prompt the user)" msgstr "Όταν γίνεται εναπόθεση κειμένου, δημιουργία ονόματος κειμένου αυτόματα (αλλιώς θα ερωτηθεί ο χρήστης)" #: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption msgid "&Show confirmation dialog after drop" msgstr "Εμφάνιση διαλόγου επιβεβαίωσης μετά την απόθεση" #: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption msgid "When drag && dropping text into panels:" msgstr "Όταν μεταφέρεται και αποτίθεται κείμενο στα πάνελ:" #: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption msgid "Place the most desired format on top of list (use dag && drop):" msgstr "Τοποθετείστε την πιο επιθυμητή μορφή στην κορυφή της λίστας (χρήση μεταφοράς και απόθεσης)" #: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption msgid "(if the most desired is not present, we'll take second one and so on)" msgstr "(αν η πιο επιθυμητή δεν είναι παρούσα, θα χρησιμοποιηθεί η δεύτερη και ούτω καθεξής)" #: tfrmoptionsdragdrop.lblwarningforaskformat.caption msgid "(will not work with some source application, so try to uncheck if problem)" msgstr "(δεν θα λειτουργήσει με μερικές εφαρμογές, οπότε δοκιμάστε να το αποεπιλέξετε αν υπάρχει πρόβλημα)" #: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption msgid "Show &file system" msgstr "Εμφάνιση συστήματος αρχείων" #: tfrmoptionsdriveslistbutton.cbshowfreespace.caption msgid "Show fr&ee space" msgstr "Εμφάνιση Ελεύθερου διαστήματος" #: tfrmoptionsdriveslistbutton.cbshowlabel.caption msgid "Show &label" msgstr "Εμφάνιση ετικέτας" #: tfrmoptionsdriveslistbutton.gbdriveslist.caption msgid "Drives list" msgstr "Λίστα Οδηγών" #: tfrmoptionseditor.chkautoindent.caption msgid "Auto Indent" msgstr "" #: tfrmoptionseditor.chkautoindent.hint msgid "Allows to indent the caret, when new line is created with , with the same amount of leading white space as the preceding line" msgstr "" #: tfrmoptionseditor.chkscrollpastendline.caption msgid "Caret past end of line" msgstr "Κέρσορας μετά το τέλος γραμμής" #: tfrmoptionseditor.chkscrollpastendline.hint msgid "Allows caret to go into empty space beyond end-of-line position" msgstr "" #: tfrmoptionseditor.chkshowspecialchars.caption msgid "Show special characters" msgstr "Εμφάνιση ειδικών χαρακτήρων" #: tfrmoptionseditor.chkshowspecialchars.hint msgid "Shows special characters for spaces and tabulations" msgstr "" #: tfrmoptionseditor.chktabindent.caption msgid "Tab indents blocks" msgstr "" #: tfrmoptionseditor.chktabindent.hint msgid "When active and act as block indent, unindent when text is selected" msgstr "" #: tfrmoptionseditor.chktabstospaces.caption msgid "Use spaces instead tab characters" msgstr "" #: tfrmoptionseditor.chktabstospaces.hint msgid "Converts tab characters to a specified number of space characters (when entering)" msgstr "" #: tfrmoptionseditor.chktrimtrailingspaces.caption msgid "Delete trailing spaces" msgstr "" #: tfrmoptionseditor.chktrimtrailingspaces.hint msgid "Auto delete trailing spaces, this applies only to edited lines" msgstr "" #: tfrmoptionseditor.gbinternaleditor.caption msgid "Internal editor options" msgstr "Ιδιότητες Εσωτερικού επεξεργαστή" #: tfrmoptionseditorcolors.backgroundlabel.caption msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption" msgid "Bac&kground" msgstr "Παρασκήνιο" #: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION" msgid "Bac&kground" msgstr "Παρασκήνιο" #: tfrmoptionseditorcolors.btnresetmask.hint msgid "Reset" msgstr "Επαναφορά" #: tfrmoptionseditorcolors.btnsavemask.hint msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT" msgid "Save" msgstr "Αποθήκευση" #: tfrmoptionseditorcolors.bvlattributesection.caption msgid "Element Attributes" msgstr "Ιδιότητες Στοιχείων" #: tfrmoptionseditorcolors.foregroundlabel.caption msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption" msgid "Fo®round" msgstr "Προσκήνιο" #: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION" msgid "Fo®round" msgstr "Προσκήνιο" #: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption msgid "&Text-mark" msgstr "Επιλογέας κειμένου" #: tfrmoptionseditorcolors.tbtnglobal.caption msgid "Use (and edit) &global scheme settings" msgstr "Χρήση (και διαμόρφωση) ρυθμίσεων του ολικού σχήματος" #: tfrmoptionseditorcolors.tbtnlocal.caption msgid "Use &local scheme settings" msgstr "Χρήση τοπικών ρυθμίσεων σχήματος" #: tfrmoptionseditorcolors.textboldcheckbox.caption msgid "&Bold" msgstr "Έντονη Γραφή" #: tfrmoptionseditorcolors.textboldradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION" msgid "In&vert" msgstr "Αναστροφή" #: tfrmoptionseditorcolors.textboldradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION" msgid "O&ff" msgstr "Κλειστό" #: tfrmoptionseditorcolors.textboldradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION" msgid "O&n" msgstr "Ανοικτό" #: tfrmoptionseditorcolors.textitaliccheckbox.caption msgid "&Italic" msgstr "Πλάγια" #: tfrmoptionseditorcolors.textitalicradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION" msgid "In&vert" msgstr "Αναστροφή" #: tfrmoptionseditorcolors.textitalicradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION" msgid "O&ff" msgstr "Κλειστό" #: tfrmoptionseditorcolors.textitalicradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION" msgid "O&n" msgstr "Ανοικτό" #: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption msgid "&Strike Out" msgstr "Μεσογράμμιση" #: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION" msgid "In&vert" msgstr "Αναστροφή" #: tfrmoptionseditorcolors.textstrikeoutradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION" msgid "O&ff" msgstr "Κλειστό" #: tfrmoptionseditorcolors.textstrikeoutradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION" msgid "O&n" msgstr "Ανοικτό" #: tfrmoptionseditorcolors.textunderlinecheckbox.caption msgid "&Underline" msgstr "Υπογράμμιση" #: tfrmoptionseditorcolors.textunderlineradioinvert.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption" msgid "In&vert" msgstr "Αναστροφή" #: tfrmoptionseditorcolors.textunderlineradiooff.caption msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption" msgid "O&ff" msgstr "Κλειστό" #: tfrmoptionseditorcolors.textunderlineradioon.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption" msgid "O&n" msgstr "Ανοικτό" #: tfrmoptionsfavoritetabs.btnadd.caption msgctxt "tfrmoptionsfavoritetabs.btnadd.caption" msgid "Add..." msgstr "Προσθήκη..." #: tfrmoptionsfavoritetabs.btndelete.caption msgctxt "tfrmoptionsfavoritetabs.btndelete.caption" msgid "Delete..." msgstr "Διαγραφή..." #: tfrmoptionsfavoritetabs.btnimportexport.caption msgid "Import/Export" msgstr "Εισαγωγή/Εξαγωγή" #: tfrmoptionsfavoritetabs.btninsert.caption msgctxt "tfrmoptionsfavoritetabs.btninsert.caption" msgid "Insert..." msgstr "Εισάγετε..." #: tfrmoptionsfavoritetabs.btnrename.caption msgctxt "tfrmoptionsfavoritetabs.btnrename.caption" msgid "Rename" msgstr "Μετονομασία" #: tfrmoptionsfavoritetabs.btnsort.caption msgctxt "tfrmoptionsfavoritetabs.btnsort.caption" msgid "Sort..." msgstr "Ταξινόμηση..." #: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text" msgid "None" msgstr "Κανένα" #: tfrmoptionsfavoritetabs.cbfullexpandtree.caption msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption" msgid "Always expand tree" msgstr "Ανάπτυξη Δέντρου Πάντα" #: tfrmoptionsfavoritetabs.cbsavedirhistory.text msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text" msgid "No" msgstr "Όχι" #: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text" msgid "Left" msgstr "Αριστερά" #: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text" msgid "Right" msgstr "Δεξιά" #: tfrmoptionsfavoritetabs.gbfavoritetabs.caption msgid "Favorite Tabs list (reorder by drag && drop)" msgstr "Λίστα Αγαπημένων Καρτελών (αναδιάταξη με μεταφορά && απόθεση)" #: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption" msgid "Other options" msgstr "Άλλες Επιλογές" #: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption msgid "What to restore where for the selected entry:" msgstr "Τι να αποκατασταθεί που για την επιλεγμένη καταχώρηση:" #: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption msgid "Existing tabs to keep:" msgstr "Υπάρχουσες καρτέλες προς φύλαξη:" #: tfrmoptionsfavoritetabs.lblsavedirhistory.caption msgid "Save dir history:" msgstr "Αποθήκευση ιστορικού καταλόγου:" #: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption msgid "Tabs saved on left to be restored to:" msgstr "Καρτέλες αποθηκευμένες αριστερά να αποκατασταθούν σε :" #: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption msgid "Tabs saved on right to be restored to:" msgstr "Καρτέλες αποθηκευμένες δεξιά να αποκατασταθούν σε :" #: tfrmoptionsfavoritetabs.menuitem1.caption msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.menuitem2.caption msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miaddseparator.caption msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption" msgid "a separator" msgstr "ένα διαχωριστικό" #: tfrmoptionsfavoritetabs.miaddseparator2.caption msgid "Add separator" msgstr "Προσθήκη διαχωριστικού" #: tfrmoptionsfavoritetabs.miaddsubmenu.caption msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption" msgid "sub-menu" msgstr "υπομενού" #: tfrmoptionsfavoritetabs.miaddsubmenu2.caption msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption" msgid "Add sub-menu" msgstr "Προσθήκη υπο-μενού" #: tfrmoptionsfavoritetabs.micollapseall.caption msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption" msgid "Collapse all" msgstr "Σύμπτυξη όλων" #: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption" msgid "...current level of item(s) selected only" msgstr "...τρέχον επίπεδο του επιλεγμένου αρχείου(ων) μόνο" #: tfrmoptionsfavoritetabs.micutselection.caption msgctxt "tfrmoptionsfavoritetabs.micutselection.caption" msgid "Cut" msgstr "Αποκοπή" #: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption" msgid "delete all!" msgstr "Διαγραφή Όλων!" #: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption" msgid "sub-menu and all its elements" msgstr "Υπομενού με όλα του τα στοιχεία" #: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption" msgid "just sub-menu but keep elements" msgstr "μόνο υπομενού αλλά διατήρηση των στοιχείων" #: tfrmoptionsfavoritetabs.mideleteselectedentry.caption msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption" msgid "selected item" msgstr "επιλεγμένο αντικείμενο" #: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption" msgid "Delete selected item" msgstr "Διαγραφή επιλεγμένου αντικειμένου" #: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption msgid "Export selection to legacy .tab file(s)" msgstr "Εξαγωγή επιλογής στο legacy .tab αρχείο(α)" #: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption msgid "FavoriteTabsTestMenu" msgstr "ΑγαπημένεςΚαρτέλεςΤεστΜενού" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption msgid "Import legacy .tab file(s) according to default setting" msgstr "Εισαγωγή legacy .tab αρχείου(ων) βάσει της προκαθορισμένης ρύθμισης" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption" msgid "Import legacy .tab file(s) at selected position" msgstr "Εισαγωγή legacy .tab αρχείου(ων) στην επιλεγμένη θέση" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption" msgid "Import legacy .tab file(s) at selected position" msgstr "Εισαγωγή legacy .tab αρχείου(ων) στην επιλεγμένη θέση" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption msgid "Import legacy .tab file(s) at selected position in a sub menu" msgstr "Εισαγωγή legacy .tab αρχείου(ων) στην επιλεγμένη θέση σε ένα υπομενού" #: tfrmoptionsfavoritetabs.miinsertseparator.caption msgid "Insert separator" msgstr "Εισαγωγή διαχωριστικού" #: tfrmoptionsfavoritetabs.miinsertsubmenu.caption msgid "Insert sub-menu" msgstr "Εισαγωγή υπο-μενού" #: tfrmoptionsfavoritetabs.miopenallbranches.caption msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption" msgid "Open all branches" msgstr "Άνοιγμα όλων των κλάδων" #: tfrmoptionsfavoritetabs.mipasteselection.caption msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption" msgid "Paste" msgstr "Επικόλληση" #: tfrmoptionsfavoritetabs.mirename.caption msgctxt "tfrmoptionsfavoritetabs.mirename.caption" msgid "Rename" msgstr "Μετονομασία" #: tfrmoptionsfavoritetabs.miseparator1.caption msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator10.caption msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator11.caption msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator2.caption msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator3.caption msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator7.caption msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator8.caption msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator9.caption msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.misorteverything.caption msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption" msgid "...everything, from A to Z!" msgstr "...όλα, από το Α ως το Ω!" #: tfrmoptionsfavoritetabs.misortsinglegroup.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption" msgid "...single group of item(s) only" msgstr "...μονό γκρουπ από αντικείμενο(α) μόνο" #: tfrmoptionsfavoritetabs.misortsinglegroup2.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption" msgid "Sort single group of item(s) only" msgstr "Ταξινόμηση μονού γκρουπ από αντικείμενο(α) μόνο" #: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption" msgid "...content of submenu(s) selected, no sublevel" msgstr "...περιεχόμενα ενός ( ή πολλών) υπομενού επιλεγμένα, όχι δευτερεύοντα επίπεδα" #: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption" msgid "...content of submenu(s) selected and all sublevels" msgstr "...περιεχόμενα του(των) υπομενού επιλεγμένα και όλων των δευτερευόντων επιπέδων" #: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption" msgid "Test resulting menu" msgstr "Μενού αποτελεσμάτων Δοκιμών" #: tfrmoptionsfileassoc.btnaddact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNADDACT.CAPTION" msgid "Add" msgstr "Προσθήκη" #: tfrmoptionsfileassoc.btnaddext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION" msgid "&Add" msgstr "Προσθήκη" #: tfrmoptionsfileassoc.btnaddnewtype.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION" msgid "A&dd" msgstr "Προσθήκη" #: tfrmoptionsfileassoc.btncloneact.caption msgid "Clone" msgstr "Κλωνοποίηση" #: tfrmoptionsfileassoc.btndownact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNDOWNACT.CAPTION" msgid "&Down" msgstr "Κάτω" #: tfrmoptionsfileassoc.btneditext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION" msgid "Edit" msgstr "Επεξεργασία" #: tfrmoptionsfileassoc.btninsertact.caption msgctxt "tfrmoptionsfileassoc.btninsertact.caption" msgid "Insert" msgstr "Εισάγετε" #: tfrmoptionsfileassoc.btninsertext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION" msgid "Insert" msgstr "Εισάγετε" #: tfrmoptionsfileassoc.btnremoveact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVEACT.CAPTION" msgid "Remo&ve" msgstr "Αφαίρεση" #: tfrmoptionsfileassoc.btnremoveext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVEEXT.CAPTION" msgid "Re&move" msgstr "Αφαίρεση" #: tfrmoptionsfileassoc.btnremovetype.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION" msgid "&Remove" msgstr "Αφαίρεση" #: tfrmoptionsfileassoc.btnrenametype.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNRENAMETYPE.CAPTION" msgid "R&ename" msgstr "Μετονομασία" #: tfrmoptionsfileassoc.btnupact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION" msgid "&Up" msgstr "Πάνω" #: tfrmoptionsfileassoc.destartpath.hint msgid "Starting path of the command. Never quote this string." msgstr "Αρχική διαδρομή αυτής εντολής. Ποτέ μην βάζετε αυτή τη γραμμή σε εισαγωγικά." #: tfrmoptionsfileassoc.edbactionname.hint msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you" msgstr "Όνομα αυτής της ενέργειας. Ποτέ δεν μεταφέρεται στο σύστημα, είναι μόνο ένα όνομα απομνημόνευσης επιλεγμένο από εσάς, για σας" #: tfrmoptionsfileassoc.edtparams.hint msgid "Parameter to pass to the command. Long filename with spaces should be quoted." msgstr "Παράμετρος που θα μεταφερθεί στην εντολή. Μακρύ όνομα αρχείου με κενά θα μπει σε εισαγωγικά." #: tfrmoptionsfileassoc.fnecommand.hint msgid "Command to execute. Long filename with space should be quoted." msgstr "Εντολή προς εκτέλεση. Μακρύ όνομα αρχείου με κενά θα μπουν σε εισαγωγικά." #: tfrmoptionsfileassoc.gbactiondescription.caption msgid "Action description:" msgstr "Περιγραφή Ενέργειας:" #: tfrmoptionsfileassoc.gbactions.caption msgctxt "TFRMOPTIONSFILEASSOC.GBACTIONS.CAPTION" msgid "Actions" msgstr "Ενέργειες" #: tfrmoptionsfileassoc.gbexts.caption msgctxt "TFRMOPTIONSFILEASSOC.GBEXTS.CAPTION" msgid "Extensions" msgstr "Επεκτάσεις" #: tfrmoptionsfileassoc.gbexts.hint msgid "Can be sorted by drag & drop" msgstr "Μπορεί να ταξινομηθεί με μεταφορά & απόθεση" #: tfrmoptionsfileassoc.gbfiletypes.caption msgctxt "TFRMOPTIONSFILEASSOC.GBFILETYPES.CAPTION" msgid "File types" msgstr "Τύποι Αρχείων" #: tfrmoptionsfileassoc.gbicon.caption msgctxt "TFRMOPTIONSFILEASSOC.GBICON.CAPTION" msgid "Icon" msgstr "Εικονίδιο" #: tfrmoptionsfileassoc.lbactions.hint msgid "Actions may be sorted by drag & drop" msgstr "Οι Ενέργειες μπορούν να ταξινομηθούν με μεταφορά & απόθεση" #: tfrmoptionsfileassoc.lbexts.hint msgid "Extensions may be sorted by drag & drop" msgstr "Οι Επεκτάσεις μπορούν να ταξινομηθούν με μεταφορά & απόθεση" #: tfrmoptionsfileassoc.lbfiletypes.hint msgid "File types may be sorted by drag & drop" msgstr "Ο τύποι αρχείων μπορούν να ταξινομηθούν με μεταφορά & απόθεση" #: tfrmoptionsfileassoc.lblaction.caption msgctxt "TFRMOPTIONSFILEASSOC.LBLACTION.CAPTION" msgid "Action name:" msgstr "Όνομα Ενέργειας:" #: tfrmoptionsfileassoc.lblcommand.caption msgctxt "TFRMOPTIONSFILEASSOC.LBLCOMMAND.CAPTION" msgid "&Command:" msgstr "Εντολή:" #: tfrmoptionsfileassoc.lblexternalparameters.caption msgctxt "TFRMOPTIONSFILEASSOC.LBLEXTERNALPARAMETERS.CAPTION" msgid "Parameter&s:" msgstr "Παράμετροι:" #: tfrmoptionsfileassoc.lblstartpath.caption msgctxt "TFRMOPTIONSFILEASSOC.LBLSTARTPATH.CAPTION" msgid "Start pat&h:" msgstr "Αρχική Διαδρομή:" #: tfrmoptionsfileassoc.menuitem1.caption msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfileassoc.menuitem3.caption msgid "Custom with..." msgstr "Προσαρμογή με..." #: tfrmoptionsfileassoc.micustom.caption msgid "Custom" msgstr "Προσαρμογή" #: tfrmoptionsfileassoc.miedit.caption msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION" msgid "Edit" msgstr "Επεξεργασία" #: tfrmoptionsfileassoc.mieditor.caption msgctxt "TFRMOPTIONSFILEASSOC.MIEDITOR.CAPTION" msgid "Open in Editor" msgstr "Άνοιγμα στον Επεξεργαστή" #: tfrmoptionsfileassoc.mieditwith.caption msgid "Edit with..." msgstr "Επεξεργασία με..." #: tfrmoptionsfileassoc.migetoutputfromcommand.caption msgctxt "TFRMOPTIONSFILEASSOC.MIGETOUTPUTFROMCOMMAND.CAPTION" msgid "Get output from command" msgstr "Εξαγωγή αποτελέσματος από την εντολή" #: tfrmoptionsfileassoc.miinternaleditor.caption msgid "Open in Internal Editor" msgstr "Άνοιγμα σε Εσωτερικό Επεξεργαστή" #: tfrmoptionsfileassoc.miinternalviewer.caption msgid "Open in Internal Viewer" msgstr "Άνοιγμα με Εσωτερικό Προβολέα" #: tfrmoptionsfileassoc.miopen.caption msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION" msgid "Open" msgstr "Άνοιγμα" #: tfrmoptionsfileassoc.miopenwith.caption msgid "Open with..." msgstr "Άνοιγμα με..." #: tfrmoptionsfileassoc.miseparator.caption msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfileassoc.mishell.caption msgctxt "TFRMOPTIONSFILEASSOC.MISHELL.CAPTION" msgid "Run in terminal" msgstr "Εκτέλεση σε Τερματικό" #: tfrmoptionsfileassoc.miview.caption msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION" msgid "View" msgstr "Προβολή" #: tfrmoptionsfileassoc.miviewer.caption msgctxt "TFRMOPTIONSFILEASSOC.MIVIEWER.CAPTION" msgid "Open in Viewer" msgstr " Άνοιγμα με Προβολέα" #: tfrmoptionsfileassoc.miviewwith.caption msgid "View with..." msgstr "Προβολή με..." #: tfrmoptionsfileassoc.sbtnicon.hint msgid "Click me to change icon!" msgstr "Επιλέξτε με για αλλαγή εικόνας!" #: tfrmoptionsfileassocextra.cbexecuteviashell.caption msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXECUTEVIASHELL.CAPTION" msgid "Execute via shell" msgstr "Εκτέλεση μέσω κελύφους" #: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption msgid "Extended context menu" msgstr "Μενού εκτεταμένων περιεχομένων" #: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption msgid "File association configuration" msgstr "Ρυθμίσεις Συσχετισμού Αρχείων" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption msgid "Offer to add selection to file association when not included already" msgstr "Πρόταση προσθήκης επιλογής στο συσχετισμό αρχείου όταν δεν συμπεριλαμβάνεται ήδη" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint" msgid "When accessing file association, offer to add current selected file if not already included in a configured file type" msgstr "Όταν γίνεται πρόσβαση του συσχετισμού αρχείου, πρόταση για προσθήκη του τρέχοντος επιλεγμένου αρχείου αν δεν έχει ήδη συμπεριληφθεί σε ένα ρυθμισμένο τύπο αρχείου" #: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBOPENSYSTEMWITHTERMINALCLOSE.CAPTION" msgid "Execute via terminal and close" msgstr "Εκτέλεση με τερματικό και κλείσιμο" #: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBOPENSYSTEMWITHTERMINALSTAYOPEN.CAPTION" msgid "Execute via terminal and stay open" msgstr "Εκτέλεση με τερματικό και παραμονή ανοικτό" #: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption msgid "Extended options items:" msgstr "Αντικείμενα Εκτεταμένων Ρυθμίσεων:" #: tfrmoptionsfileoperations.bvlconfirmations.caption msgctxt "TFRMOPTIONSFILEOPERATIONS.BVLCONFIRMATIONS.CAPTION" msgid "Show confirmation window for:" msgstr "Εμφάνιση παραθύρου επιβεβαίωσης για:" #: tfrmoptionsfileoperations.cbcopyconfirmation.caption msgid "Cop&y operation" msgstr "Εργασία Αντιγραφής" #: tfrmoptionsfileoperations.cbdeleteconfirmation.caption msgid "&Delete operation" msgstr "Λειτουργία διαγραφής" #: tfrmoptionsfileoperations.cbdeletetotrash.caption msgid "Dele&te to recycle bin (Shift key reverses this setting)" msgstr "Διαγραφή στον κάδο ανακύκλωσης (Το Shift πλήκτρο αναιρεί αυτή τη ρύθμιση)" #: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption msgid "D&elete to trash operation" msgstr "Λειτουργία Διαγραφής στον κάδο" #: tfrmoptionsfileoperations.cbdropreadonlyflag.caption msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION" msgid "D&rop readonly flag" msgstr "Κατέβασμα σημαίας μόνο για ανάγνωση" #: tfrmoptionsfileoperations.cbmoveconfirmation.caption msgid "&Move operation" msgstr "Λειτουργία Μετακίνησης" #: tfrmoptionsfileoperations.cbprocesscomments.caption msgid "&Process comments with files/folders" msgstr "Επεξεργασία σχολίων για αρχεία/φακέλους" #: tfrmoptionsfileoperations.cbrenameselonlyname.caption msgid "Select &file name without extension when renaming" msgstr "Επιλογή ονόματος αρχείου χωρίς επέκταση κατά την μετονομασία" #: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption msgid "Sho&w tab select panel in copy/move dialog" msgstr "Εμφάνιση καρτέλας επιλογής πάνελ στο διάλογο αντιγραφής/μετακίνησης" #: tfrmoptionsfileoperations.cbskipfileoperror.caption msgid "S&kip file operations errors and write them to log window" msgstr "Παράβλεψη των λαθών εργασιών αρχείων και καταγραφή τους στο παράθυρο καταγραφής" #: tfrmoptionsfileoperations.gbexecutingoperations.caption msgid "Executing operations" msgstr "Εκτέλεση λειτουργιών" #: tfrmoptionsfileoperations.gbuserinterface.caption msgid "User interface" msgstr "Περιβάλλον Χρήστη" #: tfrmoptionsfileoperations.lblbuffersize.caption msgid "&Buffer size for file operations (in KB):" msgstr "Μέγεθος ενδιάμεσης μνήμης για εργασίες αρχείων (σε KB):" #: tfrmoptionsfileoperations.lblhashbuffersize.caption msgid "Buffer size for &hash calculation (in KB):" msgstr "Μέγεθος ενδιάμεσης μνήμης για υπολογισμούς αθροιστικών ιχνών (σε KB):" #: tfrmoptionsfileoperations.lblprogresskind.caption msgid "Show operations progress &initially in" msgstr "Εμφάνιση προόδου εργασιών αρχικά σε" #: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLTYPEOFDUPLICATEDRENAME.CAPTION" msgid "Duplicated name auto-rename style:" msgstr "Στυλ αυτόματης μετονομασίας διπλότυπων:" #: tfrmoptionsfileoperations.lblwipepassnumber.caption msgid "&Number of wipe passes:" msgstr "Αριθμός περασμάτων ασφαλούς διαγραφής:" #: tfrmoptionsfilepanelscolors.btnbackcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnbackcolor2.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursortext.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnforecolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnindbackcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnindcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnmarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption msgid "Reset to DC default" msgstr "Επαναφορά στα προκαθορισμένα του DC" #: tfrmoptionsfilepanelscolors.cballowovercolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION" msgid "Allow Overcolor" msgstr "Επιτρέψτε Επιχρωμάτωση" #: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption msgid "Use &Frame Cursor" msgstr "Χρήση Πλαισιακού Κέρσορα" #: tfrmoptionsfilepanelscolors.cbbusegradientind.caption msgid "Use &Gradient Indicator" msgstr "Χρήση Διαβαθμισμένου Σημαντή" #: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption msgid "Use Inactive Sel Color" msgstr "Χρήση Χρώματος Ανενεργούς Επιλογής" #: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption msgid "U&se Inverted Selection" msgstr "Χρήση Ανάποδης Επιλογής" #: tfrmoptionsfilepanelscolors.cbusecursorborder.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION" msgid "Cursor border" msgstr "Όρια Κέρσορα" #: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION" msgid "Drive Free Space Indicator" msgstr "Σημαντής Ελεύθερου Χώρου Οδηγών" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption msgid "Bac&kground:" msgstr "Παρασκήνιο:" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION" msgid "Backg&round 2:" msgstr "Παρασκήνιο 2:" #: tfrmoptionsfilepanelscolors.lblcursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION" msgid "C&ursor Color:" msgstr "Χρώμα Κέρσορα:" #: tfrmoptionsfilepanelscolors.lblcursortext.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION" msgid "Cursor Te&xt:" msgstr "Κείμενο Κέρσορα:" #: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION" msgid "Inactive Cursor Color:" msgstr "Ανενεργό Χρώμα Κέρσορα:" #: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION" msgid "Inactive Mark Color:" msgstr "Χρώμα Ανενεργού Επιλογέα:" #: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption msgid "&Brightness level of inactive panel" msgstr "Επίπεδο Φωτεινότητας του ανενεργού πάνελ" #: tfrmoptionsfilepanelscolors.lblindbackcolor.caption msgid "In&dicator Back Color:" msgstr "Πισινό Χρώμα Σημαντή:" #: tfrmoptionsfilepanelscolors.lblindcolor.caption msgid "&Indicator Fore Color:" msgstr "Μπροστινό Χρώμα Σημαντή:" #: tfrmoptionsfilepanelscolors.lblmarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION" msgid "&Mark Color:" msgstr "Χρώμα Επιλογέα:" #: tfrmoptionsfilepanelscolors.lblpreview.caption msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings." msgstr "Παρακάτω είναι μία προεπισκόπηση. Μπορείται να μετακινήσετε τον κέρσορα και να επιλέξετε αρχεία ώστε να έχετε άμεσα μία πραγματική εικόνα και αίσθηση των διαφόρων ρυθμίσεων." #: tfrmoptionsfilepanelscolors.lbltextcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION" msgid "T&ext Color:" msgstr "Χρώμα Κειμένου:" #: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption msgid "When launching file search, clear file mask filter" msgstr "Όταν φορτώνεται η αναζήτηση αρχείων, καθαρισμός του φίλτρου μάσκας αρχείου" #: tfrmoptionsfilesearch.cbpartialnamesearch.caption msgid "&Search for part of file name" msgstr "Αναζήτηση για τμήμα ονόματος αρχείου" #: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption msgid "Show menu bar in \"Find files\"" msgstr "Εμφάνιση μπάρας μενού στην \"Αναζήτηση Αρχείων\"" #: tfrmoptionsfilesearch.dbtextsearch.caption msgid "Text search in files" msgstr "Αναζήτηση Κειμένου στα αρχεία" #: tfrmoptionsfilesearch.gbfilesearch.caption msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption" msgid "File search" msgstr "Αναζήτηση Αρχείου" #: tfrmoptionsfilesearch.lblnewsearchfilters.caption msgid "Current filters with \"New search\" button:" msgstr "Τρέχοντα φίλτρα με \"Νέα Αναζήτηση\" κουμπί:" #: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption msgid "Default search template:" msgstr "Εξ'ορισμού πρότυπο αναζήτησης:" #: tfrmoptionsfilesearch.rbusemmapinsearch.caption msgid "Use memory mapping for search te&xt in files" msgstr "Χρήση απεικόνισης στη μνήμη για αναζήτηση κειμένου στα αρχεία" #: tfrmoptionsfilesearch.rbusestreaminsearch.caption msgid "&Use stream for search text in files" msgstr "Χρήση stream για αναζήτηση κειμένου στα αρχεία" #: tfrmoptionsfilesviews.btnaddattribute.caption msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption" msgid "&Add" msgstr "Προσθήκη" #: tfrmoptionsfilesviews.btnattrshelp.caption msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption" msgid "&Help" msgstr "Βοήθεια" #: tfrmoptionsfilesviews.cbdblclicktoparent.caption msgid "Enable changing to &parent folder when double-clicking on empty part of file view" msgstr "Ενεργοποίηση αλλαγής στο &γονικό φάκελο όταν γίνεται διπλό κλικ πάνω σε ένα κενό τμήμα της προβολής αρχείου" #: tfrmoptionsfilesviews.cbdelayloadingtabs.caption msgid "Do&n't load file list until a tab is activated" msgstr "Να μην γίνει φόρτωση αρχείου μέχρι να ενεργοποιηθεί η καρτέλα" #: tfrmoptionsfilesviews.cbdirbrackets.caption msgid "S&how square brackets around directories" msgstr "Εμφάνιση τετράγωνων αγκυλών([ ]) γύρω από τους καταλόγους" #: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption msgid "Hi&ghlight new and updated files" msgstr "Υπογράμμιση νέων και ενημερωμένων αρχείων" #: tfrmoptionsfilesviews.cbinplacerename.caption msgid "Enable inplace &renaming when clicking twice on a name" msgstr "Ενεργοποίηση εδώ και μετονομασία όταν γίνεται κλικ δύο φορές σε ένα όνομα" #: tfrmoptionsfilesviews.cblistfilesinthread.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION" msgid "Load &file list in separate thread" msgstr "Φόρτωση λίστας αρχείων σε ξεχωριστή γραμμή" #: tfrmoptionsfilesviews.cbloadiconsseparately.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION" msgid "Load icons af&ter file list" msgstr "Φόρτωση εικονιδίων μετά τη λίστα αρχείων" #: tfrmoptionsfilesviews.cbshowsystemfiles.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION" msgid "Show s&ystem and hidden files" msgstr "Εμφάνιση αρχείων συστήματος και κρυφών" #: tfrmoptionsfilesviews.cbspacemovesdown.caption msgid "&When selecting files with , move down to next file (as with )" msgstr "Όταν επιλέγονται αρχεία με το , μετακίνηση κάτω στο επόμενο αρχείο (όπως με το )" #: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption" msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)" msgstr "Φίλτρο σε στυλ Windows όταν σημειώνονται αρχεία (\"*.*\" επίσης επιλέγει αρχεία χωρίς επέκταση, κ.λ.π.)" #: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption" msgid "Use an independent attribute filter in mask input dialog each time" msgstr "Χρήση ενός ανεξάρτητου φίλτρου ιδιοτήτων, στο διάλογο εισαγωγής μάσκας, κάθε φορά" #: tfrmoptionsfilesviews.gbformatting.caption msgid "Formatting" msgstr "Μορφοποίηση" #: tfrmoptionsfilesviews.gbmarking.caption msgid "Marking/Unmarking entries" msgstr "Σήμανση/ Κατάργηση σήμανσης εγγραφών" #: tfrmoptionsfilesviews.gbsorting.caption msgid "Sorting" msgstr "Ταξινόμηση" #: tfrmoptionsfilesviews.lbattributemask.caption msgctxt "tfrmoptionsfilesviews.lbattributemask.caption" msgid "Default attribute mask value to use:" msgstr "Προκαθορισμένη τιμή ιδιότητας μάσκας προς χρήση:" #: tfrmoptionsfilesviews.lblcasesensitivity.caption msgid "Case s&ensitivity:" msgstr "Διάκριση πεζών-κεφαλαίων:" #: tfrmoptionsfilesviews.lbldatetimeexample.caption msgid "Incorrect format" msgstr "Μη Έγκυρος Τύπος" #: tfrmoptionsfilesviews.lbldatetimeformat.caption msgid "&Date and time format:" msgstr "Μορφοποίηση Ημερομηνίας και Χρονιάς:" #: tfrmoptionsfilesviews.lblfilesizeformat.caption msgid "File si&ze format:" msgstr "Μορφή μεγέθους Αρχείου:" #: tfrmoptionsfilesviews.lblnewfilesposition.caption msgid "&Insert new files:" msgstr "Εισαγωγή νέων αρχείων:" #: tfrmoptionsfilesviews.lblsortfoldermode.caption msgid "So&rting directories:" msgstr "Ταξινόμηση καταλόγων:" #: tfrmoptionsfilesviews.lblsortmethod.caption msgid "&Sort method:" msgstr "Μέθοδος Ταξινόμησης:" #: tfrmoptionsfilesviews.lblupdatedfilesposition.caption msgid "&Move updated files:" msgstr "Μετακίνηση ενημερωμένων αρχείων:" #: tfrmoptionsfiletypescolors.btnaddcategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION" msgid "A&dd" msgstr "Προσθήκη" #: tfrmoptionsfiletypescolors.btnapplycategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION" msgid "A&pply" msgstr "Εφαρμογή" #: tfrmoptionsfiletypescolors.btncategorycolor.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfiletypescolors.btndeletecategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION" msgid "D&elete" msgstr "Διαγραφή" #: tfrmoptionsfiletypescolors.btnsearchtemplate.hint msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT" msgid "Template..." msgstr "Πρότυπο..." #: tfrmoptionsfiletypescolors.gbfiletypescolors.caption msgid "File types colors (sort by drag&&drop)" msgstr "Χρώματα Τύπων Αρχείων (ταξινόμηση κατά μεταφορά&&απόθεση)" #: tfrmoptionsfiletypescolors.lblcategoryattr.caption msgid "Category a&ttributes:" msgstr "Ιδιότητες Κατηγοριών:" #: tfrmoptionsfiletypescolors.lblcategorycolor.caption msgid "Category co&lor:" msgstr "Κατηγορία χρώματος:" #: tfrmoptionsfiletypescolors.lblcategorymask.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION" msgid "Category &mask:" msgstr "Μάσκα Κατηγορίας:" #: tfrmoptionsfiletypescolors.lblcategoryname.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION" msgid "Category &name:" msgstr "Όνομα Κατηγορίας:" #: tfrmoptionsfonts.btnpatheditfnt.caption msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnsearchresultsfnt.caption msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselconsolefnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnseleditfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnsellogfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselmainfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselviewerbookfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselviewfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.lblconsolefont.caption msgid "&Console font" msgstr "Γραμματοσειρά Τερματικού" #: tfrmoptionsfonts.lbleditorfont.caption msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION" msgid "&Editor font" msgstr "Γραμματοσειρά Επεξεργαστή" #: tfrmoptionsfonts.lbllogfont.caption msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION" msgid "&Log font" msgstr "Γραμματοσειρά Καταγραφών" #: tfrmoptionsfonts.lblmainfont.caption msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION" msgid "Main &font" msgstr "Κύρια Γραμματοσειρά" #: tfrmoptionsfonts.lblpatheditfont.caption msgid "Path font" msgstr "Γραμματοσειρά Διαδρομής" #: tfrmoptionsfonts.lblsearchresultsfont.caption msgid "Search results font" msgstr "Γραμματοσειρά Αποτελεσμάτων Αναζήτησης" #: tfrmoptionsfonts.lblviewerbookfont.caption msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION" msgid "Viewer&Book Font" msgstr "Γραμματοσειρά Προβολέα Βιβλίων" #: tfrmoptionsfonts.lblviewerfont.caption msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION" msgid "&Viewer font" msgstr "Γραμματοσειρά Προβολέα" #: tfrmoptionshotkeys.actaddhotkey.caption msgctxt "tfrmoptionshotkeys.actaddhotkey.caption" msgid "Add &hotkey" msgstr "Προσθήκη ειδικού πλήκτρου" #: tfrmoptionshotkeys.actcopy.caption msgctxt "tfrmoptionshotkeys.actcopy.caption" msgid "Copy" msgstr "Αντιγραφή" #: tfrmoptionshotkeys.actdelete.caption msgctxt "tfrmoptionshotkeys.actdelete.caption" msgid "Delete" msgstr "Διαγραφή" #: tfrmoptionshotkeys.actdeletehotkey.caption msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption" msgid "&Delete hotkey" msgstr "Διαγραφή ειδικού πλήκτρου" #: tfrmoptionshotkeys.actedithotkey.caption msgctxt "tfrmoptionshotkeys.actedithotkey.caption" msgid "&Edit hotkey" msgstr "Ρύθμιση ειδικού πλήκτρου" #: tfrmoptionshotkeys.actnextcategory.caption msgid "Next category" msgstr "Επόμενη Κατηγορία" #: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption msgid "Make popup the file related menu" msgstr "Δημιουργία αναδυόμενου μενού για το σχετικό αρχείο" #: tfrmoptionshotkeys.actpreviouscategory.caption msgid "Previous category" msgstr "Προηγούμενη Κατηγορία" #: tfrmoptionshotkeys.actrename.caption msgctxt "tfrmoptionshotkeys.actrename.caption" msgid "Rename" msgstr "Μετονομασία" #: tfrmoptionshotkeys.actrestoredefault.caption msgid "Restore DC default" msgstr "Αποκατάσταση των προκαθορισμένων ρυθμίσεων του DC" #: tfrmoptionshotkeys.actsavenow.caption msgid "Save now" msgstr "Αποθήκευση τώρα" #: tfrmoptionshotkeys.actsortbycommand.caption msgid "Sort by command name" msgstr "Ταξινόμηση κατά Όνομα Εντολής" #: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption msgid "Sort by hotkeys (grouped)" msgstr "Ταξινόμηση κατά ειδικά πλήκτρα (ομαδοποιημένα)" #: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption msgid "Sort by hotkeys (one per row)" msgstr "Ταξινόμηση κατά ειδικά πλήκτρα (ένα σε κάθε σειρά)" #: tfrmoptionshotkeys.lbfilter.caption msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION" msgid "&Filter" msgstr "Φίλτρο" #: tfrmoptionshotkeys.lblcategories.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION" msgid "C&ategories:" msgstr "Κατηγορίες:" #: tfrmoptionshotkeys.lblcommands.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION" msgid "Co&mmands:" msgstr "Εντολες:" #: tfrmoptionshotkeys.lblscfiles.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION" msgid "&Shortcut files:" msgstr "Αρχεία συντομεύσεων:" #: tfrmoptionshotkeys.lblsortorder.caption msgid "So&rt order:" msgstr "Σειρά κατάταξης:" #: tfrmoptionshotkeys.micategories.caption msgid "Categories" msgstr "Κατηγορίες:" #: tfrmoptionshotkeys.micommands.caption msgctxt "tfrmoptionshotkeys.micommands.caption" msgid "Command" msgstr "Εντολή" #: tfrmoptionshotkeys.miseparator1.caption msgctxt "tfrmoptionshotkeys.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionshotkeys.misortorder.caption msgid "Sort order" msgstr "Σειρά κατάταξης" #: tfrmoptionsicons.cbiconsexclude.caption msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION" msgid "For the following &paths and their subdirectories:" msgstr "Για τις ακόλουθες διαδρομές και τους υποκαταλόγους τους:" #: tfrmoptionsicons.cbiconsinmenus.caption msgid "Show icons for actions in &menus" msgstr "Εμφάνιση εικονιδίων για ενέργειες στα μενού" #: tfrmoptionsicons.cbiconsinmenussize.text msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT" msgid "16x16" msgstr "16x16" #: tfrmoptionsicons.cbiconsonbuttons.caption msgid "Show icons on buttons" msgstr "Εμφάνιση εικονιδίων στα κουμπιά" #: tfrmoptionsicons.cbiconsshowoverlay.caption msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION" msgid "Show o&verlay icons, e.g. for links" msgstr "Εμφάνιση εικονιδίων επίστρωσης, π.χ. για δεσμούς" #: tfrmoptionsicons.chkshowhiddendimmed.caption msgid "&Dimmed hidden files (slower)" msgstr "" #: tfrmoptionsicons.gbdisablespecialicons.caption msgid "Disable special icons" msgstr "Απενεργοποίηση ειδικών εικονιδίων" #: tfrmoptionsicons.gbiconssize.caption msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION" msgid " Icon size " msgstr "Μέγεθος Εικονοδίου" #: tfrmoptionsicons.gbicontheme.caption msgid "Icon theme" msgstr "Θέμα εικονιδίων" #: tfrmoptionsicons.gbshowicons.caption msgid "Show icons" msgstr "Προβολή εικονιδίων" #: tfrmoptionsicons.gbshowiconsmode.caption msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION" msgid " Show icons to the left of the filename " msgstr "Εμφάνιση εικονιδίων αριστερά από το όνομα αρχείου" #: tfrmoptionsicons.lbldiskpanel.caption msgid "Disk panel:" msgstr "Πάνελ Δίσκου:" #: tfrmoptionsicons.lblfilepanel.caption msgid "File panel:" msgstr "Πάνελ Αρχείου:" #: tfrmoptionsicons.rbiconsshowall.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION" msgid "A&ll" msgstr "Όλα" #: tfrmoptionsicons.rbiconsshowallandexe.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION" msgid "All associated + &EXE/LNK (slow)" msgstr "Όλα τα σχετιζόμενα + &EXE/LNK (αργό)" #: tfrmoptionsicons.rbiconsshownone.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION" msgid "&No icons" msgstr "Χωρίς Εικονίδια" #: tfrmoptionsicons.rbiconsshowstandard.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION" msgid "Only &standard icons" msgstr "Μόνο προκαθορισμένα εικονίδια" #: tfrmoptionsignorelist.btnaddsel.caption msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION" msgid "A&dd selected names" msgstr "Προσθήκη επιλεγμένων ονομάτων" #: tfrmoptionsignorelist.btnaddselwithpath.caption msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION" msgid "Add selected names with &full path" msgstr "Προσθήκη επιλεγμένων ονομάτων με τη πλήρη διαδρομή" #: tfrmoptionsignorelist.btnrelativesavein.hint msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmoptionsignorelist.chkignoreenable.caption msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION" msgid "&Ignore (don't show) the following files and folders:" msgstr "Αγνόηση (να μην γίνει εμφάνιση) των ακόλουθων αρχείων και φακέλων:" #: tfrmoptionsignorelist.lblsavein.caption msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION" msgid "&Save in:" msgstr "Αποθήκευση στο:" #: tfrmoptionskeyboard.cblynxlike.caption msgid "Le&ft, Right arrows change directory (Lynx-like movement)" msgstr "Αριστερά, Δεξιά βέλη αλλάζουν κατάλογο (κίνηση όπως στο Lynx)" #: tfrmoptionskeyboard.gbtyping.caption msgid "Typing" msgstr "Πληκτρολόγηση" #: tfrmoptionskeyboard.lblalt.caption msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION" msgid "Alt+L&etters:" msgstr "Alt+Γράμματα:" #: tfrmoptionskeyboard.lblctrlalt.caption msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION" msgid "Ctrl+Alt+Le&tters:" msgstr "Ctrl+Alt+Γράμματα:" #: tfrmoptionskeyboard.lblnomodifier.caption msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION" msgid "&Letters:" msgstr "Γράμματα:" #: tfrmoptionslayout.cbflatdiskpanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION" msgid "&Flat buttons" msgstr "Επίπεδα Κουμπιά" #: tfrmoptionslayout.cbflatinterface.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION" msgid "Flat i&nterface" msgstr "Επίπεδο Περιβάλλον" #: tfrmoptionslayout.cbflattoolbar.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION" msgid "Flat b&uttons" msgstr "Επίπεδα Κουμπιά" #: tfrmoptionslayout.cbfreespaceind.caption msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION" msgid "Show fr&ee space indicator on drive label" msgstr "Εμφάνιση ένδειξης ελεύθερου χώρου στην ετικέτα τόμου" #: tfrmoptionslayout.cblogwindow.caption msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION" msgid "Show lo&g window" msgstr "Εμφάνιση παραθύρου καταγραφών" #: tfrmoptionslayout.cbpanelofoperations.caption msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION" msgid "Show panel of operation in background" msgstr "Εμφάνιση πάνελ που πραγματοποιείται η εργασία στο παρασκήνιο" #: tfrmoptionslayout.cbproginmenubar.caption msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION" msgid "Show common progress in menu bar" msgstr "Εμφάνιση απλής προόδου στη μπάρα μενού" #: tfrmoptionslayout.cbshowcmdline.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION" msgid "Show command l&ine" msgstr "Εμφάνιση γραμμής εντολών" #: tfrmoptionslayout.cbshowcurdir.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION" msgid "Show current director&y" msgstr "Εμφάνιση τρέχοντος καταλόγου" #: tfrmoptionslayout.cbshowdiskpanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION" msgid "Show &drive buttons" msgstr "Εμφάνιση κουμπιών οδηγών" #: tfrmoptionslayout.cbshowdrivefreespace.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION" msgid "Show free s&pace label" msgstr "Εμφάνιση ετικέτας ελεύθερου χώρου" #: tfrmoptionslayout.cbshowdriveslistbutton.caption msgid "Show drives list bu&tton" msgstr "Εμφάνιση κουμπιού λίστας οδηγών" #: tfrmoptionslayout.cbshowkeyspanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION" msgid "Show function &key buttons" msgstr "Εμφάνιση κουμπιών πλήκτρων λειτουργίας" #: tfrmoptionslayout.cbshowmainmenu.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION" msgid "Show &main menu" msgstr "Εμφάνιση κυρίως μενού" #: tfrmoptionslayout.cbshowmaintoolbar.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION" msgid "Show tool&bar" msgstr "Εμφάνιση σειράς εργαλείων" #: tfrmoptionslayout.cbshowshortdrivefreespace.caption msgid "Show short free space &label" msgstr "Εμφάνιση ταξινόμησης ετικέτας ελεύθερου χώρου" #: tfrmoptionslayout.cbshowstatusbar.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION" msgid "Show &status bar" msgstr "Εμφάνιση μπάρας κατάστασης" #: tfrmoptionslayout.cbshowtabheader.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION" msgid "S&how tabstop header" msgstr "Εμφάνιση επικεφαλίδας του tabstop" #: tfrmoptionslayout.cbshowtabs.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION" msgid "Sho&w folder tabs" msgstr "Εμφάνιση καρτελών φακέλων" #: tfrmoptionslayout.cbtermwindow.caption msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION" msgid "Show te&rminal window" msgstr "Εμφάνιση παραθύρου τερματικού" #: tfrmoptionslayout.cbtwodiskpanels.caption msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION" msgid "Show two drive button bars (fi&xed width, above file windows)" msgstr "Εμφάνιση δύο σειρών κουμπιών οδηγών (σταθερό πλάτος, πάνω από το παράθυρο αρχείων)" #: tfrmoptionslayout.gbscreenlayout.caption msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION" msgid " Screen layout " msgstr "Διάταξη Οθόνης" #: tfrmoptionslog.btnrelativelogfile.hint msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmoptionslog.btnviewlogfile.hint msgctxt "tfrmoptionslog.btnviewlogfile.hint" msgid "View log file content" msgstr "Προβολή περιεχομένων αρχείου καταγραφής" #: tfrmoptionslog.cbincludedateinlogfilename.caption msgid "Include date in log filename" msgstr "Να συμπεριληφθεί ημερομηνία στο αρχείο καταγραφής του ονόματος αρχείου" #: tfrmoptionslog.cblogarcop.caption msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION" msgid "&Pack/Unpack" msgstr "Πακετάρισμα/Ξεπακετάρισμα" #: tfrmoptionslog.cblogcommandlineexecution.caption msgid "External command line execution" msgstr "Εκτέλεση εξωτερικής γραμμής εντολών" #: tfrmoptionslog.cblogcpmvln.caption msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION" msgid "Cop&y/Move/Create link/symlink" msgstr "Αντιγραφή/Μετακίνηση/Δημιουργία δεσμού/συμβολοδεσμού" #: tfrmoptionslog.cblogdelete.caption msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION" msgid "&Delete" msgstr "Διαγραφή" #: tfrmoptionslog.cblogdirop.caption msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION" msgid "Crea&te/Delete directories" msgstr "Δημιουργία/Διαγραφή καταλόγων" #: tfrmoptionslog.cblogerrors.caption msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION" msgid "Log &errors" msgstr "Καταγραφή λαθών" #: tfrmoptionslog.cblogfile.caption msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION" msgid "C&reate a log file:" msgstr "Δημιουργία ενός αρχείου καταγραφής:" #: tfrmoptionslog.cbloginfo.caption msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION" msgid "Log &information messages" msgstr "Καταγραφή των μηνυμάτων πληροφοριών" #: tfrmoptionslog.cblogstartshutdown.caption msgid "Start/shutdown" msgstr "Εκκίνηση/τερματισμός" #: tfrmoptionslog.cblogsuccess.caption msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION" msgid "Log &successful operations" msgstr "Καταγραφή των επιτυχημένων εργασιών" #: tfrmoptionslog.cblogvfs.caption msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION" msgid "&File system plugins" msgstr "Πρόσθετα Αρχείων Συστήματος" #: tfrmoptionslog.gblogfile.caption msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION" msgid "File operation log file" msgstr "Αρχείο καταγραφής εργασίας αρχείου" #: tfrmoptionslog.gblogfileop.caption msgid "Log operations" msgstr "Εργασίες Καταγραφής" #: tfrmoptionslog.gblogfilestatus.caption msgid "Operation status" msgstr "Κατάσταση Λειτουργίας" #: tfrmoptionsmisc.btnoutputpathfortoolbar.caption msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmoptionsmisc.btnrelativetcconfigfile.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmoptionsmisc.btnrelativetcexecutablefile.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmoptionsmisc.btnthumbcompactcache.caption msgid "&Remove thumbnails for no longer existing files" msgstr "Αφαίρεση μικρογραφιών για τα αρχεία που δεν υπάρχουν πλέον" #: tfrmoptionsmisc.btnviewconfigfile.hint msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT" msgid "View log file content" msgstr "Προβολή περιεχομένων αρχείου καταγραφής" #: tfrmoptionsmisc.chkdesccreateunicode.caption msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption" msgid "Create new with the encoding:" msgstr "Δημιουργία νέου με κωδικοποίηση:" #: tfrmoptionsmisc.chkgotoroot.caption msgid "Always &go to the root of a drive when changing drives" msgstr "Πάντα μετάβαση στη ρίζα ενός οδηγού όταν γίνεται αλλαγή οδηγών" #: tfrmoptionsmisc.chkshowwarningmessages.caption msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION" msgid "Show &warning messages (\"OK\" button only)" msgstr "Εμφάνιση προειδοποιητικών μηνυμάτων (\"OK\" κουμπί μόνο)" #: tfrmoptionsmisc.chkthumbsave.caption msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION" msgid "&Save thumbnails in cache" msgstr "Αποθήκευση μικρογραφιών στο κασέ" #: tfrmoptionsmisc.dblthumbnails.caption msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION" msgid "Thumbnails" msgstr "Μικρογραφίες" #: tfrmoptionsmisc.gbfilecomments.caption msgid "File comments (descript.ion)" msgstr "Περιγραφή Αρχείου (descript.ion)" #: tfrmoptionsmisc.gbtcexportimport.caption msgid "Regarding TC export/import:" msgstr "Όπως στον TC εισαγωγή/εξαγωγή:" #: tfrmoptionsmisc.lbldescrdefaultencoding.caption msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption" msgid "Default encoding:" msgstr "Προκαθορισμένη Κωδικοποίηση:" #: tfrmoptionsmisc.lbltcconfig.caption msgid "Configuration file:" msgstr "Αρχείο Διαμόρφωσης:" #: tfrmoptionsmisc.lbltcexecutable.caption msgid "TC executable:" msgstr "Εκτελέσιμο του TC:" #: tfrmoptionsmisc.lbltcpathfortool.caption msgid "Toolbar output path:" msgstr "Διαδρομή εξόδου γραμμής εργαλείων:" #: tfrmoptionsmisc.lblthumbpixels.caption msgid "pixels" msgstr "πίξελ" #: tfrmoptionsmisc.lblthumbseparator.caption msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION" msgid "X" msgstr "X" #: tfrmoptionsmisc.lblthumbsize.caption msgid "&Thumbnail size:" msgstr "Μέγεθος Μικρογραφίας:" #: tfrmoptionsmouse.cbselectionbymouse.caption msgid "&Selection by mouse" msgstr "Επιλογή με ποντίκι" #: tfrmoptionsmouse.chkmouseselectioniconclick.caption msgid "By clic&king on icon" msgstr "" #: tfrmoptionsmouse.gbscrolling.caption msgid "Scrolling" msgstr "Κύλιση" #: tfrmoptionsmouse.gbselection.caption msgid "Selection" msgstr "Επιλογή" #: tfrmoptionsmouse.lblmousemode.caption msgid "&Mode:" msgstr "Λειτουργία:" #: tfrmoptionsmouse.rbscrolllinebyline.caption msgid "&Line by line" msgstr "Γραμμή προς Γραμμή" #: tfrmoptionsmouse.rbscrolllinebylinecursor.caption msgid "Line by line &with cursor movement" msgstr "Γραμμή προς Γραμμή με την κίνηση του κέρσορα" #: tfrmoptionsmouse.rbscrollpagebypage.caption msgid "&Page by page" msgstr "Σελίδα προς Σελίδα" #: tfrmoptionsplugins.btnaddplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION" msgid "A&dd" msgstr "Προσθήκη" #: tfrmoptionsplugins.btnconfigplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION" msgid "Con&figure" msgstr "Διαμορφώστε" #: tfrmoptionsplugins.btnenableplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION" msgid "E&nable" msgstr "Ενεργοποίηση" #: tfrmoptionsplugins.btnremoveplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION" msgid "&Remove" msgstr "Αφαίρεση" #: tfrmoptionsplugins.btntweakplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION" msgid "&Tweak" msgstr "Τροποποίηση" #: tfrmoptionsplugins.lbldsxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION" msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)" msgstr "Τα πρόσθετα αναζήτησης επιτρέπουν τη χρήση εναλλακτικών αλγορίθμων αναζήτησης ή εξωτερικά εργαλεία (όπως \"locate\", κ.λ.π.)" #: tfrmoptionsplugins.lblwcxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION" msgid "Pack&er plugins are used to work with archives" msgstr "Πρόσθετα πακεταρίσματος χρησιμοποιούνται για εργασίες με τις αρχειοθήκες" #: tfrmoptionsplugins.lblwdxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION" msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool" msgstr "Τα πρόσθετα περιεχομένου επιτρέπουν την εμφάνιση επιπλέον λεπτομερειών του αρχείου όπως mp3 tags ή ιδιότητες εικόνας στις λίστες αρχείων, ή χρήση τους στην αναζήτηση και στο εργαλείο μετονομασίας πολλών" #: tfrmoptionsplugins.lblwfxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION" msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC." msgstr "Τα πρόσθετα αρχείων συστήματος επιτρέπουν την πρόσβαση σε δίσκους μη προσβάσιμους από το λειτουργικό σύστημα ή σε εξωτερικές συσκευές όπως το Palm/PocketPC." #: tfrmoptionsplugins.lblwlxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION" msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)" msgstr "Τα πρόσθετα προβολέα επιτρέπουν την εμφάνιση τύπων αρχείων όπως εικόνες, υπολογιστικά φύλλα, βάσεις δεδομένων κ.λ.π στον Προβολέα (F3, Ctrl+Q)" #: tfrmoptionsplugins.stgplugins.columns[0].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION" msgid "Active" msgstr "Ενεργό" #: tfrmoptionsplugins.stgplugins.columns[1].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION" msgid "Plugin" msgstr "Πρόσθετο" #: tfrmoptionsplugins.stgplugins.columns[2].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION" msgid "Registered for" msgstr "Έχει καταχωρηθεί στους" #: tfrmoptionsplugins.stgplugins.columns[3].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION" msgid "File name" msgstr "Ονομασία αρχείου" #: tfrmoptionsplugins.tsdsx.caption msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION" msgid "&Search plugins (.DSX)" msgstr "Αναζήτηση προσθέτων (.DSX)" #: tfrmoptionsplugins.tswcx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION" msgid "Pac&ker plugins (.WCX)" msgstr "Πρόσθετα Πακεταρίσματος (.WCX)" #: tfrmoptionsplugins.tswdx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION" msgid "Content pl&ugins (.WDX)" msgstr "Πρόσθετα περιεχομένου (.WDX)" #: tfrmoptionsplugins.tswfx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION" msgid "F&ile system plugins (.WFX)" msgstr "Πρόσθετα συστήματος Αρχείων (.WFX)" #: tfrmoptionsplugins.tswlx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION" msgid "&Viewer plugins (.WLX)" msgstr "Πρόσθετα Προβολέα (.WLX)" #: tfrmoptionsquicksearchfilter.cbexactbeginning.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION" msgid "&Beginning (name must start with first typed character)" msgstr "Αρχή (το όνομα πρέπει να αρχίζει με τον πρώτο πληκτρολογημένο χαρακτήρα)" #: tfrmoptionsquicksearchfilter.cbexactending.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION" msgid "En&ding (last character before a typed dot . must match)" msgstr "Κατάληξη (ο τελευταίος χαρακτήρας πριν από πληκτρολογημένη τελεία . πρέπει να ταιριάζει)" #: tfrmoptionsquicksearchfilter.cgpoptions.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION" msgid "Options" msgstr "Επιλογές" #: tfrmoptionsquicksearchfilter.gbexactnamematch.caption msgid "Exact name match" msgstr "Ακριβής Ταύτιση Ονόματος" #: tfrmoptionsquicksearchfilter.rgpsearchcase.caption msgid "Search case" msgstr "Αναζήτηση Κεφαλαίων" #: tfrmoptionsquicksearchfilter.rgpsearchitems.caption msgid "Search for these items" msgstr "Αναζήτηση για αυτά τα αντικείμενα" #: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption msgid "Keep renamed name when unlocking a tab" msgstr "Διατήρηση μετονομασμένου ονόματος όταν ξεκλειδώνεται μια καρτέλα" #: tfrmoptionstabs.cbtabsactivateonclick.caption msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION" msgid "Activate target &panel when clicking on one of its Tabs" msgstr "ενεργοποίηση πάνελ στόχου όταν γίνεται κλικ σε μία από τις Καρτέλες του" #: tfrmoptionstabs.cbtabsalwaysvisible.caption msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION" msgid "&Show tab header also when there is only one tab" msgstr "Εμφάνιση επικεφαλίδας καρτέλας ακόμη και όταν υπάρχει μόνο μία καρτέλα" #: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption msgid "Close duplicate tabs when closing application" msgstr "Κλείσιμο διπλασιασμένων καρτελών όταν κλείσει η εφαρμογή" #: tfrmoptionstabs.cbtabsconfirmcloseall.caption msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION" msgid "Con&firm close all tabs" msgstr "Επιβεβαίωση κλεισίματος όλων των καρτελών" #: tfrmoptionstabs.cbtabsconfirmcloselocked.caption msgid "Confirm close locked tabs" msgstr "Επιβεβαίωση κλεισίματος κλειδωμένων καρτελών" #: tfrmoptionstabs.cbtabslimitoption.caption msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION" msgid "&Limit tab title length to" msgstr "Ορισμός μήκους τίτλου καρτέλας σε" #: tfrmoptionstabs.cbtabslockedasterisk.caption msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION" msgid "Show locked tabs &with an asterisk *" msgstr "Εμφάνιση κλειδωμένων καρτελών με έναν αστερίσκο *" #: tfrmoptionstabs.cbtabsmultilines.caption msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION" msgid "&Tabs on multiple lines" msgstr "Καρτέλες σε πολλαπλές γραμμές" #: tfrmoptionstabs.cbtabsopenforeground.caption msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION" msgid "Ctrl+&Up opens new tab in foreground" msgstr "Ctrl+&Up ανοίγουν νέα καρτέλα στο προσκήνιο" #: tfrmoptionstabs.cbtabsopennearcurrent.caption msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION" msgid "Open &new tabs near current tab" msgstr "Άνοιγμα νέων καρτελών δίπλα στην τρέχουσα καρτέλα" #: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption msgid "Reuse existing tab when possible" msgstr "Επαναχρησιμοποίηση υπάρχουσας καρτέλας όταν αυτό είναι δυνατό" #: tfrmoptionstabs.cbtabsshowclosebutton.caption msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION" msgid "Show ta&b close button" msgstr "Εμφάνιση κουμπιού κλεισίματος καρτελών" #: tfrmoptionstabs.cbtabsshowdriveletter.caption msgid "Always show drive letter in tab title" msgstr "Εμφάνιση πάντοτε γράμματος οδηγού στον τίτλο καρτέλας" #: tfrmoptionstabs.gbtabs.caption msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION" msgid "Folder tabs headers" msgstr "Επικεφαλίδες Καρτελών Φακέλων" #: tfrmoptionstabs.lblchar.caption msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION" msgid "characters" msgstr "χαρακτήρες" #: tfrmoptionstabs.lbltabsactionondoubleclick.caption msgid "Action to do when double click on a tab:" msgstr "Ενέργεια που θα εκτελεστεί όταν γίνει διπλό κλικ σε μια καρτέλα:" #: tfrmoptionstabs.lbltabsposition.caption msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION" msgid "Ta&bs position" msgstr "Θέση Καρτελών" #: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text" msgid "None" msgstr "Κανένα" #: tfrmoptionstabsextra.cbdefaultsavedirhistory.text msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text" msgid "No" msgstr "Όχι" #: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text" msgid "Left" msgstr "Αριστερά" #: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text" msgid "Right" msgstr "Δεξιά" #: tfrmoptionstabsextra.cbgotoconfigafterresave.caption msgid "Goto to Favorite Tabs Configuration after resaving" msgstr "Μετάβαση στη Διαμόρφωση Αγαπημένων Καρτελών μετά την επαναποθήκευση" #: tfrmoptionstabsextra.cbgotoconfigaftersave.caption msgid "Goto to Favorite Tabs Configuration after saving a new one" msgstr "Μετάβαση στη Διαμόρφωση Αγαπημένων Καρτελών μετά την αποθήκευση μίας νέας" #: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)" msgstr "Ενεργοποίηση επιπλέον ιδιοτήτων Αγαπημένων Καρτελών (επιλογή πλευρά στόχου όταν γίνεται αποκατάσταση, κ.λ.π.)" #: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption msgid "Default extra settings when saving new Favorite Tabs:" msgstr "Προκαθορισμένες επιπλέον ιδιότητες όταν αποθηκεύεται νέα Αγαπημένη Καρτέλα:" #: tfrmoptionstabsextra.gbtabs.caption msgid "Folder tabs headers extra" msgstr "Έξτρα Επικεφαλίδων Καρτελών Φακέλων" #: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption msgid "When restoring tab, existing tabs to keep:" msgstr "όταν αποκαθίσταται καρτέλα, υπάρχουσες καρτέλες προς φύλαξη:" #: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption msgid "Tabs saved on left will be restored to:" msgstr "Καρτέλες αποθηκευμένες αριστερά να αποκατασταθούν σε :" #: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption msgid "Tabs saved on right will be restored to:" msgstr "Καρτέλες αποθηκευμένες δεξιά να αποκατασταθούν σε :" #: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption" msgid "Keep saving dir history with Favorite Tabs:" msgstr "Διατήρηση αποθήκευσης ιστορικού καταλόγου με Αγαπημένες Καρτέλες:" #: tfrmoptionstabsextra.rgwheretoadd.caption msgid "Default position in menu when saving a new Favorite Tabs:" msgstr "Προκαθορισμένη θέση στο μενού όταν αποθηκεύεται μια νέα Αγαπημένη Καρτέλα:" #: tfrmoptionsterminal.edrunintermcloseparams.hint msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{command} θα έπρεπε να είναι παρούσα εδώ για να προσδιορίσει την εντολή που θα εκτελεστεί στο τερματικό" #: tfrmoptionsterminal.edrunintermstayopenparams.hint msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{command} θα έπρεπε να είναι παρούσα εδώ για να προσδιορίσει την εντολή που θα εκτελεστεί στο τερματικό" #: tfrmoptionsterminal.edruntermparams.hint msgctxt "tfrmoptionsterminal.edruntermparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{command} θα έπρεπε να είναι παρούσα εδώ για να προσδιορίσει την εντολή που θα εκτελεστεί στο τερματικό" #: tfrmoptionsterminal.gbjustrunterminal.caption msgid "Command for just running terminal:" msgstr "Εντολή για εκτέλεση μόνο του τερματικού:" #: tfrmoptionsterminal.gbruninterminalclose.caption msgid "Command for running a command in terminal and close after:" msgstr "Εντολή για εκτέλεση μιας εντολής στο τερματικό και κλείσιμό του μετά απ'αυτό:" #: tfrmoptionsterminal.gbruninterminalstayopen.caption msgid "Command for running a command in terminal and stay open:" msgstr "Εντολή για εκτέλεση μιας εντολής στο τερματικό και παραμονή του ανοικτό :" #: tfrmoptionsterminal.lbrunintermclosecmd.caption msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption" msgid "Command:" msgstr "Εντολή:" #: tfrmoptionsterminal.lbrunintermcloseparams.caption msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption" msgid "Parameters:" msgstr "Παράμετροι:" #: tfrmoptionsterminal.lbrunintermstayopencmd.caption msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption" msgid "Command:" msgstr "Εντολή:" #: tfrmoptionsterminal.lbrunintermstayopenparams.caption msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption" msgid "Parameters:" msgstr "Παράμετροι:" #: tfrmoptionsterminal.lbruntermcmd.caption msgctxt "tfrmoptionsterminal.lbruntermcmd.caption" msgid "Command:" msgstr "Εντολή:" #: tfrmoptionsterminal.lbruntermparams.caption msgctxt "tfrmoptionsterminal.lbruntermparams.caption" msgid "Parameters:" msgstr "Παράμετροι:" #: tfrmoptionstoolbar.btnclonebutton.caption msgid "C&lone button" msgstr "Κουμπί κλωνοποίησης" #: tfrmoptionstoolbar.btndeletebutton.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION" msgid "&Delete" msgstr "Διαγραφή" #: tfrmoptionstoolbar.btnedithotkey.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION" msgid "Edit hot&key" msgstr "Ρύθμιση ειδικού πλήκτρου" #: tfrmoptionstoolbar.btninsertbutton.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION" msgid "&Insert new button" msgstr "Εισαγωγή νέου κουμπιού" #: tfrmoptionstoolbar.btnopencmddlg.caption msgid "Select" msgstr "Επιλέξτε" #: tfrmoptionstoolbar.btnopenfile.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstoolbar.btnother.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNOTHER.CAPTION" msgid "Other..." msgstr "Άλλα..." #: tfrmoptionstoolbar.btnremovehotkey.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION" msgid "Remove hotke&y" msgstr "Αφαίρεση ειδικού πλήκτρου" #: tfrmoptionstoolbar.btnstartpath.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstoolbar.btnsuggestiontooltip.caption msgid "Suggest" msgstr "Πρόταση" #: tfrmoptionstoolbar.btnsuggestiontooltip.hint msgid "Have DC suggest the tooltip based on button type, command and parameters" msgstr "Πρόταση από τον DC υπόδειξης βασισμένης στον τύπο κουμπιού, εντολής και παραμέτρων" #: tfrmoptionstoolbar.cbflatbuttons.caption msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption" msgid "&Flat buttons" msgstr "Επίπεδα Κουμπιά" #: tfrmoptionstoolbar.cbreporterrorwithcommands.caption msgid "Report errors with commands" msgstr "Αναφορά λαθών με εντολές" #: tfrmoptionstoolbar.edtinternalparameters.hint msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters." msgstr "Εισαγωγή παραμέτρων εντολής, καθεμία σε ξεχωριστή γραμμή. Πιέστε F1 για βοήθεια στις παραμέτρους." #: tfrmoptionstoolbar.gbgroupbox.caption msgid "Appearance" msgstr "Εμφάνιση" #: tfrmoptionstoolbar.lblbarsize.caption msgid "&Bar size:" msgstr "Μέγεθος Μπάρας:" #: tfrmoptionstoolbar.lblexternalcommand.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION" msgid "Comman&d:" msgstr "Εντολή:" #: tfrmoptionstoolbar.lblexternalparameters.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION" msgid "Parameter&s:" msgstr "Παράμετροι:" #: tfrmoptionstoolbar.lblhelponinternalcommand.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION" msgid "Help" msgstr "Βοήθεια" #: tfrmoptionstoolbar.lblhotkey.caption msgid "Hot key:" msgstr "Ειδικό Πλήκτρο:" #: tfrmoptionstoolbar.lbliconfile.caption msgid "Ico&n:" msgstr "Εικονίδιο:" #: tfrmoptionstoolbar.lbliconsize.caption msgid "Icon si&ze:" msgstr "Μέγεθος εικόνας:" #: tfrmoptionstoolbar.lblinternalcommand.caption msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption" msgid "Co&mmand:" msgstr "Εντολή:" #: tfrmoptionstoolbar.lblinternalparameters.caption msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption" msgid "&Parameters:" msgstr "Παράμετροι:" #: tfrmoptionstoolbar.lblstartpath.caption msgctxt "tfrmoptionstoolbar.lblstartpath.caption" msgid "Start pat&h:" msgstr "Διαδρομή Εκκίνησης:" #: tfrmoptionstoolbar.lbltooltip.caption msgid "&Tooltip:" msgstr "Υπόδειξη:" #: tfrmoptionstoolbar.miaddallcmds.caption msgid "Add toolbar with ALL DC commands" msgstr "Προσθήκη γραμμής εργαλείων με ΟΛΕΣ τις DC εντολές" #: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption msgid "for an external command" msgstr "για μία εξωτερική εντολή" #: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption msgid "for an internal command" msgstr "για μία εσωτερική εντολή" #: tfrmoptionstoolbar.miaddseparatorsubmenu.caption msgid "for a separator" msgstr "για ένα διαχωριστικό" #: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption msgid "for a sub-tool bar" msgstr "για μια υπο-σειρά εργαλείων" #: tfrmoptionstoolbar.mibackup.caption msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION" msgid "Backup..." msgstr "Αντίγραφο Ασφαλείας..." #: tfrmoptionstoolbar.miexport.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION" msgid "Export..." msgstr "Εξαγωγή..." #: tfrmoptionstoolbar.miexportcurrent.caption msgid "Current toolbar..." msgstr "Τρέχουσα γραμμή εργαλείων..." #: tfrmoptionstoolbar.miexportcurrenttodcbar.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION" msgid "to a Toolbar File (.toolbar)" msgstr "σε ένα αρχείο Γραμμής Εργαλείων (.toolbar)" #: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION" msgid "to a TC .BAR file (keep existing)" msgstr "σε ένα TC .BAR αρχείο (διατήρηση υπάρχοντος)" #: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION" msgid "to a TC .BAR file (erase existing)" msgstr "σε ένα TC .BAR αρχείο (διαγραφή υπάρχοντος)" #: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "σε ένα \"wincmd.ini\" του TC (διατήρηση υπάρχοντος)" #: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "σε ένα \"wincmd.ini\" του TC (διαγραφή υπάρχοντος)" #: tfrmoptionstoolbar.miexportseparator1.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator2.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator3.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator4.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexporttop.caption msgid "Top toolbar..." msgstr "Γραμμή Εργαλείων κορυφής..." #: tfrmoptionstoolbar.miexporttoptobackup.caption msgid "Save a backup of Toolbar" msgstr "Αποθήκευση ενός αντιγράφου ασφαλείας της Γραμμής Εργαλείων" #: tfrmoptionstoolbar.miexporttoptodcbar.caption msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption" msgid "to a Toolbar File (.toolbar)" msgstr "σε ένα αρχείο Γραμμής Εργαλείων (.toolbar)" #: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption" msgid "to a TC .BAR file (keep existing)" msgstr "σε ένα TC .BAR αρχείο (διατήρηση υπάρχοντος)" #: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption" msgid "to a TC .BAR file (erase existing)" msgstr "σε ένα TC .BAR αρχείο (διαγραφή υπάρχοντος)" #: tfrmoptionstoolbar.miexporttoptotcinikeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "σε ένα \"wincmd.ini\" του TC (διατήρηση υπάρχοντος)" #: tfrmoptionstoolbar.miexporttoptotcininokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "σε ένα \"wincmd.ini\" του TC (διαγραφή υπάρχοντος)" #: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "Αμέσως μετά την τρέχουσα επιλογή" #: tfrmoptionstoolbar.miexternalcommandfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "ως πρώτο στοιχείο" #: tfrmoptionstoolbar.miexternalcommandlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION" msgid "as last element" msgstr "ως τελευταίο στοιχείο" #: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "Αμέσως πριν την τρέχουσα επιλογή" #: tfrmoptionstoolbar.miimport.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION" msgid "Import..." msgstr "Εισάγετε..." #: tfrmoptionstoolbar.miimportbackup.caption msgid "Restore a backup of Toolbar" msgstr "Επαναφορά ενός αντιγράφου ασφαλείας της Σειράς Εργαλείων" #: tfrmoptionstoolbar.miimportbackupaddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "για προσθήκη στη τρέχουσα σειρά εργαλείων" #: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "προσθήκη νέας γραμμής εργαλείων στη τρέχουσα γραμμή εργαλείων" #: tfrmoptionstoolbar.miimportbackupaddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "προσθήκη νέας γραμμής εργαλείων στη γραμμή εργαλείων που είναι στη κορυφή" #: tfrmoptionstoolbar.miimportbackupaddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "για προσθήκη στη σειρά εργαλείων της κορυφής" #: tfrmoptionstoolbar.miimportbackupreplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "για αντικατάσταση της σειράς εργαλείων της κορυφής" #: tfrmoptionstoolbar.miimportdcbar.caption msgid "from a Toolbar File (.toolbar)" msgstr "Από ένα Αρχείο Γραμμής Εργαλείων (.toolbar)" #: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption" msgid "to add to current toolbar" msgstr "για προσθήκη στη τρέχουσα σειρά εργαλείων" #: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "προσθήκη νέας γραμμής εργαλείων στη τρέχουσα γραμμή εργαλείων" #: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "προσθήκη νέας γραμμής εργαλείων στη γραμμή εργαλείων που είναι στη κορυφή" #: tfrmoptionstoolbar.miimportdcbaraddtop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption" msgid "to add to top toolbar" msgstr "για προσθήκη στη σειρά εργαλείων της κορυφής" #: tfrmoptionstoolbar.miimportdcbarreplacetop.caption msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption" msgid "to replace top toolbar" msgstr "για αντικατάσταση της σειράς εργαλείων της κορυφής" #: tfrmoptionstoolbar.miimportseparator.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miimporttcbar.caption msgid "from a single TC .BAR file" msgstr "Από ένα απλό TC .BAR αρχείο" #: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "για προσθήκη στη τρέχουσα σειρά εργαλείων" #: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "προσθήκη νέας γραμμής εργαλείων στη τρέχουσα γραμμή εργαλείων" #: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "προσθήκη νέας γραμμής εργαλείων στη γραμμή εργαλείων που είναι στη κορυφή" #: tfrmoptionstoolbar.miimporttcbaraddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "για προσθήκη στη σειρά εργαλείων της κορυφής" #: tfrmoptionstoolbar.miimporttcbarreplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "για αντικατάσταση της σειράς εργαλείων της κορυφής" #: tfrmoptionstoolbar.miimporttcini.caption msgid "from \"wincmd.ini\" of TC..." msgstr "Από \"wincmd.ini\" του TC..." #: tfrmoptionstoolbar.miimporttciniaddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "για προσθήκη στη τρέχουσα σειρά εργαλείων" #: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "προσθήκη νέας γραμμής εργαλείων στην τρέχουσα γραμμή εργαλείων" #: tfrmoptionstoolbar.miimporttciniaddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "προσθήκη νέας γραμμής εργαλείων στη γραμμή εργαλείων που είναι στη κορυφή" #: tfrmoptionstoolbar.miimporttciniaddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "για προσθήκη στη σειρά εργαλείων της κορυφής" #: tfrmoptionstoolbar.miimporttcinireplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "για αντικατάσταση της σειράς εργαλείων της κορυφής" #: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "Αμέσως μετά την τρέχουσα επιλογή" #: tfrmoptionstoolbar.miinternalcommandfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "ως πρώτο στοιχείο" #: tfrmoptionstoolbar.miinternalcommandlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION" msgid "as last element" msgstr "ως τελευταίο στοιχείο" #: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "Αμέσως πριν την τρέχουσα επιλογή" #: tfrmoptionstoolbar.misearchandreplace.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION" msgid "Search and replace..." msgstr "Αναζήτηση και αντικατάσταση..." #: tfrmoptionstoolbar.miseparator1.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator10.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator11.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator13.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator14.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator2.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator6.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator7.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator8.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator9.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparatoraftercurrent.caption msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption" msgid "just after current selection" msgstr "Αμέσως μετά την τρέχουσα επιλογή" #: tfrmoptionstoolbar.miseparatorfirstitem.caption msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption" msgid "as first element" msgstr "ως πρώτο στοιχείο" #: tfrmoptionstoolbar.miseparatorlastelement.caption msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption" msgid "as last element" msgstr "ως τελευταίο στοιχείο" #: tfrmoptionstoolbar.miseparatorpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption" msgid "just prior current selection" msgstr "Αμέσως πριν την τρέχουσα επιλογή" #: tfrmoptionstoolbar.misrcrplallofall.caption msgid "in all of all the above..." msgstr "σε όλα τα ανωτέρω..." #: tfrmoptionstoolbar.misrcrplclickseparator.caption msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.misrcrplcommands.caption msgid "in all commands..." msgstr "σε όλες τις εντολές..." #: tfrmoptionstoolbar.misrcrpliconnames.caption msgid "in all icon names..." msgstr "σε όλα τα ονόματα εικονιδίων..." #: tfrmoptionstoolbar.misrcrplparameters.caption msgid "in all parameters..." msgstr "σε όλες τις παραμέτρους..." #: tfrmoptionstoolbar.misrcrplstartpath.caption msgid "in all start path..." msgstr "σε όλες τις διαδρομές εκκίνησης...." #: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "Αμέσως μετά την τρέχουσα επιλογή" #: tfrmoptionstoolbar.misubtoolbarfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "ως πρώτο στοιχείο" #: tfrmoptionstoolbar.misubtoolbarlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION" msgid "as last element" msgstr "ως τελευταίο στοιχείο" #: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "Αμέσως πριν την τρέχουσα επιλογή" #: tfrmoptionstoolbar.rgtoolitemtype.caption msgid "Button type" msgstr "Τύπος Κουμπιού" #: tfrmoptionstoolbase.btnrelativetoolpath.hint msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption msgid "&Keep terminal window open after executing program" msgstr "Διατήρηση παραθύρου τερματικού ανοικτό μετά την εκτέλεση του προγράμματος" #: tfrmoptionstoolbase.cbtoolsruninterminal.caption msgid "&Execute in terminal" msgstr "Εκτέλεση σε τερματικό" #: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption msgid "&Use external program" msgstr "Χρήση εξωτερικού προγράμματος" #: tfrmoptionstoolbase.lbltoolsparameters.caption msgid "A&dditional parameters" msgstr "Επιπρόσθετες παράμετροι" #: tfrmoptionstoolbase.lbltoolspath.caption msgid "&Path to program to execute" msgstr "Διαδρομή προγράμματος προς εκτέλεση" #: tfrmoptionstooltips.btnaddfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION" msgid "A&dd" msgstr "Προσθήκη" #: tfrmoptionstooltips.btnapplyfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION" msgid "A&pply" msgstr "Εφαρμογή" #: tfrmoptionstooltips.btndeletefields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION" msgid "D&elete" msgstr "Διαγραφή" #: tfrmoptionstooltips.btnfieldslist.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstooltips.btnfieldssearchtemplate.hint msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT" msgid "Template..." msgstr "Πρότυπο..." #: tfrmoptionstooltips.chkshowtooltip.caption msgctxt "TFRMOPTIONSTOOLTIPS.CHKSHOWTOOLTIP.CAPTION" msgid "&Show tooltip for files in the file panel" msgstr "Εμφάνιση υπόδειξης για αρχεία στο πάνελ αρχείων" #: tfrmoptionstooltips.gbcustomfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION" msgid "Custom fields by file type" msgstr "Εξατομικευμένα πεδία κατά τύπο αρχείου" #: tfrmoptionstooltips.lblfieldslist.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION" msgid "Category &hint:" msgstr "Συμβουλή Κατηγορίας:" #: tfrmoptionstooltips.lblfieldsmask.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION" msgid "Category &mask:" msgstr "Μάσκα Κατηγορίας:" #: tfrmoptionstooltips.lblfieldsname.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION" msgid "Category &name:" msgstr "Όνομα Κατηγορίας:" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption msgid "With double-click on the bar on top of a file panel" msgstr "Με διπλό κλικ στην κορυφή πάνω από το πάνελ Αρχείου" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption" msgid "With the menu and internal command" msgstr "Με το μενού και εσωτερική εντολή" #: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption msgid "Double click in tree select and exit" msgstr "Διπλό κλικ σε επιλογή Δέντρου και έξοδος" #: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption" msgid "With the menu and internal command" msgstr "Με το μενού και εσωτερική εντολή" #: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption msgid "With double-click on a tab (if configured for it)" msgstr "Με διπλό κλικ σε μια Καρτέλα (αν έχει οριστεί έτσι)" #: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption msgid "When using the keyboard shortcut, it will exit the window returning the current choice" msgstr "Όταν γίνεται χρήση της συντόμευσης πληκτρολογίου, θα γίνει έξοδος από το παράθυρο επιστρέφοντας την τρέχουσα επιλογή" #: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption msgid "Single mouse click in tree select and exit" msgstr "Απλό κλικ του ποντικιού σε επιλογή δέντρου και έξοδος" #: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption msgid "Use it for Command Line History" msgstr "Χρήση στο Ιστορικό Γραμμής Εντολών" #: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption msgid "Use it for the Dir History" msgstr "Χρήση στο Ιστορικό Καταλόγου" #: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption msgid "Use it for the View History (Visited paths for active view)" msgstr "Χρήση στο Ιστορικό Προβολής (προβεβλημένες διαδρομές για την ενεργή προβολή)" #: tfrmoptionstreeviewmenu.gbbehavior.caption msgid "Behavior regarding selection:" msgstr "Συμπεριφορά που αφορά την Επιλογή:" #: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption msgid "Tree View Menus related options:" msgstr "Επιλογές σχετικές με τα Μενού Προβολής Δέντρου:" #: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption msgid "Where to use Tree View Menus:" msgstr "Που θα γίνει χρήση Μενού Προβολής Δέντρου:" #: tfrmoptionstreeviewmenu.lblnote.caption msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another." msgstr "*ΣΗΜΕΙΩΣΗ: Όσον αφορά ρυθμίσεις όπως τη διάκριση πεζών-κεφαλαίων, αγνόηση τονισμού ή όχι, αυτές αποθηκεύονται ξεχωριστά για το κάθε περιεχόμενο από τη μια χρήση και περίοδο λειτουργίας στην άλλη." #: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption msgid "With Directory Hotlist:" msgstr "Με Hotlist Καταλόγου:" #: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption msgid "With Favorite Tabs:" msgstr "Με Αγαπημένες Καρτέλες:" #: tfrmoptionstreeviewmenu.lblusewithhistory.caption msgid "With History:" msgstr "Με Ιστορικό:" #: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btncursorcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption msgid "Use and display keyboard shortcut for choosing items" msgstr "Χρήση και Προβολή συντόμευσης πληκτρολογίου για την επιλογή αντικειμένων" #: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption msgid "Layout and colors options:" msgstr "Διάταξη και Επιλογές Χρωμάτων:" #: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption msgid "Background color:" msgstr "Χρώμα Παρασκηνίου:" #: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption msgid "Cursor color:" msgstr "Χρώμα Κέρσορα:" #: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption msgid "Found text color:" msgstr "Χρώμα Ευρεθέντος Κειμένου:" #: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption msgid "Found text under cursor:" msgstr "Ευρεθέν Κείμενο κάτω από τον κέρσορα:" #: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption msgid "Normal text color:" msgstr "Χρώμα Κανονικού Κειμένου:" #: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption msgid "Normal text under cursor:" msgstr "Κανονικό Κείμενο κάτω από τον κέρσορα:" #: tfrmoptionstreeviewmenucolor.lblpreview.caption msgid "Tree View Menu Preview:" msgstr "Προεπισκόπηση Μενού Προβολής Δέντρου:" #: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption msgid "Secondary text color:" msgstr "Χρώμα δευτερεύοντος κειμένου:" #: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption msgid "Secondary text under cursor:" msgstr "Δευτερεύον κείμενο κάτω από τον κέρσορα:" #: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption msgid "Shortcut color:" msgstr "Χρώμα συντόμευσης:" #: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption msgid "Shortcut under cursor:" msgstr "Συντόμευση κάτω από τον κέρσορα:" #: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption msgid "Unselectable text color:" msgstr "Χρώμα μη επιλέξιμου κειμένου:" #: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption msgid "Unselectable under cursor:" msgstr "Μη επιλέξιμο κάτω από τον κέρσορα:" #: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample." msgstr "Κάντε αλλαγή χρώματος στα αριστερά και θα εμφανιστεί εδώ μια Προεπισκόπηση του πως θα εμφανίζονται τα Μενού Προβολής Δέντρου με αυτό το δείγμα." #: tfrmoptionsviewer.btnbackviewercolor.caption msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsviewer.btnfontviewercolor.caption msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsviewer.gbviewerbookmode.caption msgid "Viewer Book Mode" msgstr "Λειτουργία Προβολέα Βιβλίων" #: tfrmoptionsviewer.gbviewerexample.caption msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION" msgid "Example" msgstr "Παράδειγμα" #: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption msgid "&Background color in book viewer" msgstr "Χρώμα παρασκηνίου στον προβολέα βιβλίων" #: tfrmoptionsviewer.lblfontcolorviewerbook.caption msgid "&Font color in book viewer" msgstr "Χρώμα Γραμματοσειράς στον προβολέα βιβλίων" #: tfrmoptionsviewer.lblnumbercolumnsviewer.caption msgid "&Number of columns in book viewer" msgstr "Αριθμός στηλών στον προβολέα βιβλίων" #: tfrmpackdlg.btnconfig.caption msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION" msgid "Con&figure" msgstr "Διαμόρφωση" #: tfrmpackdlg.caption msgctxt "TFRMPACKDLG.CAPTION" msgid "Pack files" msgstr "Πακετάρισμα αρχείων" #: tfrmpackdlg.cbcreateseparatearchives.caption msgid "C&reate separate archives, one per selected file/dir" msgstr "Δημιουργία ξεχωριστών αρχειοθηκών, μια για κάθε ξεχωριστό αρχείο/κατάλογο" #: tfrmpackdlg.cbcreatesfx.caption msgid "Create self e&xtracting archive" msgstr "Δημιουργία αυτο-εξαγώμενης αρχειοθήκης" #: tfrmpackdlg.cbencrypt.caption msgid "Encr&ypt" msgstr "Κρυπτογράφηση" #: tfrmpackdlg.cbmovetoarchive.caption msgid "Mo&ve to archive" msgstr "Μετακίνηση στην αρχειοθήκη" #: tfrmpackdlg.cbmultivolume.caption msgid "&Multiple disk archive" msgstr "Πολλαπλή αρχειοθήκη δίσκου" #: tfrmpackdlg.cbotherplugins.caption msgid "=>" msgstr "=>" #: tfrmpackdlg.cbputintarfirst.caption msgid "P&ut in the TAR archive first" msgstr "Τοποθέτηση πρώτο στην TAR αρχειοθήκη" #: tfrmpackdlg.cbstoredir.caption msgid "Also &pack path names (only recursed)" msgstr "Επίσης πακετάρισμα διαδρομών ονομάτων (μόνο των αναδρομικών)" #: tfrmpackdlg.lblprompt.caption msgid "Pack file(s) to the file:" msgstr "Πακετάρισμα αρχείου(ων) στο αρχείο:" #: tfrmpackdlg.rgpacker.caption msgid "Packer" msgstr "Εφαρμογή Πακεταρίσματος" #: tfrmpackinfodlg.btnclose.caption msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Κλείσιμο" #: tfrmpackinfodlg.btnunpackallandexec.caption msgid "Unpack &all and execute" msgstr "Ξεπακετάρισμα όλων και εκτέλεση" #: tfrmpackinfodlg.btnunpackandexec.caption msgid "&Unpack and execute" msgstr "Ξεπακετάρισμα και εκτέλεση" #: tfrmpackinfodlg.caption msgctxt "TFRMPACKINFODLG.CAPTION" msgid "Properties of packed file" msgstr "Ιδιότητες πακεταρισμένου αρχείου" #: tfrmpackinfodlg.lblattributes.caption msgid "Attributes:" msgstr "Ιδιότητες:" #: tfrmpackinfodlg.lblcompressionratio.caption msgid "Compression ratio:" msgstr "Αναλογία Συμπίεσης:" #: tfrmpackinfodlg.lbldate.caption msgid "Date:" msgstr "Ημερομηνία:" #: tfrmpackinfodlg.lblmethod.caption msgid "Method:" msgstr "Μέθοδος:" #: tfrmpackinfodlg.lbloriginalsize.caption msgid "Original size:" msgstr "Αυθεντικό μέγεθος:" #: tfrmpackinfodlg.lblpackedfile.caption msgid "File:" msgstr "Αρχείο:" #: tfrmpackinfodlg.lblpackedsize.caption msgid "Packed size:" msgstr "Μέγεθος πακεταρισμένου:" #: tfrmpackinfodlg.lblpacker.caption msgid "Packer:" msgstr "Εφαρμογή Πακεταρίσματος:" #: tfrmpackinfodlg.lbltime.caption msgid "Time:" msgstr "Χρόνος:" #: tfrmquicksearch.btncancel.caption msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION" msgid "X" msgstr "X" #: tfrmquicksearch.btncancel.hint msgid "Close filter panel" msgstr "Κλείσιμο πάνελ φίλτρου" #: tfrmquicksearch.edtsearch.hint msgid "Enter text to search for or filter by" msgstr "Εισάγετε κείμενο για αναζήτηση ή εφαρμόστε φίλτρο για" #: tfrmquicksearch.sbcasesensitive.caption msgid "Aa" msgstr "Αα" #: tfrmquicksearch.sbcasesensitive.hint msgid "Case Sensitive" msgstr "Διάκριση Πεζών-Κεφαλαίων" #: tfrmquicksearch.sbdirectories.caption msgid "D" msgstr "Κ" #: tfrmquicksearch.sbdirectories.hint msgctxt "tfrmquicksearch.sbdirectories.hint" msgid "Directories" msgstr "Κατάλογοι" #: tfrmquicksearch.sbfiles.caption msgid "F" msgstr "Α" #: tfrmquicksearch.sbfiles.hint msgctxt "tfrmquicksearch.sbfiles.hint" msgid "Files" msgstr "Αρχεία" #: tfrmquicksearch.sbmatchbeginning.caption msgid "{" msgstr "{" #: tfrmquicksearch.sbmatchbeginning.hint msgid "Match Beginning" msgstr "Αντιστοίχηση που Αρχίζει" #: tfrmquicksearch.sbmatchending.caption msgid "}" msgstr "}" #: tfrmquicksearch.sbmatchending.hint msgid "Match Ending" msgstr "Αντιστοίχηση που Τελειώνει" #: tfrmquicksearch.tglfilter.caption msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION" msgid "Filter" msgstr "Φίλτρο" #: tfrmquicksearch.tglfilter.hint msgid "Toggle between search or filter" msgstr "Εναλλαγή μεταξύ αναζήτησης και φίλτρου" #: tfrmsearchplugin.btnadd.caption msgid "&More rules" msgstr "Περισσότεροι κανόνες" #: tfrmsearchplugin.btndelete.caption msgid "L&ess rules" msgstr "Λιγότεροι κανόνες" #: tfrmsearchplugin.chkuseplugins.caption msgid "Use &content plugins, combine with:" msgstr "Χρήση προσθέτων περιεχομένου, συνδυασμός με:" #: tfrmsearchplugin.headercontrol.sections[0].text msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT" msgid "Plugin" msgstr "Πρόσθετο" #: tfrmsearchplugin.headercontrol.sections[1].text msgid "Field" msgstr "Πεδίο" #: tfrmsearchplugin.headercontrol.sections[2].text msgid "Operator" msgstr "Χειριστής" #: tfrmsearchplugin.headercontrol.sections[3].text msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[3].TEXT" msgid "Value" msgstr "Τιμή" #: tfrmsearchplugin.rband.caption msgid "&AND (all match)" msgstr "ΚΑΙ (όσα ταιριάζουν)" #: tfrmsearchplugin.rbor.caption msgid "&OR (any match)" msgstr "Ή (όποιο ταιριάζει)" #: tfrmselecttextrange.btppanel.cancelbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION" msgid "Cancel" msgstr "Ακύρωση" #: tfrmselecttextrange.btppanel.closebutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION" msgid "&Close" msgstr "Κλείσιμο" #: tfrmselecttextrange.btppanel.helpbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION" msgid "&Help" msgstr "Βοήθεια" #: tfrmselecttextrange.btppanel.okbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION" msgid "&OK" msgstr "OK" #: tfrmselecttextrange.lblselecttext.caption msgid "&Select the characters to insert:" msgstr "Επιλέξτε τους χαρακτήρες για εισαγωγή:" #: tfrmsetfileproperties.btncancel.caption msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmsetfileproperties.btnok.caption msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION" msgid "&OK" msgstr "&OK" #: tfrmsetfileproperties.caption msgctxt "TFRMSETFILEPROPERTIES.CAPTION" msgid "Change attributes" msgstr "Αλλαγή Ιδιοτήτων" #: tfrmsetfileproperties.cbsgid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmsetfileproperties.cbsticky.caption msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Κολημμένα" #: tfrmsetfileproperties.cbsuid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmsetfileproperties.chkarchive.caption msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION" msgid "Archive" msgstr "Αρχειοθήκη" #: tfrmsetfileproperties.chkcreationtime.caption msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION" msgid "Created:" msgstr "Δημιουργήθηκε:" #: tfrmsetfileproperties.chkhidden.caption msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION" msgid "Hidden" msgstr "Κρυφό" #: tfrmsetfileproperties.chklastaccesstime.caption msgid "Accessed:" msgstr "Προσπελάστηκε:" #: tfrmsetfileproperties.chklastwritetime.caption msgid "Modified:" msgstr "Τροποποιήθηκε:" #: tfrmsetfileproperties.chkreadonly.caption msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION" msgid "Read only" msgstr "Μόνο για Ανάγνωση" #: tfrmsetfileproperties.chkrecursive.caption msgid "Including subfolders" msgstr "Συμπεριβαλομένων των υποφακέλων" #: tfrmsetfileproperties.chksystem.caption msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION" msgid "System" msgstr "Σύστημα" #: tfrmsetfileproperties.gbtimesamp.caption msgid "Timestamp properties" msgstr "Ιδιότητες χρόνου τελευταίας πρόσβασης" #: tfrmsetfileproperties.gbunixattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Ιδιότητες" #: tfrmsetfileproperties.gbwinattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Ιδιότητες" #: tfrmsetfileproperties.lblattrbitsstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bits:" #: tfrmsetfileproperties.lblattrgroupstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Γκρουπ" #: tfrmsetfileproperties.lblattrinfo.caption msgctxt "tfrmsetfileproperties.lblattrinfo.caption" msgid "(gray field means unchanged value)" msgstr "(γκρι πεδίο σημαίνει τιμή χωρίς αλλαγή)" #: tfrmsetfileproperties.lblattrotherstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Άλλα" #: tfrmsetfileproperties.lblattrownerstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Ιδιοκτήτης" #: tfrmsetfileproperties.lblattrtext.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "-----------" #: tfrmsetfileproperties.lblattrtextstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "Κείμενο:" #: tfrmsetfileproperties.lblexec.caption msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "Εκτέλεση" #: tfrmsetfileproperties.lblmodeinfo.caption msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION" msgid "(gray field means unchanged value)" msgstr "(γκρι πεδίο σημαίνει τιμή χωρίς αλλαγή)" #: tfrmsetfileproperties.lbloctal.caption msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "Octal:" #: tfrmsetfileproperties.lblread.caption msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "Ανάγνωση" #: tfrmsetfileproperties.lblwrite.caption msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "Εγγραφή" #: tfrmsplitter.btncancel.caption msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmsplitter.btnftchoice.caption msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION" msgid "..." msgstr "..." #: tfrmsplitter.btnok.caption msgctxt "TFRMSPLITTER.BTNOK.CAPTION" msgid "&OK" msgstr "&OK" #: tfrmsplitter.btnrelativeftchoice.hint msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT" msgid "Some functions to select appropriate path" msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής" #: tfrmsplitter.caption msgctxt "TFRMSPLITTER.CAPTION" msgid "Splitter" msgstr "Διαχωριστής" #: tfrmsplitter.cbrequireacrc32verificationfile.caption msgid "Require a CRC32 verification file" msgstr "Απαιτεί ένα αρχείο επιβεβαίωσης CRC32" #: tfrmsplitter.cmbxsize.text msgid "1457664B - 3.5\"" msgstr "1457664B - 3.5\"" #: tfrmsplitter.grbxfile.caption msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION" msgid "File name" msgstr "Ονομασία αρχείου" #: tfrmsplitter.grbxsize.caption msgid "Size and number of parts" msgstr "Μέγεθος και αριθμητικό πλήθος των τμημάτων" #: tfrmsplitter.lbdirtarget.caption msgid "Directory &target" msgstr "Στόχος Καταλόγου" #: tfrmsplitter.lbfilesource.caption msgid "File &source" msgstr "Πηγή Αρχείου" #: tfrmsplitter.lblnumberparts.caption msgid "&Number of parts" msgstr "Αριθμός τμημάτων" #: tfrmsplitter.rbtnbyte.caption msgid "&Bytes" msgstr "&Bytes" #: tfrmsplitter.rbtngigab.caption msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION" msgid "&Gigabytes" msgstr "&Gigabytes" #: tfrmsplitter.rbtnkilob.caption msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION" msgid "&Kilobytes" msgstr "&Kilobytes" #: tfrmsplitter.rbtnmegab.caption msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION" msgid "&Megabytes" msgstr "&Megabytes" #: tfrmstartingsplash.caption msgctxt "TFRMSTARTINGSPLASH.CAPTION" msgid "Double Commander" msgstr "Double Commander" #: tfrmstartingsplash.lblbuild.caption msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION" msgid "Build" msgstr "Εσωτερική Έκδοση" #: tfrmstartingsplash.lblfreepascalver.caption msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION" msgid "Free Pascal" msgstr "Free Pascal" #: tfrmstartingsplash.lbllazarusver.caption msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION" msgid "Lazarus" msgstr "Lazarus" #: tfrmstartingsplash.lbloperatingsystem.caption msgid "Operating System" msgstr "Λειτουργικό Σύστημα" #: tfrmstartingsplash.lblplatform.caption msgid "Platform" msgstr "Σύστημα" #: tfrmstartingsplash.lblrevision.caption msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION" msgid "Revision" msgstr "Αναθεωρημένη Έκδοση" #: tfrmstartingsplash.lbltitle.caption msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION" msgid "Double Commander" msgstr "Double Commander" #: tfrmstartingsplash.lblversion.caption msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION" msgid "Version" msgstr "Έκδοση" #: tfrmstartingsplash.lblwidgetsetver.caption msgid "WidgetsetVer" msgstr "WidgetsetVer" #: tfrmsymlink.btncancel.caption msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmsymlink.btnok.caption msgctxt "TFRMSYMLINK.BTNOK.CAPTION" msgid "&OK" msgstr "OK" #: tfrmsymlink.caption msgid "Create symbolic link" msgstr "Δημιουργία συμβολοδεσμού" #: tfrmsymlink.chkuserelativepath.caption msgid "Use &relative path when possible" msgstr "Χρήση &σχετικής διαδρομής όταν είναι δυνατό" #: tfrmsymlink.lblexistingfile.caption msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "Προορισμός τον οποίο θα υποδείξει ο δεσμός" #: tfrmsymlink.lbllinktocreate.caption msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "Όνομα Δεσμού" #: tfrmsyncdirsdlg.actselectclear.caption msgid "Remove selection" msgstr "" #: tfrmsyncdirsdlg.actselectcopydefault.caption msgid "Select for copying (default direction)" msgstr "" #: tfrmsyncdirsdlg.actselectcopylefttoright.caption msgid "Select for copying -> (left to right)" msgstr "" #: tfrmsyncdirsdlg.actselectcopyreverse.caption msgid "Reverse copy direction" msgstr "" #: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption msgid "Select for copying <- (right to left)" msgstr "" #: tfrmsyncdirsdlg.actselectdeleteright.caption msgid "Select for deleting -> (right)" msgstr "" #: tfrmsyncdirsdlg.btnclose.caption msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION" msgid "Close" msgstr "Κλείσιμο" #: tfrmsyncdirsdlg.btncompare.caption msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION" msgid "Compare" msgstr "Σύγκριση" #: tfrmsyncdirsdlg.btnseldir1.caption msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION" msgid ">>" msgstr ">>" #: tfrmsyncdirsdlg.btnseldir2.caption msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION" msgid ">>" msgstr ">>" #: tfrmsyncdirsdlg.btnsynchronize.caption msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption" msgid "Synchronize" msgstr "Συγχρονισμός" #: tfrmsyncdirsdlg.caption msgid "Synchronize directories" msgstr "Συγχρονισμός καταλόγων" #: tfrmsyncdirsdlg.cbextfilter.text msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT" msgid "*.*" msgstr "*.*" #: tfrmsyncdirsdlg.chkasymmetric.caption msgid "asymmetric" msgstr "Ασύμμετρο" #: tfrmsyncdirsdlg.chkbycontent.caption msgid "by content" msgstr "Ανά περιεχόμενο" #: tfrmsyncdirsdlg.chkignoredate.caption msgid "ignore date" msgstr "αγνόηση ημερομηνίας" #: tfrmsyncdirsdlg.chkonlyselected.caption msgid "only selected" msgstr "Μόνο το(α) επιλεγμένο(α)" #: tfrmsyncdirsdlg.chksubdirs.caption msgid "Subdirs" msgstr "Υποκατάλογοι" #: tfrmsyncdirsdlg.groupbox1.caption msgid "Show:" msgstr "Εμφάνιση:" #: tfrmsyncdirsdlg.headerdg.columns[0].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption" msgid "Name" msgstr "Όνομα" #: tfrmsyncdirsdlg.headerdg.columns[1].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption" msgid "Size" msgstr "Μέγεθος " #: tfrmsyncdirsdlg.headerdg.columns[2].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption" msgid "Date" msgstr "Ημερομηνία" #: tfrmsyncdirsdlg.headerdg.columns[3].title.caption msgid "<=>" msgstr "<=>" #: tfrmsyncdirsdlg.headerdg.columns[4].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption" msgid "Date" msgstr "Ημερομηνία" #: tfrmsyncdirsdlg.headerdg.columns[5].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption" msgid "Size" msgstr "Μέγεθος " #: tfrmsyncdirsdlg.headerdg.columns[6].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption" msgid "Name" msgstr "Όνομα" #: tfrmsyncdirsdlg.label1.caption msgid "(in main window)" msgstr "(στο κύριο παράθυρο)" #: tfrmsyncdirsdlg.menuitemcompare.caption msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION" msgid "Compare" msgstr "Σύγκριση" #: tfrmsyncdirsdlg.menuitemviewleft.caption msgid "View left" msgstr "Προβολή Αριστερά" #: tfrmsyncdirsdlg.menuitemviewright.caption msgid "View right" msgstr "Προβολή Δεξιά" #: tfrmsyncdirsdlg.sbcopyleft.caption msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION" msgid "<" msgstr "<" #: tfrmsyncdirsdlg.sbcopyright.caption msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION" msgid ">" msgstr ">" #: tfrmsyncdirsdlg.sbduplicates.caption msgid "duplicates" msgstr "Διπλότυπα" #: tfrmsyncdirsdlg.sbequal.caption msgid "=" msgstr "=" #: tfrmsyncdirsdlg.sbnotequal.caption msgid "!=" msgstr "!=" #: tfrmsyncdirsdlg.sbsingles.caption msgid "singles" msgstr "Μονά" #: tfrmsyncdirsdlg.statusbar1.panels[0].text msgid "Please press \"Compare\" to start" msgstr "Παρακαλώ πιέστε \"Σύγκριση\" για εκκίνηση" #: tfrmsyncdirsperformdlg.caption msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION" msgid "Synchronize" msgstr "Συγχρονισμός" #: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption msgid "Confirm overwrites" msgstr "Επιβεβαίωση αντικαταστημένων" #: tfrmtreeviewmenu.caption msgctxt "tfrmtreeviewmenu.caption" msgid "Tree View Menu" msgstr "Μενού Προβολής Δέντρου" #: tfrmtreeviewmenu.lblsearchingentry.caption msgid "Select your hot directory:" msgstr "Επιλογή Hot Directory:" #: tfrmtreeviewmenu.pmicasesensitive.caption msgid "Search is case sensitive" msgstr "Η Αναζήτηση γίνεται με διάκριση πεζών-κεφαλαίων" #: tfrmtreeviewmenu.pmifullcollapse.caption msgid "Full collapse" msgstr "Πλήρη Σύμπτυξη" #: tfrmtreeviewmenu.pmifullexpand.caption msgid "Full expand" msgstr "Πλήρη Διεύρυνση" #: tfrmtreeviewmenu.pmiignoreaccents.caption msgid "Search ignore accents and ligatures" msgstr "Αναζήτηση αγνόησης χρήσης τονισμού και διφθόγγων" #: tfrmtreeviewmenu.pminotcasesensitive.caption msgid "Search is not case sensitive" msgstr "Η Αναζήτηση δεν είναι με διάκριση πεζών-κεφαλαίων" #: tfrmtreeviewmenu.pminotignoreaccents.caption msgid "Search is strict regarding accents and ligatures" msgstr "Η Αναζήτηση αφορά αυστηρά και μόνο τονισμό και διφθόγγους" #: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption msgid "Don't show the branch content \"just\" because the searched string is found in the branche name" msgstr "Απαγόρευση προβολής περιεχομένου κλάδου \"μόνο και μόνο\" επειδή η ζητούμενη ακολουθία βρέθηκε στο όνομα κλάδου" #: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption msgid "If searched string is found in a branch name, show the whole branch even if elements don't match" msgstr "Αν η ζητούμενη ακολουθία βρέθηκε σε ένα όνομα κλάδου, προβολή όλου του κλάδου ακόμη και αν τα στοιχεία δεν ταιριάζουν" #: tfrmtreeviewmenu.tbcancelandquit.hint msgid "Close Tree View Menu" msgstr "Κλείσιμο Μενού Προβολής Δέντρου" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint" msgid "Configuration of Tree View Menu" msgstr "Ρύθμιση του Μενού Προβολής Δέντρου" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint" msgid "Configuration of Tree View Menu Colors" msgstr "Ρύθμιση Χρωμάτων Μενού Προβολής Δέντρου" #: tfrmtweakplugin.btnadd.caption msgid "A&dd new" msgstr "Προσθήκη νέου" #: tfrmtweakplugin.btncancel.caption msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "Ακύρωση" #: tfrmtweakplugin.btnchange.caption msgid "C&hange" msgstr "Αλλαγή" #: tfrmtweakplugin.btndefault.caption msgid "De&fault" msgstr "Προκαθορισμένα" #: tfrmtweakplugin.btnok.caption msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION" msgid "&OK" msgstr "OK" #: tfrmtweakplugin.btnremove.caption msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION" msgid "&Remove" msgstr "Αφαίρεση" #: tfrmtweakplugin.caption msgctxt "TFRMTWEAKPLUGIN.CAPTION" msgid "Tweak plugin" msgstr "Επεξεργασία προσθέτου" #: tfrmtweakplugin.cbpk_caps_by_content.caption msgid "De&tect archive type by content" msgstr "Εντοπισμός τύπου αρχειοθήκης από τα περιεχόμενα" #: tfrmtweakplugin.cbpk_caps_delete.caption msgid "Can de&lete files" msgstr "Δυνατότητα διαγραφής αρχείων" #: tfrmtweakplugin.cbpk_caps_encrypt.caption msgid "Supports e&ncryption" msgstr "Υποστηρίζει Κρυπτογράφηση" #: tfrmtweakplugin.cbpk_caps_hide.caption msgid "Sho&w as normal files (hide packer icon)" msgstr "Εμφάνιση ως κανονικά αρχεία (κρύψιμο εικονιδίου εφαρμογής πακεταρίσματος)" #: tfrmtweakplugin.cbpk_caps_mempack.caption msgid "Supports pac&king in memory" msgstr "Υποστήριξη πακεταρίσματος στη μνήμη" #: tfrmtweakplugin.cbpk_caps_modify.caption msgid "Can &modify existing archives" msgstr "Δυνατότητα τροποποίησης υπάρχοντων αρχείων" #: tfrmtweakplugin.cbpk_caps_multiple.caption msgid "&Archive can contain multiple files" msgstr "Η Αρχειοθήκη μπορεί να περιλαμβάνει πολλαπλά αρχεία" #: tfrmtweakplugin.cbpk_caps_new.caption msgid "Can create new archi&ves" msgstr "Δυνατότητα δημιουργίας νέων αρχείων" #: tfrmtweakplugin.cbpk_caps_options.caption msgid "S&upports the options dialogbox" msgstr "Υποστηρίζει το πλαίσιο διαλόγου ρυθμίσεων" #: tfrmtweakplugin.cbpk_caps_searchtext.caption msgid "Allow searchin&g for text in archives" msgstr "Επιτρέψτε αναζήτηση κειμένου στα αρχεία" #: tfrmtweakplugin.lbldescription.caption msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION" msgid "&Description:" msgstr "Περιγραφή:" #: tfrmtweakplugin.lbldetectstr.caption msgid "D&etect string:" msgstr "Εντοπισμός ακολουθίας:" #: tfrmtweakplugin.lblextension.caption msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION" msgid "&Extension:" msgstr "Επέκταση:" #: tfrmtweakplugin.lblflags.caption msgid "Flags:" msgstr "Σημαίες:" #: tfrmtweakplugin.lblname.caption msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION" msgid "&Name:" msgstr "Όνομα:" #: tfrmtweakplugin.lblplugin.caption msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION" msgid "&Plugin:" msgstr "Πρόσθετο:" #: tfrmtweakplugin.lblplugin1.caption msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION" msgid "&Plugin:" msgstr "Πρόσθετο:" #: tfrmviewer.actabout.caption msgctxt "TFRMVIEWER.ACTABOUT.CAPTION" msgid "About Viewer..." msgstr "Σχετικά με τον Προβολέα..." #: tfrmviewer.actabout.hint msgid "Displays the About message" msgstr "Εμφανίζει το \"Σχετικά\" μήνυμα" #: tfrmviewer.actchangeencoding.caption msgid "Change encoding" msgstr "Αλλαγή κωδικοποίησης" #: tfrmviewer.actcopyfile.caption msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION" msgid "Copy File" msgstr "Αντιγραφή Αρχείου" #: tfrmviewer.actcopyfile.hint msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT" msgid "Copy File" msgstr "Αντιγραφή Αρχείου" #: tfrmviewer.actcopytoclipboard.caption msgctxt "tfrmviewer.actcopytoclipboard.caption" msgid "Copy To Clipboard" msgstr "Αντιγραφή στο Πρόχειρο" #: tfrmviewer.actcopytoclipboardformatted.caption msgid "Copy To Clipboard Formatted" msgstr "Αντιγραφή στο Πρόχειρο μετά από Διαμόρφωση" #: tfrmviewer.actdeletefile.caption msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION" msgid "Delete File" msgstr "Διαγραφή Αρχείου" #: tfrmviewer.actdeletefile.hint msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT" msgid "Delete File" msgstr "Διαγραφή Αρχείου" #: tfrmviewer.actexitviewer.caption msgctxt "tfrmviewer.actexitviewer.caption" msgid "E&xit" msgstr "Έξοδος" #: tfrmviewer.actfind.caption msgctxt "tfrmviewer.actfind.caption" msgid "Find" msgstr "Εύρεση" #: tfrmviewer.actfindnext.caption msgctxt "tfrmviewer.actfindnext.caption" msgid "Find next" msgstr "Εύρεση επόμενου" #: tfrmviewer.actfindprev.caption msgctxt "tfrmviewer.actfindprev.caption" msgid "Find previous" msgstr "Εύρεση Προηγούμενου" #: tfrmviewer.actfullscreen.caption msgctxt "tfrmviewer.actfullscreen.caption" msgid "Full Screen" msgstr "Πλήρης Οθόνη" #: tfrmviewer.actimagecenter.caption msgctxt "tfrmviewer.actimagecenter.caption" msgid "Center" msgstr "Κέντρο" #: tfrmviewer.actloadnextfile.caption msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION" msgid "&Next" msgstr "Επόμενο" #: tfrmviewer.actloadnextfile.hint msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT" msgid "Load Next File" msgstr "Φόρτωση Επόμενου Αρχείου" #: tfrmviewer.actloadprevfile.caption msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION" msgid "&Previous" msgstr "Προηγούμενο" #: tfrmviewer.actloadprevfile.hint msgid "Load Previous File" msgstr "Φόρτωση Προηγούμενου Αρχείου" #: tfrmviewer.actmirrorhorz.caption msgid "Mirror Horizontally" msgstr "Αντικατοπτρισμός Οριζοντίως" #: tfrmviewer.actmirrorhorz.hint msgctxt "tfrmviewer.actmirrorhorz.hint" msgid "Mirror" msgstr "Καθρεφτισμός" #: tfrmviewer.actmirrorvert.caption msgid "Mirror Vertically" msgstr "Αντικατοπτρισμός Καθέτως" #: tfrmviewer.actmovefile.caption msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION" msgid "Move File" msgstr "Μετακίνηση Αρχείου" #: tfrmviewer.actmovefile.hint msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT" msgid "Move File" msgstr "Μετακίνηση Αρχείου" #: tfrmviewer.actpreview.caption msgctxt "tfrmviewer.actpreview.caption" msgid "Preview" msgstr "Προεπισκόπηση" #: tfrmviewer.actreload.caption msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION" msgid "Reload" msgstr "Επαναφόρτωση" #: tfrmviewer.actreload.hint msgid "Reload current file" msgstr "Επαναφόρτωση τρέχοντος αρχείου" #: tfrmviewer.actrotate180.caption msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION" msgid "+ 180" msgstr "+ 180" #: tfrmviewer.actrotate180.hint msgctxt "TFRMVIEWER.ACTROTATE180.HINT" msgid "Rotate 180 degrees" msgstr "Περιστροφή 180°" #: tfrmviewer.actrotate270.caption msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION" msgid "- 90" msgstr "- 90" #: tfrmviewer.actrotate270.hint msgctxt "TFRMVIEWER.ACTROTATE270.HINT" msgid "Rotate -90 degrees" msgstr "Περιστροφή -90°" #: tfrmviewer.actrotate90.caption msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION" msgid "+ 90" msgstr "+ 90" #: tfrmviewer.actrotate90.hint msgctxt "TFRMVIEWER.ACTROTATE90.HINT" msgid "Rotate +90 degrees" msgstr "Περιστροφή +90°" #: tfrmviewer.actsave.caption msgctxt "tfrmviewer.actsave.caption" msgid "Save" msgstr "Αποθήκευση " #: tfrmviewer.actsaveas.caption msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION" msgid "Save As..." msgstr "Αποθήκευση Ως..." #: tfrmviewer.actsaveas.hint msgid "Save File As..." msgstr "Αποθήκευση Αρχείου Ως..." #: tfrmviewer.actscreenshot.caption msgctxt "tfrmviewer.actscreenshot.caption" msgid "Screenshot" msgstr "Στιγμιότυπο Οθόνης" #: tfrmviewer.actscreenshotdelay3sec.caption msgid "Delay 3 sec" msgstr "Καθυστέρηση 3 δευτερόλεπτα" #: tfrmviewer.actscreenshotdelay5sec.caption msgid "Delay 5 sec" msgstr "Καθυστέρηση 5 δευτερόλεπτα" #: tfrmviewer.actselectall.caption msgctxt "tfrmviewer.actselectall.caption" msgid "Select All" msgstr "Επιλογή όλων" #: tfrmviewer.actshowasbin.caption msgctxt "tfrmviewer.actshowasbin.caption" msgid "Show as &Bin" msgstr "Εμφάνιση ως Δυαδικό" #: tfrmviewer.actshowasbook.caption msgctxt "tfrmviewer.actshowasbook.caption" msgid "Show as B&ook" msgstr "Εμφάνιση ως Βιβλίο" #: tfrmviewer.actshowasdec.caption msgid "Show as &Dec" msgstr "Προβολής ως Δεκαδικό" #: tfrmviewer.actshowashex.caption msgctxt "tfrmviewer.actshowashex.caption" msgid "Show as &Hex" msgstr "Εμφάνιση ως Δεκαεξαδικό" #: tfrmviewer.actshowastext.caption msgctxt "tfrmviewer.actshowastext.caption" msgid "Show as &Text" msgstr "Εμφάνιση ως Κείμενο" #: tfrmviewer.actshowaswraptext.caption msgctxt "tfrmviewer.actshowaswraptext.caption" msgid "Show as &Wrap text" msgstr "Εμφάνιση ως Αναδιπλούμενο Κείμενο" #: tfrmviewer.actshowgraphics.caption msgctxt "tfrmviewer.actshowgraphics.caption" msgid "Graphics" msgstr "Γραφικά" #: tfrmviewer.actshowplugins.caption msgctxt "tfrmviewer.actshowplugins.caption" msgid "Plugins" msgstr "Πρόσθετα" #: tfrmviewer.actstretchimage.caption msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION" msgid "Stretch" msgstr "Άπλωμα" #: tfrmviewer.actstretchimage.hint msgid "Stretch Image" msgstr "Άπλωμα Εικόνας" #: tfrmviewer.actstretchonlylarge.caption msgctxt "tfrmviewer.actstretchonlylarge.caption" msgid "Stretch only large" msgstr "Άπλωμα μόνο Μεγάλων" #: tfrmviewer.actzoom.caption msgid "Zoom" msgstr "Μεγέθυνση" #: tfrmviewer.actzoomin.caption msgctxt "tfrmviewer.actzoomin.caption" msgid "Zoom In" msgstr "Μεγέθυνση" #: tfrmviewer.actzoomout.caption msgctxt "tfrmviewer.actzoomout.caption" msgid "Zoom Out" msgstr "Μίκρυνση" #: tfrmviewer.btncopyfile.hint msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT" msgid "Copy" msgstr "Αντιγραφή" #: tfrmviewer.btncopyfile1.hint msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT" msgid "Copy" msgstr "Αντιγραφή" #: tfrmviewer.btncuttuimage.hint msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT" msgid "Crop" msgstr "Περικοπή" #: tfrmviewer.btndeletefile.hint msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT" msgid "Delete" msgstr "Διαγραφή" #: tfrmviewer.btndeletefile1.hint msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT" msgid "Delete" msgstr "Διαγραφή" #: tfrmviewer.btnfullscreen.hint msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT" msgid "Full Screen" msgstr "Πλήρης Οθόνη" #: tfrmviewer.btngifmove.caption msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION" msgid "||" msgstr "||" #: tfrmviewer.btngiftobmp.caption msgid "S" msgstr "S" #: tfrmviewer.btnhightlight.hint msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT" msgid "Highlight" msgstr "Υπογράμμιση" #: tfrmviewer.btnmovefile.hint msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT" msgid "Move" msgstr "Μετακίνηση" #: tfrmviewer.btnmovefile1.hint msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT" msgid "Move" msgstr "Μετακίνηση" #: tfrmviewer.btnnextgifframe.caption msgid "||>" msgstr "||>" #: tfrmviewer.btnpaint.hint msgctxt "TFRMVIEWER.BTNPAINT.HINT" msgid "Paint" msgstr "Ζωγραφική" #: tfrmviewer.btnprevgifframe.caption msgid "<||" msgstr "<||" #: tfrmviewer.btnredeye.hint msgid "Red Eyes" msgstr "Κόκκινα Μάτια" #: tfrmviewer.btnresize.hint msgctxt "TFRMVIEWER.BTNRESIZE.HINT" msgid "Resize" msgstr "Αλλαγή Μεγέθους" #: tfrmviewer.btnundo.hint msgctxt "TFRMVIEWER.BTNUNDO.HINT" msgid "Undo" msgstr "Αναίρεση" #: tfrmviewer.caption msgctxt "TFRMVIEWER.CAPTION" msgid "Viewer" msgstr "Προβολέας" #: tfrmviewer.cbslideshow.caption msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "Slide Show" #: tfrmviewer.comboboxpaint.text msgid "Pen" msgstr "Στυλό" #: tfrmviewer.comboboxwidth.text msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT" msgid "1" msgstr "1" #: tfrmviewer.gboxhightlight.caption msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION" msgid "Highlight" msgstr "Υπογράμμιση" #: tfrmviewer.gboxpaint.caption msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION" msgid "Paint" msgstr "Ζωγραφική" #: tfrmviewer.gboxslideshow.caption msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "Slide Show" #: tfrmviewer.gboxview.caption msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION" msgid "View" msgstr "Προβολή" #: tfrmviewer.lblhightlight.caption msgid "0x0" msgstr "0x0" #: tfrmviewer.miabout.caption msgctxt "TFRMVIEWER.MIABOUT.CAPTION" msgid "About" msgstr "Σχετικά" #: tfrmviewer.midiv1.caption msgctxt "TFRMVIEWER.MIDIV1.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv2.caption msgctxt "TFRMVIEWER.MIDIV2.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv3.caption msgctxt "TFRMVIEWER.MIDIV3.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv4.caption msgctxt "TFRMVIEWER.MIDIV4.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv5.caption msgctxt "TFRMVIEWER.MIDIV5.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.miedit.caption msgctxt "TFRMVIEWER.MIEDIT.CAPTION" msgid "&Edit" msgstr "Επεξεργασία" #: tfrmviewer.miencoding.caption msgctxt "TFRMVIEWER.MIENCODING.CAPTION" msgid "En&coding" msgstr "Κωδικοποίηση" #: tfrmviewer.mifile.caption msgctxt "TFRMVIEWER.MIFILE.CAPTION" msgid "&File" msgstr "Αρχείο" #: tfrmviewer.miimage.caption msgid "&Image" msgstr "Εικόνα" #: tfrmviewer.miprint.caption msgid "Print..." msgstr "Εκτύπωση..." #: tfrmviewer.mirotate.caption msgctxt "TFRMVIEWER.MIROTATE.CAPTION" msgid "Rotate" msgstr "Περιστροφή" #: tfrmviewer.miscreenshot.caption msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION" msgid "Screenshot" msgstr "Στιγμιότυπο Οθόνης" #: tfrmviewer.miseparator.caption msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.miview.caption msgctxt "TFRMVIEWER.MIVIEW.CAPTION" msgid "&View" msgstr "Προβολή" #: tfrmviewer.pmiselectall.caption msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION" msgid "Select All" msgstr "Επιλογή όλων" #: tfrmviewoperations.btnstartpause.caption #, fuzzy msgctxt "tfrmviewoperations.btnstartpause.caption" msgid "&Start" msgstr "Εκκίνηση" #: tfrmviewoperations.btnstop.caption msgid "S&top" msgstr "" #: tfrmviewoperations.caption #, fuzzy msgctxt "tfrmviewoperations.caption" msgid "File operations" msgstr "Λειτουργίες Αρχείου" #: tfrmviewoperations.cbalwaysontop.caption msgid "Always on top" msgstr "" #: tfrmviewoperations.lblusedragdrop.caption msgid "&Use \"drag && drop\" to move operations between queues" msgstr "" #: tfrmviewoperations.mnucanceloperation.caption #, fuzzy msgctxt "tfrmviewoperations.mnucanceloperation.caption" msgid "Cancel" msgstr "Ακύρωση" #: tfrmviewoperations.mnucancelqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnucancelqueue.caption" msgid "Cancel" msgstr "Ακύρωση" #: tfrmviewoperations.mnunewqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnunewqueue.caption" msgid "New queue" msgstr "Νέα ουρά" #: tfrmviewoperations.mnuoperationshowdetached.caption msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption" msgid "Show in detached window" msgstr "" #: tfrmviewoperations.mnuputfirstinqueue.caption msgid "Put first in queue" msgstr "" #: tfrmviewoperations.mnuputlastinqueue.caption msgid "Put last in queue" msgstr "" #: tfrmviewoperations.mnuqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue.caption" msgid "Queue" msgstr "Ουρά" #: tfrmviewoperations.mnuqueue0.caption msgid "Out of queue" msgstr "" #: tfrmviewoperations.mnuqueue1.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue1.caption" msgid "Queue 1" msgstr "Ουρά 1" #: tfrmviewoperations.mnuqueue2.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue2.caption" msgid "Queue 2" msgstr "Ουρά 2" #: tfrmviewoperations.mnuqueue3.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue3.caption" msgid "Queue 3" msgstr "Ουρά 3" #: tfrmviewoperations.mnuqueue4.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue4.caption" msgid "Queue 4" msgstr "Ουρά 4" #: tfrmviewoperations.mnuqueue5.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue5.caption" msgid "Queue 5" msgstr "Ουρά 5" #: tfrmviewoperations.mnuqueueshowdetached.caption msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption" msgid "Show in detached window" msgstr "" #: tfrmviewoperations.tbpauseall.caption msgid "&Pause all" msgstr "" #: tmultiarchivecopyoperationoptionsui.lblfileexists.caption msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "Όταν το αρχείο υπάρχει" #: twcxarchivecopyoperationoptionsui.lblfileexists.caption msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "Όταν το αρχείο υπάρχει" #: twfxplugincopymoveoperationoptionsui.cbcopytime.caption msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "Αντιγραφή ημερομηνίας/ώρας" #: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption msgid "Work in background (separate connection)" msgstr "Εργασία στο παρασκήνιο (ξεχωριστή σύνδεση)" #: twfxplugincopymoveoperationoptionsui.lblfileexists.caption msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "Όταν το αρχείο υπάρχει" #: uexifreader.rsdatetimeoriginal msgid "Date taken" msgstr "Ημερομηνία πρόσληψης" #: uexifreader.rsimageheight msgctxt "uexifreader.rsimageheight" msgid "Height" msgstr "Ύψος" #: uexifreader.rsimagewidth msgctxt "uexifreader.rsimagewidth" msgid "Width" msgstr "Πλάτος" #: uexifreader.rsmake msgid "Manufacturer" msgstr "Κατασκευαστής" #: uexifreader.rsmodel msgid "Camera model" msgstr "Μοντέλο Κάμερας" #: uexifreader.rsorientation msgid "Orientation" msgstr "Προσανατολισμός" #: ulng.msgtrytolocatecrcfile msgid "" "This file cannot be found and could help to validate final combination of files:\n" "%s\n" "\n" "Could you make it available and press \"OK\" when ready,\n" "or press \"CANCEL\" to continue without it?\n" msgstr "" "Αυτό το αρχείο δε μπορεί να βρεθεί και αυτό θα μπορούσε να βοηθήσει στην επικύρωση του τελικού συνδυασμού αρχείων:\n" "%s\n" "\n" "Θα μπορούσατε να το κάνετε διαθέσιμο πιέζοντας \"ΟΚ\"όταν είστε έτοιμοι,\n" "ή πιέστε \"Ακύρωση\" για να συνεχίσετε χωρίς αυτό;\n" #: ulng.rscancelfilter msgid "Cancel Quick Filter" msgstr "Ακύρωση Γρήγορου Φίλτρου" #: ulng.rscanceloperation msgid "Cancel Current Operation" msgstr "Ακύρωση Τρέχουσας Λειτουργίας" #: ulng.rscaptionforaskingfilename msgid "Enter filename, with extension, for dropped text" msgstr "Εισαγωγή ονόματος αρχείου, με επέκταση, για το εναποθετημένο κείμενο" #: ulng.rscaptionfortextformattoimport msgid "Text format to import" msgstr "Τύπος Κειμένου προς εισαγωγή" #: ulng.rschecksumverifybroken msgid "Broken:" msgstr "Κατεστραμμένο:" #: ulng.rschecksumverifygeneral msgid "General:" msgstr "Γενικά:" #: ulng.rschecksumverifymissing msgid "Missing:" msgstr "Λείπει:" #: ulng.rschecksumverifyreaderror msgid "Read error:" msgstr "Λάθος Ανάγνωσης: " #: ulng.rschecksumverifysuccess msgid "Success:" msgstr "Επιτυχία:" #: ulng.rschecksumverifytext msgid "Enter checksum and select algorithm:" msgstr "Εισαγωγή αθροίσματος ελέγχου και επιλογή αλγόριθμου:" #: ulng.rschecksumverifytitle msgid "Verify checksum" msgstr "Επιβεβαίωση αθροίσματος ελέγχου" #: ulng.rschecksumverifytotal msgid "Total:" msgstr "Συνολικά:" #: ulng.rsclearfiltersornot msgid "Do you want to clear filters for this new search?" msgstr "Επιθυμείτε το καθαρισμό φίλτρων για αυτή τη νέα αναζήτηση;" #: ulng.rsclipboardcontainsinvalidtoolbardata msgid "Clipboard doesn't contain any valid toolbar data." msgstr "Το Πρόχειρο δεν περιέχει κάποια έγκυρα δεδομένα γραμμής εργαλείων." #: ulng.rscmdcategorylistinorder msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log" msgstr "Όλα;Ενεργό Πάνελ;Αριστερό Πάνελ;Δεξιό Πάνελ;Εργασίες Αρχείου;Ρύθμιση;Δίκτυο;Διάφορα;Παράλληλη Πόρτα;Εκτύπωση;Επιλογέας;Ασφάλεια;Πρόχειρο;FTP;Πλοήγηση;Βοήθεια;Παράθυρο;Γραμμή Εντολών;Εργαλεία;Προβολή;Χρήστης;Καρτέλες;Διάταξη;Καταγραφή" #: ulng.rscmdkindofsort msgid "Legacy sorted;A-Z sorted" msgstr "Ταξινόμηση της Legacy ;Α-Ω ταξινόμηση" #: ulng.rscolattr msgid "Attr" msgstr "Ιδιότητα" #: ulng.rscoldate msgctxt "ulng.rscoldate" msgid "Date" msgstr "Ημερομηνία" #: ulng.rscolext msgid "Ext" msgstr "Εξωτερικό" #: ulng.rscolname msgctxt "ulng.rscolname" msgid "Name" msgstr "Όνομα" #: ulng.rscolsize msgctxt "ulng.rscolsize" msgid "Size" msgstr "Μέγεθος" #: ulng.rsconfcolalign msgid "Align" msgstr "Ευθυγράμμιση" #: ulng.rsconfcolcaption msgid "Caption" msgstr "Σύλληψη" #: ulng.rsconfcoldelete msgctxt "ulng.rsconfcoldelete" msgid "Delete" msgstr "Διαγραφή" #: ulng.rsconfcolfieldcont msgid "Field contents" msgstr "Περιεχόμενα Πεδίου" #: ulng.rsconfcolmove msgctxt "ulng.rsconfcolmove" msgid "Move" msgstr "Μετακίνηση" #: ulng.rsconfcolwidth msgctxt "ulng.rsconfcolwidth" msgid "Width" msgstr "Πλάτος" #: ulng.rsconfcustheader msgid "Customize column" msgstr "Προσαρμογή στήλης" #: ulng.rsconfigurationfileassociation msgid "Configure file association" msgstr "Διαμόρφωση συσχετισμού αρχείων" #: ulng.rsconfirmexecution msgid "Confirming command line and parameters" msgstr "Επιβεβαίωση της γραμμής εντολών και παραμέτρων" #: ulng.rscopynametemplate msgid "Copy (%d) %s" msgstr "Αντιγραφή (%d) %s" #: ulng.rsdefaultimporteddctoolbarhint msgid "Imported DC toolbar" msgstr "Εισαγμένη σειρά Εργαλείων του DC" #: ulng.rsdefaultimportedtctoolbarhint msgid "Imported TC toolbar" msgstr "Εισαγμένη σειρά Εργαλείων του TC" #: ulng.rsdefaultsuffixdroppedtext msgid "_DroppedText" msgstr "_ΕναποθετημένοΚείμενο" #: ulng.rsdefaultsuffixdroppedtexthtmlfilename msgid "_DroppedHTMLtext" msgstr "_ΕναποθετημένοHTMLκείμενο" #: ulng.rsdefaultsuffixdroppedtextrichtextfilename msgid "_DroppedRichtext" msgstr "_ΕναποθετημένοΠλούσιοκείμενο" #: ulng.rsdefaultsuffixdroppedtextsimplefilename msgid "_DroppedSimpleText" msgstr "_ΕναποθετημένοΑπλόΚείμενο" #: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename msgid "_DroppedUnicodeUTF16text" msgstr "_ΕναποθετημένοUnicodeUTF16κείμενο" #: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename msgid "_DroppedUnicodeUTF8text" msgstr "_ΕναποθετημένοUnicodeUTF8κείμενο" #: ulng.rsdiffadds msgid " Adds: " msgstr "Προσθέτει:" #: ulng.rsdiffdeletes msgid " Deletes: " msgstr "Διαγραφή:" #: ulng.rsdifffilesidentical msgid "The two files are identical!" msgstr "Τα δύο αρχεία είναι όμοια!" #: ulng.rsdiffmatches msgid " Matches: " msgstr "Αντιστοιχίσεις:" #: ulng.rsdiffmodifies msgid " Modifies: " msgstr "Μεταβολές:" #: ulng.rsdlgbuttonabort msgid "Ab&ort" msgstr "Απόρριψη" #: ulng.rsdlgbuttonall msgctxt "ulng.rsdlgbuttonall" msgid "A&ll" msgstr "Όλα" #: ulng.rsdlgbuttonappend msgid "A&ppend" msgstr "Επισύναψη" #: ulng.rsdlgbuttonautorenamesource msgid "A&uto-rename source files" msgstr "Αυτόματη ονομασία πηγαίων αρχείων" #: ulng.rsdlgbuttoncancel msgctxt "ulng.rsdlgbuttoncancel" msgid "&Cancel" msgstr "Ακύρωση" #: ulng.rsdlgbuttoncompare msgid "Compare &by content" msgstr "" #: ulng.rsdlgbuttoncontinue msgid "&Continue" msgstr "Συνέχιση" #: ulng.rsdlgbuttoncopyinto msgid "&Merge" msgstr "Συγχώνευση" #: ulng.rsdlgbuttoncopyintoall msgid "Mer&ge All" msgstr "Συγχώνευση Όλων" #: ulng.rsdlgbuttonexitprogram msgid "E&xit program" msgstr "Έξοδος προγράμματος" #: ulng.rsdlgbuttonignore msgid "Ig&nore" msgstr "Αγνόηση" #: ulng.rsdlgbuttonignoreall msgid "I&gnore All" msgstr "Αγνόηση όλων" #: ulng.rsdlgbuttonno msgid "&No" msgstr "Όχι" #: ulng.rsdlgbuttonnone msgid "Non&e" msgstr "Κανένα" #: ulng.rsdlgbuttonok msgctxt "ulng.rsdlgbuttonok" msgid "&OK" msgstr "OK" #: ulng.rsdlgbuttonother msgid "Ot&her" msgstr "Άλλα" #: ulng.rsdlgbuttonoverwrite msgid "&Overwrite" msgstr "Αντικατάσταση" #: ulng.rsdlgbuttonoverwriteall msgid "Overwrite &All" msgstr "Αντικατάσταση Όλων" #: ulng.rsdlgbuttonoverwritelarger msgid "Overwrite All &Larger" msgstr "Αντικατάσταση Όλων των Μεγαλύτερων" #: ulng.rsdlgbuttonoverwriteolder msgid "Overwrite All Ol&der" msgstr "Αντικατάσταση Όλων των Παλαιοτέρων" #: ulng.rsdlgbuttonoverwritesmaller msgid "Overwrite All S&maller" msgstr "Αντικατάσταση Όλων των Μικρότερων" #: ulng.rsdlgbuttonrename msgctxt "ulng.rsdlgbuttonrename" msgid "R&ename" msgstr "Μετονομασία" #: ulng.rsdlgbuttonresume msgid "&Resume" msgstr "Ολοκλήρωση" #: ulng.rsdlgbuttonretry msgid "Re&try" msgstr "Επαναπροσπάθεια" #: ulng.rsdlgbuttonretryadmin msgid "As Ad&ministrator" msgstr "Ως Διαχειριστής" #: ulng.rsdlgbuttonskip msgid "&Skip" msgstr "Παράβλεψη" #: ulng.rsdlgbuttonskipall msgid "S&kip All" msgstr "Παράβλεψη Όλων" #: ulng.rsdlgbuttonyes msgid "&Yes" msgstr "Ναι" #: ulng.rsdlgcp msgctxt "ulng.rsdlgcp" msgid "Copy file(s)" msgstr "Αντιγραφή αρχείου(ων)" #: ulng.rsdlgmv msgid "Move file(s)" msgstr "Μετακίνηση αρχείου(ων)" #: ulng.rsdlgoppause msgctxt "ulng.rsdlgoppause" msgid "Pau&se" msgstr "Παύση" #: ulng.rsdlgopstart msgctxt "ulng.rsdlgopstart" msgid "&Start" msgstr "Εκκίνηση" #: ulng.rsdlgqueue msgctxt "ulng.rsdlgqueue" msgid "Queue" msgstr "Ουρά" #: ulng.rsdlgspeed msgid "Speed %s/s" msgstr "Ταχύτητα %s/s" #: ulng.rsdlgspeedtime msgid "Speed %s/s, time remaining %s" msgstr "Ταχύτητα %s/s, εναπομένων χρόνος %s" #: ulng.rsdraganddroptextformat msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format" msgstr "Μορφή Rich Text;Μορφή HTML;Μορφή Unicode;Μορφή Απλού Κειμένου" #: ulng.rsdrivenolabel msgid "" msgstr "<χωρίς ετικέτα>" #: ulng.rsdrivenomedia msgid "" msgstr "<χωρίς μέσο>" #: ulng.rseditabouttext msgid "Internal Editor of Double Commander." msgstr "Εσωτερικός επεξεργαστής του Double Commander." #: ulng.rseditgotolinequery msgid "Goto line:" msgstr "Μετάβαση στη γραμμή:" #: ulng.rseditgotolinetitle msgctxt "ulng.rseditgotolinetitle" msgid "Goto Line" msgstr "Μετάβαση στη γραμμή" #: ulng.rseditnewfile msgid "new.txt" msgstr "new.txt" #: ulng.rseditnewfilename msgid "Filename:" msgstr "Όνομα αρχείου:" #: ulng.rseditnewopen msgid "Open file" msgstr "Άνοιγμα Αρχείου" #: ulng.rseditsearchback msgid "&Backward" msgstr "Πίσω" #: ulng.rseditsearchcaption msgctxt "ulng.rseditsearchcaption" msgid "Search" msgstr "Αναζήτηση" #: ulng.rseditsearchfrw msgid "&Forward" msgstr "Μπροστά" #: ulng.rseditsearchreplace msgctxt "ulng.rseditsearchreplace" msgid "Replace" msgstr "Αντικατάσταση" #: ulng.rseditwithexternaleditor msgid "with external editor" msgstr "με εξωτερικό επεξεργαστή" #: ulng.rseditwithinternaleditor msgid "with internal editor" msgstr "με εσωτερικό επεξεργαστή" #: ulng.rsexecuteviashell msgctxt "ulng.rsexecuteviashell" msgid "Execute via shell" msgstr "Εκτέλεση μέσω κελύφους" #: ulng.rsexecuteviaterminalclose msgctxt "ulng.rsexecuteviaterminalclose" msgid "Execute via terminal and close" msgstr "Εκτέλεση μέσω τερματικού και κλείσιμό του" #: ulng.rsexecuteviaterminalstayopen msgctxt "ulng.rsexecuteviaterminalstayopen" msgid "Execute via terminal and stay open" msgstr "Εκτέλεση μέσω τερματικού και παραμονή αυτού ανοικτό" #: ulng.rsfavtabspanelsideselection msgid "Left;Right;Active;Inactive;Both;None" msgstr "Αριστερά;Δεξιά;Ενεργό;Ανενεργό;Και τα δύο;Κανένα" #: ulng.rsfavtabssavedirhistory msgid "No;Yes" msgstr "Όχι;Ναι" #: ulng.rsfilenameexportedtcbarprefix msgid "Exported_from_DC" msgstr "Έχει_Εξαχθεί_από_DC" #: ulng.rsfileopdirectoryexistsoptions msgid "Ask;Merge;Skip" msgstr "Ερώτηση;Συγχώνευση;Παράβλεψη" #: ulng.rsfileopfileexistsoptions msgid "Ask;Overwrite;Overwrite Older;Skip" msgstr "Ερώτηση;Αντικατάσταση;Αντικατάσταση παλαιότερων;Παράβλεψη" #: ulng.rsfileopsetpropertyerroroptions msgctxt "ulng.rsfileopsetpropertyerroroptions" msgid "Ask;Don't set anymore;Ignore errors" msgstr "Ερώτηση;Όχι επιπλέον καθορισμός;Αγνόηση λαθών" #: ulng.rsfilterstatus msgid "FILTER" msgstr "ΦΙΛΤΡΟ" #: ulng.rsfinddefinetemplate msgid "Define template" msgstr "Καθορισμός προτύπου" #: ulng.rsfinddepth msgid "%s level(s)" msgstr "%s επίπεδο(α)" #: ulng.rsfinddepthall msgid "all (unlimited depth)" msgstr "όλα (απεριόριστο εύρος)" #: ulng.rsfinddepthcurdir msgid "current dir only" msgstr "τρέχων κατάλογος μόνο" #: ulng.rsfinddirnoex msgid "Directory %s does not exist!" msgstr "Ο Κατάλογος %s δεν υπάρχει!" #: ulng.rsfindfound msgctxt "ulng.rsfindfound" msgid "Found: %d" msgstr "Βρέθηκαν: %d" #: ulng.rsfindsavetemplatecaption msgid "Save search template" msgstr "Αποθήκευση αναζήτησης προτύπου" #: ulng.rsfindsavetemplatetitle msgid "Template name:" msgstr "Όνομα Προτύπου:" #: ulng.rsfindscanned msgctxt "ulng.rsfindscanned" msgid "Scanned: %d" msgstr "Έχουν Σαρωθεί: %d" #: ulng.rsfindscanning msgid "Scanning" msgstr "Σάρωση" #: ulng.rsfindsearchfiles msgctxt "ulng.rsfindsearchfiles" msgid "Find files" msgstr "Εύρεση αρχείων" #: ulng.rsfindtimeofscan msgid "Time of scan: " msgstr "Ώρα σάρωσης:" #: ulng.rsfindwherebeg msgid "Begin at" msgstr "Αρχή σε" #: ulng.rsfreemsg msgid "Free %s from %s bytes" msgstr "Ελεύθερα %s από %s bytes" #: ulng.rsfreemsgshort msgid "%s bytes free" msgstr "%s bytes ελεύθερα" #: ulng.rsfuncatime msgid "Access date/time" msgstr "Πρόσβαση ημερομηνίας/ώρας" #: ulng.rsfuncattr msgctxt "ulng.rsfuncattr" msgid "Attributes" msgstr "Ιδιότητες" #: ulng.rsfunccomment msgctxt "ulng.rsfunccomment" msgid "Comment" msgstr "Σχόλιο" #: ulng.rsfunccompressedsize msgid "Compressed size" msgstr "Συμπιεσμένο μέγεθος" #: ulng.rsfuncctime msgid "Creation date/time" msgstr "Δημιουργία ημερομηνίας/ώρας" #: ulng.rsfuncext msgid "Extension" msgstr "Επέκταση" #: ulng.rsfuncgroup msgctxt "ulng.rsfuncgroup" msgid "Group" msgstr "Γκρουπ" #: ulng.rsfunchtime msgid "Change date/time" msgstr "Αλλαγή ημερομηνίας/ώρας" #: ulng.rsfunclinkto msgid "Link to" msgstr "Δεσμός σε" #: ulng.rsfuncmtime msgid "Modification date/time" msgstr "Αλλαγή Ημερομηνίας/Ώρας" #: ulng.rsfuncname msgctxt "ulng.rsfuncname" msgid "Name" msgstr "Όνομα" #: ulng.rsfuncnamenoext msgid "Name without extension" msgstr "Όνομα χωρίς επέκταση" #: ulng.rsfuncowner msgctxt "ulng.rsfuncowner" msgid "Owner" msgstr "Ιδιοκτήτης" #: ulng.rsfuncpath msgctxt "ulng.rsfuncpath" msgid "Path" msgstr "Διαδρομή" #: ulng.rsfuncsize msgctxt "ulng.rsfuncsize" msgid "Size" msgstr "Μέγεθος" #: ulng.rsfunctype msgid "Type" msgstr "Τύπος" #: ulng.rsharderrcreate msgid "Error creating hardlink." msgstr "Λάθος στη δημιουργία δεσμού τύπου hardlink." #: ulng.rshotdirforcesortingorderchoices msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9" msgstr "κανένα;Όνομα, α-ω;Όνομα, ω-α;Εξωτ, α-ω;Εξωτ, ω-α;Μέγεθος 9-0;Μέγεθος 0-9;Ημέρα 9-0;Ημέρα 0-9" #: ulng.rshotdirwarningabortrestorebackup msgid "" "Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n" "\n" "Are you sure you want to proceed?\n" msgstr "" "Προσοχή! Κατά την αποκατάσταση ενός .hotlist αντιγράφου, θα διαγραφεί η υπάρχουσα λίστα για να αντικατασταθεί από την σημαντική.\n" "\n" "Είστε σίγουροι οτι επιθυμείτε να συνεχίσετε;\n" #: ulng.rshotkeycategorycopymovedialog msgid "Copy/Move Dialog" msgstr "Διάλογος Αντιγραφής/Μετακίνησης" #: ulng.rshotkeycategorydiffer msgctxt "ulng.rshotkeycategorydiffer" msgid "Differ" msgstr "Differ" #: ulng.rshotkeycategoryeditcommentdialog msgid "Edit Comment Dialog" msgstr "Επεξεργασία Διαλόγου Σχολίου" #: ulng.rshotkeycategoryeditor msgctxt "ulng.rshotkeycategoryeditor" msgid "Editor" msgstr "Επεξεργαστής" #: ulng.rshotkeycategoryfindfiles msgctxt "ulng.rshotkeycategoryfindfiles" msgid "Find files" msgstr "Εύρεση αρχείων" #: ulng.rshotkeycategorymain msgid "Main" msgstr "Κυρίως" #: ulng.rshotkeycategorysyncdirs msgid "Synchronize Directories" msgstr "" #: ulng.rshotkeycategoryviewer msgctxt "ulng.rshotkeycategoryviewer" msgid "Viewer" msgstr "Προβολέας" #: ulng.rshotkeyfilealreadyexists msgid "" "A setup with that name already exists.\n" "Do you want to overwrite it?\n" msgstr "" "Μια εγκατάσταση με αυτή την ονομασία υπάρχει ήδη.\n" "Επιθυμείτε αντικατάστασή της;\n" #: ulng.rshotkeyfileconfirmdefault msgid "Are you sure you want to restore default?" msgstr "Είστε σίγουροι ότι επιθυμείτε αποκατάσταση των προκαθορισμένων;" #: ulng.rshotkeyfileconfirmerasure msgid "Are you sure you want to erase setup \"%s\"?" msgstr "Είστε σίγουροι ότι επιθυμείτε διαγραφή της εγκατάστασης των \"%s\";" #: ulng.rshotkeyfilecopyof msgid "Copy of %s" msgstr "Αντιγραφή των %s" #: ulng.rshotkeyfileinputnewname msgid "Input your new name" msgstr "Εισάγετε τη νέα σας ονομασία" #: ulng.rshotkeyfilemustkeepone msgid "You must keep at least one shortcut file." msgstr "Πρέπει να διατηρηθεί τουλάχιστο ένα αρχείο συντόμευσης." #: ulng.rshotkeyfilenewname msgid "New name" msgstr "Νέα Ονομασία" #: ulng.rshotkeyfilesavemodified msgid "" "\"%s\" setup has been modified.\n" "Do you want to save it now?\n" msgstr "" "\"%s\" Εγκαταστάσεις έχουν αλλάξει.\n" "Επιθυμείτε αποθήκευση;\n" #: ulng.rshotkeynoscenter msgid "No shortcut with \"ENTER\"" msgstr "Δεν υπάρχει συντόμευση για \"ENTER\"" #: ulng.rshotkeysortorder msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)" msgstr "Βάσει ονόματος εντολής;Βάσει κουμπιού συντόμευσης (ομαδοποιημένα);Βάσει κουμπιού συντόμευσης (ένα σε κάθε σειρά)" #: ulng.rsimporttoolbarproblem msgid "Cannot find reference to default bar file" msgstr "Αδυναμία εύρεσης αναφοράς στο προκαθορισμένο αρχείο γραμμής εργαλείων" #: ulng.rslistoffindfileswindows msgid "List of \"Find files\" windows" msgstr "Λίστα παραθύρων \"Αναζήτηση Αρχείων\"" #: ulng.rsmarkminus msgid "Unselect mask" msgstr "Αποεπιλογή Μάσκας" #: ulng.rsmarkplus msgid "Select mask" msgstr "Επιλογή μάσκας" #: ulng.rsmaskinput msgid "Input mask:" msgstr "Εισαγωγή μάσκας:" #: ulng.rsmenuconfigurecolumnsalreadyexists msgid "A columns view with that name already exists." msgstr "Μία προβολή στηλών με αυτό το όνομα ήδη υπάρχει" #: ulng.rsmenuconfigurecolumnssavetochange msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one" msgstr "Για να αλλάξετε την τρέχουσα ρύθμιση προβολής στηλών, κάντε ΑΠΟΘΗΚΕΥΣΗ, ΑΝΤΙΓΡΑΦΗ ή ΔΙΑΓΡΑΦΗ τρέχουσας ρύθμισης" #: ulng.rsmenuconfigurecustomcolumns msgid "Configure custom columns" msgstr "Διαμόρφωση εξατομικευμένων στηλών" #: ulng.rsmenuconfigureentercustomcolumnname msgid "Enter new custom columns name" msgstr "Εισάγετε νέα προσαρμοσμένα χρώματα στηλών" #: ulng.rsmnuactions msgctxt "ulng.rsmnuactions" msgid "Actions" msgstr "Ενέργειες" #: ulng.rsmnucontentdefault msgid "" msgstr "<Προκαθορισμένα>" #: ulng.rsmnucontentoctal msgid "Octal" msgstr "Octal" #: ulng.rsmnucopynetnamestoclip msgid "Copy names with UNC path" msgstr "Αντιγραφή ονομάτων με UNC διαδρομή" #: ulng.rsmnudisconnectnetworkdrive msgid "Disconnect Network Drive..." msgstr "Αποσύνδεση Δικτυακού Οδηγού..." #: ulng.rsmnuedit msgctxt "ulng.rsmnuedit" msgid "Edit" msgstr "Επεξεργασία" #: ulng.rsmnueject msgid "Eject" msgstr "Εξαγωγή" #: ulng.rsmnuextracthere msgid "Extract here..." msgstr "Εξαγωγή εδώ..." #: ulng.rsmnumapnetworkdrive msgid "Map Network Drive..." msgstr "Σχεδιασμός Δικτυακού Οδηγού..." #: ulng.rsmnumount msgid "Mount" msgstr "Προσάρτηση" #: ulng.rsmnunew msgctxt "ulng.rsmnunew" msgid "New" msgstr "Νέο" #: ulng.rsmnunomedia msgid "No media available" msgstr "Δεν υπάρχει διαθέσιμο Μέσο" #: ulng.rsmnuopen msgctxt "ulng.rsmnuopen" msgid "Open" msgstr "Άνοιγμα" #: ulng.rsmnuopenwith msgid "Open with" msgstr "Άνοιγμα με" #: ulng.rsmnuopenwithother msgctxt "ulng.rsmnuopenwithother" msgid "Other..." msgstr "Άλλα..." #: ulng.rsmnupackhere msgid "Pack here..." msgstr "Πακετάρισμα εδώ..." #: ulng.rsmnusortby msgid "Sort by" msgstr "Ταξινόμηση κατά" #: ulng.rsmnuumount msgid "Unmount" msgstr "Αποπροσάρτηση" #: ulng.rsmnuview msgctxt "ulng.rsmnuview" msgid "View" msgstr "Προβολή" #: ulng.rsmsgaccount msgid "Account:" msgstr "Λογαριασμός:" #: ulng.rsmsgalldcintcmds msgid "All Double Commander internal commands" msgstr "Όλες οι εσωτερικές εντολές του Double Commander" #: ulng.rsmsgarchivercustomparams msgid "Additional parameters for archiver command-line:" msgstr "Επιπρόσθετες παράμετροι για τη γραμμή εντολών του προγράμματος συμπίεσης:" #: ulng.rsmsgaskquoteornot msgid "Do you want to enclose between quotes?" msgstr "Επιθυμείτε να εισαχθεί μεταξύ εισαγωγικών;" #: ulng.rsmsgbadcrc32 msgid "" "Bad CRC32 for resulting file:\n" "\"%s\"\n" "\n" "Do you want to keep the resulting corrupted file anyway?\n" msgstr "" "Κακό CRC32 για τελικό αρχείο:\n" "\"%s\"\n" "\n" "Επιθυμείτε να κρατήσετε το κατεστραμμένο τελικό αρχείο ως έχει;\n" #: ulng.rsmsgcannotcopymoveitself msgid "You can not copy/move a file \"%s\" to itself!" msgstr "Δεν μπορείτε να αντιγράψετε/μετακινήσετε ένα αρχείο \"%s\" σε αυτό το ίδιο!" #: ulng.rsmsgcannotdeletedirectory msgid "Cannot delete directory %s" msgstr "Αδυναμία διαγραφής καταλόγου %s" #: ulng.rsmsgcannotoverwritedirectory msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\"" msgstr "Δεν είναι δυνατή η αντικατάσταση του καταλόγου \"%s\" με τον μη-κατάλογο \"%s\"" #: ulng.rsmsgchdirfailed msgid "ChDir to [%s] failed!" msgstr "ChDir σε [%s] απέτυχε!" #: ulng.rsmsgcloseallinactivetabs msgid "Remove all inactive tabs?" msgstr "Αφαίρεση όλων των ανενεργών καρτελών;" #: ulng.rsmsgcloselockedtab msgid "This tab (%s) is locked! Close anyway?" msgstr "Αυτή η καρτέλα (%s) είναι κλειδωμένη! Κλείσιμο ως έχει;" #: ulng.rsmsgcofirmuserparam msgid "Confirmation of parameter" msgstr "Επιβεβαίωση της παραμέτρου" #: ulng.rsmsgconfirmquit msgid "Are you sure you want to quit?" msgstr "Είστε σίγουροι οτι επιθυμείτε έξοδο;" #: ulng.rsmsgcopybackward msgid "The file %s has changed. Do you want to copy it backward?" msgstr "Το αρχείο %s έχει αλλάξει. Επιθυμείτε να το αντιγράψετε αντίστροφα;" #: ulng.rsmsgcouldnotcopybackward msgid "Could not copy backward - do you want to keep the changed file?" msgstr "Αδυναμία αντίστροφης αντιγραφής - επιθυμείτε να διατηρήσετε το αλλαγμένο αρχείο;" #: ulng.rsmsgcpfldr msgid "Copy %d selected files/directories?" msgstr "Αντιγραφή %d επιλεγμένων αρχείων/καταλόγων;" #: ulng.rsmsgcpsel msgid "Copy selected \"%s\"?" msgstr "Αντιγραφή επιλεγμένου \"%s\";" #: ulng.rsmsgcreateanewfiletype msgid "< Create a new file type \"%s files\" >" msgstr "< Δημιουργία ενός νέου τύπου αρχείου \"%s αρχεία\" >" #: ulng.rsmsgdctoolbarwheretosave msgid "Enter location and filename where to save a DC Toolbar file" msgstr "Εισάγετε τοποθεσία και όνομα αρχείου που θα αποθηκευθεί το αρχείο γραμμής εργαλείων του DC" #: ulng.rsmsgdefaultcustomactionname msgid "Custom action" msgstr "Προσαρμοσμένη ενέργεια" #: ulng.rsmsgdeletepartiallycopied msgid "Delete the partially copied file ?" msgstr "Διαγραφή μερικώς αντιγραμμένου αρχείου ;" #: ulng.rsmsgdelfldr msgid "Delete %d selected files/directories?" msgstr "Διαγραφή %d επιλεγμένων αρχείων/καταλόγων;" #: ulng.rsmsgdelfldrt msgid "Delete %d selected files/directories into trash can?" msgstr "Διαγραφή %d επιλεγμένων αρχείων/καταλόγων στο κάδο αχρήστων;" #: ulng.rsmsgdelsel msgid "Delete selected \"%s\"?" msgstr "Διαγραφή επιλεγμένων \"%s\";" #: ulng.rsmsgdelselt msgid "Delete selected \"%s\" into trash can?" msgstr "Διαγραφή επιλεγμένων \"%s\" στο κάδο αχρήστων;" #: ulng.rsmsgdeltotrashforce msgid "Can not delete \"%s\" to trash! Delete directly?" msgstr "Αδυναμία διαγραφής \"%s\" στα απορρίμματα! Διαγραφή άμεσα;" #: ulng.rsmsgdisknotavail msgid "Disk is not available" msgstr "Ο Δίσκος δεν είναι διαθέσιμος" #: ulng.rsmsgentercustomaction msgid "Enter custom action name:" msgstr "Εισάγετε νέο προσαρμοσμένο όνομα ενέργειας:" #: ulng.rsmsgenterfileext msgid "Enter file extension:" msgstr "Εισάγετε την επέκταση αρχείου:" #: ulng.rsmsgentername msgid "Enter name:" msgstr "Εισαγωγή ονόματος:" #: ulng.rsmsgenternewfiletypename msgid "Enter name of new file type to create for extension \"%s\"" msgstr "Εισαγωγή ονόματος του νέου τύπου αρχείου που δημιουργείται για την επέκταση \"%s\"" #: ulng.rsmsgerrbadarchive msgid "CRC error in archive data" msgstr "CRC λάθος στα δεδομένα αρχειοθήκης" #: ulng.rsmsgerrbaddata msgid "Data is bad" msgstr "Άσχημα Δεδομένα" #: ulng.rsmsgerrcannotconnect msgid "Can not connect to server: \"%s\"" msgstr "Αδυναμία σύνδεσης στον διακομιστή: \"%s\"" #: ulng.rsmsgerrcannotcopyfile msgid "Cannot copy file %s to %s" msgstr "Αδυναμία αντιγραφής αρχείου %s στο %s" #: ulng.rsmsgerrcreatefiledirectoryexists msgid "There already exists a directory named \"%s\"." msgstr "Εκεί υπάρχει ήδη ένας κατάλογος με το όνομα \"%s\"." #: ulng.rsmsgerrdatenotsupported msgid "Date %s is not supported" msgstr "Ημερομηνία %s δεν υποστηρίζεται" #: ulng.rsmsgerrdirexists msgid "Directory %s exists!" msgstr "Ο Κατάλογος %s υπάρχει!" #: ulng.rsmsgerreaborted msgid "Function aborted by user" msgstr "Λειτουργία που έχει απορριφθεί από το χρήστη" #: ulng.rsmsgerreclose msgid "Error closing file" msgstr "Λάθος κλεισίματος αρχείου" #: ulng.rsmsgerrecreate msgid "Cannot create file" msgstr "Αδυναμία δημιουργίας αρχείου" #: ulng.rsmsgerrendarchive msgid "No more files in archive" msgstr "Όχι άλλα αρχεία στην αρχειοθήκη" #: ulng.rsmsgerreopen msgid "Cannot open existing file" msgstr "Αδυναμία ανοίγματος υπάρχοντος αρχείου" #: ulng.rsmsgerreread msgid "Error reading from file" msgstr "Λάθος ανάγνωσης από το αρχείο" #: ulng.rsmsgerrewrite msgid "Error writing to file" msgstr "Λάθος εγγραφής στο αρχείο" #: ulng.rsmsgerrforcedir msgid "Can not create directory %s!" msgstr "Αδυναμία δημιουργίας καταλόγου %s!" #: ulng.rsmsgerrinvalidlink msgid "Invalid link" msgstr "Μη Έγκυρος δεσμός" #: ulng.rsmsgerrnofiles msgid "No files found" msgstr "Δεν βρέθηκαν αρχεία" #: ulng.rsmsgerrnomemory msgid "Not enough memory" msgstr "Όχι αρκετή μνήμη" #: ulng.rsmsgerrnotsupported msgid "Function not supported!" msgstr "Η λειτουργία δεν υποστηρίζεται!" #: ulng.rsmsgerrorincontextmenucommand msgid "Error in context menu command" msgstr "Λάθος στην εντολή μενού περιεχόμενου" #: ulng.rsmsgerrorloadingconfiguration msgid "Error when loading configuration" msgstr "Λάθος κατά την φόρτωση των ρυθμίσεων" #: ulng.rsmsgerrregexpsyntax msgid "Syntax error in regular expression!" msgstr "Συντακτικό λάθος σε συνήθη φράση!" #: ulng.rsmsgerrrename msgid "Cannot rename file %s to %s" msgstr "Αδυναμία μετονομασίας αρχείου %s σε %s" #: ulng.rsmsgerrsaveassociation msgid "Can not save association!" msgstr "Αδύνατη η αποθήκευση συσχετισμού!" #: ulng.rsmsgerrsavefile msgid "Cannot save file" msgstr "Αδύνατη η αποθήκευση αρχείου" #: ulng.rsmsgerrsetattribute msgid "Can not set attributes for \"%s\"" msgstr "Αδυναμία καθορισμού ιδιοτήτων για \"%s\"" #: ulng.rsmsgerrsetdatetime msgid "Can not set date/time for \"%s\"" msgstr "Αδυναμία ορισμού ημερομηνίας/ώρας για \"%s\"" #: ulng.rsmsgerrsetownership msgid "Can not set owner/group for \"%s\"" msgstr "Αδυναμία ορισμού ιδιοκτήτη/γκρουπ για \"%s\"" #: ulng.rsmsgerrsetpermissions msgid "Can not set permissions for \"%s\"" msgstr "Αδυναμία ορισμού αδειών για \"%s\"" #: ulng.rsmsgerrsmallbuf msgid "Buffer too small" msgstr "Ενδιάμεση μνήμη πολύ μικρή" #: ulng.rsmsgerrtoomanyfiles msgid "Too many files to pack" msgstr "Πάρα πολλά αρχεία για πακετάρισμα" #: ulng.rsmsgerrunknownformat msgid "Archive format unknown" msgstr "Άγνωστη μορφή Αρχειοθήκης" #: ulng.rsmsgfavoritetabsdeleteallentries msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)" msgstr "Είστε βέβαιοι οτι επιθυμείτε να αφαιρέσετε όλες τις καταχωρήσεις των Αγαπημένων Καρτελών σας; (Δεν υπάρχει \"αναίρεση\" σε αυτή την ενέργεια!)" #: ulng.rsmsgfavoritetabsdraghereentry msgid "Drag here other entries" msgstr "Μεταφορά με το ποντίκι εδώ άλλων καταχωρήσεων" #: ulng.rsmsgfavoritetabsentername msgid "Enter a name this Favorite Tabs entry" msgstr "Εισαγωγή ενός ονόματος για αυτή τη καταχώρηση Αγαπημένης Καρτέλας" #: ulng.rsmsgfavoritetabsenternametitle msgid "Saving a new Favorite Tabs entry" msgstr "Αποθήκευση μίας νέας καταχώρησης Αγαπημένων Καρτελών" #: ulng.rsmsgfavoritetabsexportedsuccessfully msgid "Number of Favorite Tabs exported successfully: %d on %d" msgstr "Αριθμός Αγαπημένων Καρτελών που έχουν εξαχθεί επιτυχώς: %d στις %d" #: ulng.rsmsgfavoritetabsextramode msgid "Default extra setting for save dir history for new Favorite Tabs:" msgstr "Προκαθορισμένη επιπλέον ρύθμιση για αποθήκευση ιστορικού καταλόγου για νέες Αγαπημένες Καρτέλες:" #: ulng.rsmsgfavoritetabsimportedsuccessfully msgid "Number of file(s) imported successfully: %d on %d" msgstr "Αριθμός αρχείου(ων) που έχουν εισαχθεί επιτυχώς: %d στα %d" #: ulng.rsmsgfavoritetabsimportsubmenuname msgid "Legacy tabs imported" msgstr "Εισήχθησαν καρτέλες Legacy" #: ulng.rsmsgfavoritetabsimporttitle msgid "Select .tab file(s) to import (could be more than one at the time!)" msgstr "Επιλέξτε .tab αρχείο(α) για εισαγωγή (μπορούν να είναι και περισσότερα από ένα κάθε φορά!)" #: ulng.rsmsgfavoritetabsmodifiednoimport msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?" msgstr "Η τελευταία προσαρμογή Αγαπημένων Καρτελών δεν έχει αποθηκευθεί ακόμη. Επιθυμείτε να αποθηκεύσετε πριν να συνεχίσετε;" #: ulng.rsmsgfavoritetabssimplemode msgctxt "ulng.rsmsgfavoritetabssimplemode" msgid "Keep saving dir history with Favorite Tabs:" msgstr "Διατήρηση αποθήκευσης ιστορικού καταλόγου με Αγαπημένες Καρτέλες:" #: ulng.rsmsgfavoritetabssubmenuname msgctxt "ulng.rsmsgfavoritetabssubmenuname" msgid "Submenu name" msgstr "Ονομασία υπομενού" #: ulng.rsmsgfavoritetabsthiswillloadfavtabs msgid "This will load the Favorite Tabs: \"%s\"" msgstr "Αυτό θα φορτώσει τις Αγαπημένες Καρτέλες: \"%s\"" #: ulng.rsmsgfavortietabssaveoverexisting msgid "Save current tabs over existing Favorite Tabs entry" msgstr "Αποθήκευση τρεχουσών καρτελών πάνω σε υπάρχουσα καταχώρηση Αγαπημένων Καρτελών" #: ulng.rsmsgfilechangedsave msgid "File %s changed, save?" msgstr "Το αρχείο %s έχει αλλάξει, αποθήκευση;" #: ulng.rsmsgfileexistsfileinfo msgid "%s bytes, %s" msgstr "%s bytes, %s" #: ulng.rsmsgfileexistsoverwrite msgid "Overwrite:" msgstr "Αντικατάσταση:" #: ulng.rsmsgfileexistsrwrt msgid "File %s exists, overwrite?" msgstr "Το Αρχείο %s υπάρχει, αντικατάσταση;" #: ulng.rsmsgfileexistswithfile msgid "With file:" msgstr "Με το αρχείο:" #: ulng.rsmsgfilenotfound msgid "File \"%s\" not found." msgstr "Το Αρχείο \"%s\" δε βρέθηκε." #: ulng.rsmsgfileoperationsactive msgid "File operations active" msgstr "Εργασίες Αρχείου ενεργές" #: ulng.rsmsgfileoperationsactivelong msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss." msgstr "Κάποιες εργασίες αρχείου δεν έχουν ακόμη τελειώσει. Κλείνοντας τον Double Commander ίσως προκληθεί απώλεια δεδομένων." #: ulng.rsmsgfilepathovermaxpath msgid "" "The target name length (%d) is more than %d characters!\n" "%s\n" "Most programs will not be able to access a file/directory with such a long name!\n" msgstr "" "Το μήκος ονόματος στόχου (%d) είναι περισσότερο από %d χαρακτήρες!\n" "%s\n" "Τα περισσότερα προγράμματα δε θα μπορούν να έχουν πρόσβαση σε αρχείο/κατάλογο με τόσο μακρύ όνομα!\n" #: ulng.rsmsgfilereadonly msgid "File %s is marked as read-only/hidden/system. Delete it?" msgstr "Το Αρχείο %s έχει σημανθεί για ανάγνωση μόνο. Διαγραφή;" #: ulng.rsmsgfilereloadwarning msgid "Are you sure you want to reload the current file and lose the changes?" msgstr "" #: ulng.rsmsgfilesizetoobig msgid "The file size of \"%s\" is too big for destination file system!" msgstr "Το μέγεθος αρχείου του \"%s\" είναι πολύ μεγάλο για το προοριζόμενο σύστημα αρχείων!" #: ulng.rsmsgfolderexistsrwrt msgid "Folder %s exists, merge?" msgstr "Ο Φάκελος %s υπάρχει, συγχώνευση;" #: ulng.rsmsgfollowsymlink msgid "Follow symlink \"%s\"?" msgstr "Ακολουθείστε Συμβολοδεσμό \"%s\";" #: ulng.rsmsgfortextformattoimport msgid "Select the text format to import" msgstr "Επιλέξτε τον τύπο κειμένου προς εισαγωγή" #: ulng.rsmsghotdiraddselecteddirectories msgid "Add %d selected dirs" msgstr "Προσθήκη %d επιλεγμένων καταλόγων" #: ulng.rsmsghotdiraddselecteddirectory msgid "Add selected dir: " msgstr "Προσθήκη του επιλεγμένου καταλόγου:" #: ulng.rsmsghotdiraddthisdirectory msgid "Add current dir: " msgstr "Προσθήκη του τρέχοντος καταλόγου:" #: ulng.rsmsghotdircommandname msgid "Do command" msgstr "Εκτέλεση Εντολής" #: ulng.rsmsghotdircommandsample msgid "cm_somthing" msgstr "cm_somthing" #: ulng.rsmsghotdirconfighotlist msgctxt "ulng.rsmsghotdirconfighotlist" msgid "Configuration of Directory Hotlist" msgstr "Ρυθμίσεις του Καταλόγου Hotlist" #: ulng.rsmsghotdirdeleteallentries msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)" msgstr "Είστε σίγουροι οτι επιθυμείτε να αφαιρέσετε όλες τις καταχωρήσεις από τον κατάλογο Hotlist; (Δεν υπάρχει \"Αναίρεση\" σε αυτή την ενέργεια!)" #: ulng.rsmsghotdirdemocommand msgid "This will execute the following command:" msgstr "Αυτό θα εκτελέσει την ακόλουθη εντολή:" #: ulng.rsmsghotdirdemoname msgid "This is hot dir named " msgstr "Αυτό είναι ονομασμένο hot dir" #: ulng.rsmsghotdirdemopath msgid "This will change active frame to the following path:" msgstr "Αυτό θα αλλάξει το ενεργό πλαίσιο στην ακόλουθη διαδρομή:" #: ulng.rsmsghotdirdemotarget msgid "And inactive frame would change to the following path:" msgstr "Και το ανενεργό πλαίσιο θα αλλάξει στην ακόλουθη διαδρομή:" #: ulng.rsmsghotdirerrorbackuping msgid "Error backuping entries..." msgstr "Λάθος κατά τη λήψη αντιγράφου ασφαλείας των εισαγμένων εγγραφών..." #: ulng.rsmsghotdirerrorexporting msgid "Error exporting entries..." msgstr "Λάθος εξαγωγής εγγραφών..." #: ulng.rsmsghotdirexportall msgid "Export all!" msgstr "Εξαγωγή Όλων!" #: ulng.rsmsghotdirexporthotlist msgid "Export Directory Hotlist - Select the entries you want to export" msgstr "Εξαγωγή Καταλόγου Hotlist - Επιλέξτε τις καταχωρήσεις που επιθυμείτε να εξαγάγετε" #: ulng.rsmsghotdirexportsel msgid "Export selected" msgstr "Εξαγωγή Επιλεγμένων" #: ulng.rsmsghotdirimportall msgctxt "ulng.rsmsghotdirimportall" msgid "Import all!" msgstr "Εισαγωγή Όλων!" #: ulng.rsmsghotdirimporthotlist msgid "Import Directory Hotlist - Select the entries you want to import" msgstr "Εισαγωγή Καταλόγου Hotlist - Επιλέξτε τις καταχωρήσεις που επιθυμείτε να εισαγάγετε" #: ulng.rsmsghotdirimportsel msgctxt "ulng.rsmsghotdirimportsel" msgid "Import selected" msgstr "Εισαγωγή επιλεγμένων" #: ulng.rsmsghotdirjustpath msgctxt "ulng.rsmsghotdirjustpath" msgid "&Path:" msgstr "Διαδρομή" #: ulng.rsmsghotdirlocatehotlistfile msgid "Locate \".hotlist\" file to import" msgstr "Εντοπισμός \".hotlist\" αρχείου προς εισαγωγή" #: ulng.rsmsghotdirname msgid "Hotdir name" msgstr "Όνομα Hotdir" #: ulng.rsmsghotdirnbnewentries msgid "Number of new entries: %d" msgstr "Αριθμός νέων καταχωρήσεων: %d" #: ulng.rsmsghotdirnothingtoexport msgid "Nothing selected to export!" msgstr "Δεν έχει επιλεχθεί τίποτα προς εξαγωγή!" #: ulng.rsmsghotdirpath msgid "Hotdir path" msgstr "Διαδρομή Hotdir" #: ulng.rsmsghotdirreaddselecteddirectory msgid "Re-Add selected dir: " msgstr "Επαναπροσθήκη του επιλεγμένου καταλόγου:" #: ulng.rsmsghotdirreaddthisdirectory msgid "Re-Add current dir: " msgstr "Επαναπροσθήκη του τρέχων καταλόγου:" #: ulng.rsmsghotdirrestorewhat msgid "Enter location and filename of Directory Hotlist to restore" msgstr "Εισαγωγή τοποθεσίας και ονόματος αρχείου του καταλόγου Hotlist για επαναφορά" #: ulng.rsmsghotdirsimplecommand msgctxt "ulng.rsmsghotdirsimplecommand" msgid "Command:" msgstr "Εντολή:" #: ulng.rsmsghotdirsimpleendofmenu msgctxt "ulng.rsmsghotdirsimpleendofmenu" msgid "(end of sub menu)" msgstr "(τέλος του υπομενού)" #: ulng.rsmsghotdirsimplemenu msgctxt "ulng.rsmsghotdirsimplemenu" msgid "Menu &name:" msgstr "Ονομασία Μενού:" #: ulng.rsmsghotdirsimplename msgctxt "ulng.rsmsghotdirsimplename" msgid "&Name:" msgstr "Ονομασία:" #: ulng.rsmsghotdirsimpleseparator msgctxt "ulng.rsmsghotdirsimpleseparator" msgid "(separator)" msgstr "(διαχωριστικό)" #: ulng.rsmsghotdirsubmenuname msgctxt "ulng.rsmsghotdirsubmenuname" msgid "Submenu name" msgstr "Ονομασία υπομενού" #: ulng.rsmsghotdirtarget msgid "Hotdir target" msgstr "Στόχος Hotdir" #: ulng.rsmsghotdirtiporderpath msgid "Determine if you want the active frame to be sorted in a specified order after changing directory" msgstr "Προσδιορίστε αν επιθυμείτε το ενεργό πλαίσιο να ταξινομηθεί με μια ειδική σειρά μετά την αλλαγή καταλόγου" #: ulng.rsmsghotdirtipordertarget msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory" msgstr "Προσδιορίστε αν επιθυμείτε το μη ενεργό πλαίσιο να ταξινομηθεί με μια ειδική σειρά μετά την αλλαγή καταλόγου" #: ulng.rsmsghotdirtipspecialdirbut msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc." msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης σχετικής διαδρομής, απόλυτης, ειδικούς φακέλους παραθύρων, κ.λ.π." #: ulng.rsmsghotdirtotalbackuped msgid "" "Total entries saved: %d\n" "\n" "Backup filename: %s\n" msgstr "" "Σύνολο καταχωρήσεων που έχουν αποθηκευθεί: %d\n" "\n" "Όνομα Αρχείου ασφαλείας: %s\n" #: ulng.rsmsghotdirtotalexported msgid "Total entries exported: " msgstr "Σύνολο καταχωρήσεων που έχουν εξαχθεί:" #: ulng.rsmsghotdirwhattodelete msgid "" "Do you want to delete all elements inside the sub-menu [%s]?\n" "Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n" msgstr "" "Επιθυμείτε να διαγράψετε όλα τα στοιχεία εντός του υπομενού [%s];\n" "Απαντώντας ΟΧΙ θα διαγράψετε μόνο τους οριοθέτες του μενού αλλά θα διατηρηθεί το στοιχείο μέσα στο υπομενού.\n" #: ulng.rsmsghotdirwheretosave msgid "Enter location and filename where to save a Directory Hotlist file" msgstr "Εισαγωγή τοποθεσίας και ονόματος αρχείου όπου θα αποθηκευθεί ένα αρχείο καταλόγου Hotlist" #: ulng.rsmsgincorrectfilelength msgid "Incorrect resulting filelength for file : \"%s\"" msgstr "Μη Έγκυρο τελικό μήκος αρχείου για το αρχείο : \"%s\"" #: ulng.rsmsginsertnextdisk msgid "" "Please insert next disk or something similar.\n" "\n" "It is to allow writing this file:\n" "\"%s\"\n" "\n" "Number of bytes still to write: %d\n" msgstr "" "Παρακαλώ εισάγετε τον επόμενο δίσκο ή κάτι παρόμοιο.\n" "\n" "Ώστε να επιτραπεί εγγραφή σε αυτό το αρχείο:\n" "\"%s\"\n" "\n" "Αριθμός bytes προς εγγραφή: %d\n" #: ulng.rsmsginvalidcommandline msgid "Error in command line" msgstr "Λάθος στη γραμμή εντολών" #: ulng.rsmsginvalidfilename msgid "Invalid filename" msgstr "Μη Έγκυρο όνομα αρχείου" #: ulng.rsmsginvalidformatofconfigurationfile msgid "Invalid format of configuration file" msgstr "Άκυρος τύπος αρχείου ρυθμίσεων" #: ulng.rsmsginvalidhexnumber msgid "Invalid hexadecimal number: \"%s\"" msgstr "" #: ulng.rsmsginvalidpath msgid "Invalid path" msgstr "Μη Έγκυρη διαδρομή" #: ulng.rsmsginvalidpathlong msgid "Path %s contains forbidden characters." msgstr "Η Διαδρομή %s περιέχει απαγορευμένος χαρακτήρες." #: ulng.rsmsginvalidplugin msgid "This is not a valid plugin!" msgstr "Αυτό είναι ένα μη έγκυρο πρόσθετο!" #: ulng.rsmsginvalidpluginarchitecture msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!" msgstr "Αυτό το πρόσθετο έχει δημιουργηθεί για τον Double Commander για %s.%sΔεν μπορεί να λειτουργήσει στον Double Commander για %s!" #: ulng.rsmsginvalidquoting msgid "Invalid quoting" msgstr "Μη έγκυρη δημιουργία εισαγωγικών" #: ulng.rsmsginvalidselection msgid "Invalid selection." msgstr "Μη Έγκυρη επιλογή." #: ulng.rsmsgloadingfilelist msgid "Loading file list..." msgstr "Φόρτωση λίστας αρχείων..." #: ulng.rsmsglocatetcconfiguation msgid "Locate TC configuration file (wincmd.ini)" msgstr "Εντοπισμός αρχείου ρυθμίσεων του TC (wincmd.ini)" #: ulng.rsmsglocatetcexecutable msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)" msgstr "Εντοπισμός αρχείου εκτέλεσης του TC (totalcmd.exe or totalcmd64.exe)" #: ulng.rsmsglogcopy msgid "Copy file %s" msgstr "Αντιγραφή αρχείου %s" #: ulng.rsmsglogdelete msgid "Delete file %s" msgstr "Διαγραφή αρχείου %s" #: ulng.rsmsglogerror msgid "Error: " msgstr "Λάθος: " #: ulng.rsmsglogextcmdlaunch msgid "Launch external" msgstr "Φόρτωση Εξωτερικά" #: ulng.rsmsglogextcmdresult msgid "Result external" msgstr "Εξαγωγή Αποτελέσματος εξωτερικά" #: ulng.rsmsglogextract msgid "Extract file %s" msgstr "Εξαγωγή Αρχείου %s" #: ulng.rsmsgloginfo msgid "Info: " msgstr "Πληροφορίες:" #: ulng.rsmsgloglink msgid "Create link %s" msgstr "Δημιουργία δεσμού %s" #: ulng.rsmsglogmkdir msgid "Create directory %s" msgstr "Δημιουργία καταλόγου %s" #: ulng.rsmsglogmove msgid "Move file %s" msgstr "Μετακίνηση αρχείου %s" #: ulng.rsmsglogpack msgid "Pack to file %s" msgstr "Πακετάρισμα στο αρχείο %s" #: ulng.rsmsglogrmdir msgid "Remove directory %s" msgstr "Αφαίρεση καταλόγου %s" #: ulng.rsmsglogsuccess msgid "Done: " msgstr "Έγινε:" #: ulng.rsmsglogsymlink msgid "Create symlink %s" msgstr "Δημιουργία συμβολοδεσμού %s" #: ulng.rsmsglogtest msgid "Test file integrity %s" msgstr "Δοκιμή ακεραιότητας αρχείου %s" #: ulng.rsmsglogwipe msgid "Wipe file %s" msgstr "Ασφαλής Διαγραφή αρχείου %s" #: ulng.rsmsglogwipedir msgid "Wipe directory %s" msgstr "Ασφαλής Διαγραφή καταλόγου %s" #: ulng.rsmsgmasterpassword msgid "Master Password" msgstr "Κύριο Συνθηματικό" #: ulng.rsmsgmasterpasswordenter msgid "Please enter the master password:" msgstr "Παρακαλώ εισάγετε το κύριο συνθηματικό:" #: ulng.rsmsgnewfile msgid "New file" msgstr "Νέο Αρχείο" #: ulng.rsmsgnextvolunpack msgid "Next volume will be unpacked" msgstr "Ο Επόμενος τόμος θα ξεπακεταριστεί" #: ulng.rsmsgnofiles msgid "No files" msgstr "Δεν υπάρχουν αρχεία" #: ulng.rsmsgnofilesselected msgid "No files selected." msgstr "Δεν έχουν επιλεχθεί αρχεία." #: ulng.rsmsgnofreespacecont msgid "No enough free space on target drive, Continue?" msgstr "Όχι αρκετός ελεύθερος χώρος στον στοχευμένο οδηγό, Συνέχιση;" #: ulng.rsmsgnofreespaceretry msgid "No enough free space on target drive, Retry?" msgstr "Όχι αρκετός ελεύθερος χώρος στον στοχευμένο οδηγό, Δοκιμή Ξανά;" #: ulng.rsmsgnotdelete msgid "Can not delete file %s" msgstr "Αδυναμία διαγραφής αρχείου %s" #: ulng.rsmsgnotimplemented msgid "Not implemented." msgstr "Δεν έχει εφαρμοστεί." #: ulng.rsmsgobjectnotexists msgid "Object does not exist!" msgstr "Το αντικείμενο δεν υπάρχει!" #: ulng.rsmsgpanelpreview msgctxt "ulng.rsmsgpanelpreview" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "Παρακάτω είναι μία προεπισκόπηση. Μπορείται να μετακινήσετε τον κέρσορα και να επιλέξετε αρχεία ώστε να έχετε άμεσα μία πραγματική εικόνα και αίσθηση των διαφόρων ρυθμίσεων." #: ulng.rsmsgpassword msgid "Password:" msgstr "Συνθηματικό:" #: ulng.rsmsgpassworddiff msgid "Passwords are different!" msgstr "Τα συνθηματικά διαφέρουν!" #: ulng.rsmsgpasswordenter msgid "Please enter the password:" msgstr "Παρακαλώ εισάγετε το συνθηματικό:" #: ulng.rsmsgpasswordfirewall msgid "Password (Firewall):" msgstr "Συνθηματικό (Τείχος Προστασίας):" #: ulng.rsmsgpasswordverify msgid "Please re-enter the password for verification:" msgstr "Παρακαλώ επανεισάγετε το συνθηματικό για ταυτοποίηση:" #: ulng.rsmsgpopuphotdelete #, fuzzy,badformat msgid "&Delete %s" msgstr "%Διαγραφή %s" #: ulng.rsmsgpresetalreadyexists msgid "Preset \"%s\" already exists. Overwrite?" msgstr "Τα προκαθορισμένα \"%s\" ήδη υπάρχουν. Αντικατάσταση;" #: ulng.rsmsgproblemexecutingcommand msgid "Problem executing command (%s)" msgstr "Πρόβλημα κατά την εκτέλεση της εντολής (%s)" #: ulng.rsmsgpromptaskingfilename msgid "Filename for dropped text:" msgstr "Όνομα Αρχείου για εναποθετημένο κείμενο:" #: ulng.rsmsgprovidethisfile msgid "Please, make this file available. Retry?" msgstr "Παρακαλώ, κάντε αυτό το αρχείο διαθέσιμο. Δοκιμή ξανά;" #: ulng.rsmsgrenamefavtabs msgid "Enter new friendly name for this Favorite Tabs" msgstr "Εισαγωγή νέου φιλικού ονόματος για αυτή την Αγαπημένη Καρτέλα" #: ulng.rsmsgrenamefavtabsmenu msgid "Enter new name for this menu" msgstr "Εισαγωγή νέου ονόματος για αυτό το μενού" #: ulng.rsmsgrenfldr msgid "Rename/move %d selected files/directories?" msgstr "Μετονομασία/μετακίνηση %d επιλεγμένων αρχείων/καταλόγων;" #: ulng.rsmsgrensel msgid "Rename/move selected \"%s\"?" msgstr "Μετονομασία/μετακίνηση επιλεγμένων \"%s\";" #: ulng.rsmsgrestartforapplychanges msgid "Please, restart Double Commander in order to apply changes" msgstr "Παρακαλώ επανεκκινείστε τον Double Commander ώστε να εφαρμοστούν οι αλλαγές" #: ulng.rsmsgsekectfiletype msgid "Select to which file type to add extension \"%s\"" msgstr "Επιλογή σε ποιους τύπους αρχείων να προστεθεί επέκταση \"%s\"" #: ulng.rsmsgselectedinfo msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d" msgstr "Επιλεγμένα: %s από %s, αρχεία: %d από %d, φάκελοι: %d από %d" #: ulng.rsmsgselectexecutablefile msgid "Select executable file for" msgstr "Επιλογή εκτελέσιμου αρχείου για" #: ulng.rsmsgselectonlychecksumfiles msgid "Please select only checksum files!" msgstr "Παρακαλώ επιλέξτε μόνο αρχεία αθροίσματος ελέγχου!" #: ulng.rsmsgsellocnextvol msgid "Please select location of next volume" msgstr "Παρακαλώ επιλέξτε τοποθεσία του επόμενου τόμου" #: ulng.rsmsgsetvolumelabel msgid "Set volume label" msgstr "Καθορισμός ετικέτας τόμου" #: ulng.rsmsgspecialdir msgid "Special Dirs" msgstr "Ειδικοί Κατάλογοι" #: ulng.rsmsgspecialdiraddacti msgid "Add path from active frame" msgstr "Προσθήκη διαδρομής από το ενεργό πλαίσιο" #: ulng.rsmsgspecialdiraddnonacti msgid "Add path from inactive frame" msgstr "Προσθήκη διαδρομής από το ανενεργό πλαίσιο" #: ulng.rsmsgspecialdirbrowssel msgid "Browse and use selected path" msgstr "Εξερεύνηση και χρήση της επιλεγμένης διαδρομής" #: ulng.rsmsgspecialdirenvvar msgid "Use environment variable..." msgstr "Χρήση μεταβλητής περιβάλλοντος..." #: ulng.rsmsgspecialdirgotodc msgid "Go to Double Commander special path..." msgstr "Μετάβαση στην ειδική διαδρομή του Double Commander..." #: ulng.rsmsgspecialdirgotoenvvar msgid "Go to environment variable..." msgstr "Μετάβαση στην μεταβλητή περιβάλλοντος..." #: ulng.rsmsgspecialdirgotoother msgid "Go to other Windows special folder..." msgstr "Μετάβαση σε άλλο ειδικό φάκελο των Windows..." #: ulng.rsmsgspecialdirgototc msgid "Go to Windows special folder (TC)..." msgstr "Μετάβαση στον ειδικό φάκελο των Windows (TC)..." #: ulng.rsmsgspecialdirmakereltohotdir msgid "Make relative to hotdir path" msgstr "Δημιουργία σχετικής διαδρομής για την hotdir" #: ulng.rsmsgspecialdirmkabso msgid "Make path absolute" msgstr "Ορίστε ως απόλυτη τη διαδρομή" #: ulng.rsmsgspecialdirmkdcrel msgid "Make relative to Double Commander special path..." msgstr "Ορίστε ως σχετική την ειδική διαδρομή του Double Commander..." #: ulng.rsmsgspecialdirmkenvrel msgid "Make relative to environment variable..." msgstr "Ορίστε ως σχετική για την μεταβλητή περιβάλλοντος..." #: ulng.rsmsgspecialdirmktctel msgid "Make relative to Windows special folder (TC)..." msgstr "Ορίστε ως σχετική για τον ειδικό Windows φάκελο (TC)..." #: ulng.rsmsgspecialdirmkwnrel msgid "Make relative to other Windows special folder..." msgstr "Ορίστε ως σχετική για άλλον ειδικό φάκελο των Windows... " #: ulng.rsmsgspecialdirusedc msgid "Use Double Commander special path..." msgstr "Χρήση της ειδικής διαδρομής του Double Commander..." #: ulng.rsmsgspecialdirusehotdir msgid "Use hotdir path" msgstr "Χρήση διαδρομής hotdir" #: ulng.rsmsgspecialdiruseother msgid "Use other Windows special folder..." msgstr "Χρήση άλλου ειδικού φακέλου των Windows..." #: ulng.rsmsgspecialdirusetc msgid "Use Windows special folder (TC)..." msgstr "Χρήση του ειδικού φακέλου των Windows (TC)..." #: ulng.rsmsgtabforopeninginnewtab msgid "This tab (%s) is locked! Open directory in another tab?" msgstr "Αυτή η καρτέλα (%s) είναι κλειδωμένη! Άνοιγμα καταλόγου σε άλλη καρτέλα;" #: ulng.rsmsgtabrenamecaption msgid "Rename tab" msgstr "Μετονομασία καρτέλας" #: ulng.rsmsgtabrenameprompt msgid "New tab name:" msgstr "Όνομα νέας καρτέλας:" #: ulng.rsmsgtargetdir msgid "Target path:" msgstr "Διαδρομή στόχου:" #: ulng.rsmsgtcconfignotfound msgid "" "Error! Cannot find the TC configuration file:\n" "%s\n" msgstr "" "Λάθος! Αδυναμία εύρεσης αρχείου TC ρυθμίσεων:\n" "%s\n" #: ulng.rsmsgtcexecutablenotfound msgid "" "Error! Cannot find the TC configuration executable:\n" "%s\n" msgstr "" "Λάθος! Αδυναμία εύρεσης εκτελέσιμου TC ρυθμίσεων:\n" "%s\n" #: ulng.rsmsgtcisrunning msgid "" "Error! TC is still running but it should be closed for this operation.\n" "Close it and press OK or press CANCEL to abort.\n" msgstr "" "Λάθος! Ο TC ακόμη λειτουργεί αλλά θα έπρεπε να είναι κλειστός για αυτή τη λειτουργία.\n" "Κλείστε τον και πιέστε ΟΚ ή πιέστε ΑΚΥΡΩΣΗ για απόρριψη.\n" #: ulng.rsmsgtctoolbarnotfound msgid "" "Error! Cannot find the desired wanted TC toolbar output folder:\n" "%s\n" msgstr "" "Λάθος! Αδυναμία εύρεσης επιθυμητού φακέλου εξαγωγής TC γραμμής εργαλείων:\n" "%s\n" #: ulng.rsmsgtctoolbarwheretosave msgid "Enter location and filename where to save a TC Toolbar file" msgstr "Εισαγωγή τοποθεσίας και ονόματος αρχείου που θα αποθηκευθεί ένα αρχείο γραμμής εργαλείων του TC" #: ulng.rsmsgthisisnowinclipboard msgid "\"%s\" is now in the clipboard" msgstr "\"%s\" είναι τώρα στο πρόχειρο" #: ulng.rsmsgtitleextnotinfiletype msgid "Extension of selected file is not in any recognized file types" msgstr "Η Επέκταση του επιλεγμένου αρχείου δεν είναι κάποιος γνωστός τύπος αρχείου" #: ulng.rsmsgtoolbarlocatedctoolbarfile msgid "Locate \".toolbar\" file to import" msgstr "Εντοπισμός \".toolbar\" αρχείο για εισαγωγή" #: ulng.rsmsgtoolbarlocatetctoolbarfile msgid "Locate \".BAR\" file to import" msgstr "Εντοπισμός \".BAR\" αρχείο για εισαγωγή" #: ulng.rsmsgtoolbarrestorewhat msgid "Enter location and filename of Toolbar to restore" msgstr "Εισαγωγή τοποθεσίας και ονόματος αρχείου της Γραμμής Εργαλείων για επαναφορά" #: ulng.rsmsgtoolbarsaved msgid "" "Saved!\n" "Toolbar filename: %s\n" msgstr "" "Αποθηκεύτηκε!\n" "Όνομα Αρχείου Γραμμής Εργαλείων: %s\n" #: ulng.rsmsgtoomanyfilesselected msgid "Too many files selected." msgstr "Έχουν επιλεχθεί πάρα πολλά αρχεία." #: ulng.rsmsgundeterminednumberoffile msgid "Undetermined" msgstr "Απροσδιόριστο" #: ulng.rsmsgunexpectedusagetreeviewmenu msgid "ERROR: Unexpected Tree View Menu usage!" msgstr "ΛΑΘΟΣ: Μη προβλεπόμενη χρήση Μενού Προβολής Δέντρου!" #: ulng.rsmsgurl msgid "URL:" msgstr "URL:" #: ulng.rsmsguserdidnotsetextension msgid "" msgstr "<ΟΧΙ ΕΞΩΤΕΡ>" #: ulng.rsmsguserdidnotsetname msgid "" msgstr "<ΧΩΡΙΣ ΟΝΟΜΑ>" #: ulng.rsmsgusername msgid "User name:" msgstr "Όνομα Χρήστη:" #: ulng.rsmsgusernamefirewall msgid "User name (Firewall):" msgstr "Όνομα χρήστη (Τείχος Προστασίας):" #: ulng.rsmsgverify msgid "VERIFICATION:" msgstr "" #: ulng.rsmsgverifywrong msgid "The target file is corrupted, checksum mismatch!" msgstr "" #: ulng.rsmsgvolumelabel msgid "Volume label:" msgstr "Ετικέτα τόμου:" #: ulng.rsmsgvolumesizeenter msgid "Please enter the volume size:" msgstr "Παρακαλώ εισαγάγετε το μέγεθος τόμου:" #: ulng.rsmsgwipefldr msgid "Wipe %d selected files/directories?" msgstr "Ασφαλής Διαγραφή %d επιλεγμένων αρχείων/καταλόγων;" #: ulng.rsmsgwipesel msgid "Wipe selected \"%s\"?" msgstr "Ασφαλής Διαγραφή επιλεγμένων \"%s\";" #: ulng.rsmsgwithactionwith msgid "with" msgstr "με" #: ulng.rsmsgwrongpasswordtryagain msgid "" "Wrong password!\n" "Please try again!\n" msgstr "" #: ulng.rsmulrenautorename msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?" msgstr "Εκτέλεση αυτόματης μετονομασίας του \"name (1).ext\", \"name (2).ext\" κ.λ.π;" #: ulng.rsmulrenfilenamestylelist msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;" msgstr "Χωρίς αλλαγή;ΚΕΦΑΛΑΙΟ;μικρό;Πρώτο γράμμα κεφαλαίο;Πρώτο Γράμμα κάθε Λέξης Κεφαλαίο;" #: ulng.rsmulrenwarningduplicate msgid "Warning, duplicate names!" msgstr "Προσοχή, διπλότυπες ονομασίες!" #: ulng.rsmulrenwronglinesnumber msgid "File contains wrong number of lines: %d, should be %d!" msgstr "Το Αρχείο περιέχει λάθος αριθμό γραμμών: Το %d, θα έπρεπε να είναι %d!" #: ulng.rsnewsearchclearfilteroptions msgid "Keep;Clear;Prompt" msgstr "Διατήρηση;Καθαρισμός;Υπενθύμιση" #: ulng.rsnoequivalentinternalcommand msgid "No internal equivalent command" msgstr "Δεν υπάρχει ισοδύναμη εσωτερική εντολή" #: ulng.rsnofindfileswindowyet msgid "Sorry, no \"Find files\" window yet..." msgstr "Λυπούμαστε, δεν υπάρχει παράθυρο \"Αναζήτηση Αρχείων\" ακόμη..." #: ulng.rsnootherfindfileswindowtoclose msgid "Sorry, no other \"Find files\" window to close and free from memory..." msgstr "Λυπούμαστε, δεν υπάρχει άλλο παράθυρο \"Αναζήτηση Αρχείων\" προς κλείσιμο και απελευθέρωση από τη μνήμη..." #: ulng.rsopenwithdevelopment msgid "Development" msgstr "" #: ulng.rsopenwitheducation msgid "Education" msgstr "" #: ulng.rsopenwithgames msgid "Games" msgstr "" #: ulng.rsopenwithgraphics #, fuzzy msgctxt "ulng.rsopenwithgraphics" msgid "Graphics" msgstr "Γραφικά" #: ulng.rsopenwithmultimedia msgid "Multimedia" msgstr "" #: ulng.rsopenwithnetwork #, fuzzy msgctxt "ulng.rsopenwithnetwork" msgid "Network" msgstr "Δίκτυο" #: ulng.rsopenwithoffice msgid "Office" msgstr "" #: ulng.rsopenwithother #, fuzzy msgctxt "ulng.rsopenwithother" msgid "Other" msgstr "Άλλοι" #: ulng.rsopenwithscience msgid "Science" msgstr "" #: ulng.rsopenwithsettings msgid "Settings" msgstr "" #: ulng.rsopenwithsystem #, fuzzy msgctxt "ulng.rsopenwithsystem" msgid "System" msgstr "Σύστημα" #: ulng.rsopenwithutility msgid "Accessories" msgstr "" #: ulng.rsoperaborted msgid "Aborted" msgstr "Έχει απορριφθεί" #: ulng.rsopercalculatingchecksum msgid "Calculating checksum" msgstr "Υπολογισμός αθροίσματος ελέγχου" #: ulng.rsopercalculatingchecksumin msgid "Calculating checksum in \"%s\"" msgstr "Υπολογισμός αθροίσματος ελέγχου σε \"%s\"" #: ulng.rsopercalculatingchecksumof msgid "Calculating checksum of \"%s\"" msgstr "Υπολογισμός αθροίσματος ελέγχου του \"%s\"" #: ulng.rsopercalculatingstatictics msgctxt "ulng.rsopercalculatingstatictics" msgid "Calculating" msgstr "Υπολογισμός" #: ulng.rsopercalculatingstatisticsin msgid "Calculating \"%s\"" msgstr "Υπολογισμός \"%s\"" #: ulng.rsopercombining msgid "Joining" msgstr "Ένωση" #: ulng.rsopercombiningfromto msgid "Joining files in \"%s\" to \"%s\"" msgstr "Ένωση αρχείων από \"%s\" σε \"%s\"" #: ulng.rsopercopying msgid "Copying" msgstr "Αντιγραφή" #: ulng.rsopercopyingfromto msgid "Copying from \"%s\" to \"%s\"" msgstr "Αντιγραφή από \"%s\" σε \"%s\"" #: ulng.rsopercopyingsomethingto msgid "Copying \"%s\" to \"%s\"" msgstr "Αντιγραφή \"%s\" σε \"%s\"" #: ulng.rsopercreatingdirectory msgid "Creating directory" msgstr "Δημιουργία καταλόγου" #: ulng.rsopercreatingsomedirectory msgid "Creating directory \"%s\"" msgstr "Δημιουργία καταλόγου \"%s\"" #: ulng.rsoperdeleting msgctxt "ulng.rsoperdeleting" msgid "Deleting" msgstr "Διαγραφή" #: ulng.rsoperdeletingin msgid "Deleting in \"%s\"" msgstr "Διαγραφή σε \"%s\" " #: ulng.rsoperdeletingsomething msgid "Deleting \"%s\"" msgstr "Διαγραφή \"%s\"" #: ulng.rsoperexecuting msgid "Executing" msgstr "Εκτέλεση" #: ulng.rsoperexecutingsomething msgid "Executing \"%s\"" msgstr "Εκτέλεση \"%s\"" #: ulng.rsoperextracting msgid "Extracting" msgstr "Εξαγωγή" #: ulng.rsoperextractingfromto msgid "Extracting from \"%s\" to \"%s\"" msgstr "Εξαγωγή από \"%s\" σε \"%s\"" #: ulng.rsoperfinished msgid "Finished" msgstr "Τελείωσε" #: ulng.rsoperlisting msgid "Listing" msgstr "Προβολή Λίστας" #: ulng.rsoperlistingin msgid "Listing \"%s\"" msgstr "Προβολή Λίστας \"%s\"" #: ulng.rsopermoving msgid "Moving" msgstr "Μετακίνηση" #: ulng.rsopermovingfromto msgid "Moving from \"%s\" to \"%s\"" msgstr "Μετακίνηση από \"%s\"σε \"%s\"" #: ulng.rsopermovingsomethingto msgid "Moving \"%s\" to \"%s\"" msgstr "Μετακίνηση \"%s\"σε \"%s\"" #: ulng.rsopernotstarted msgid "Not started" msgstr "Δεν έχει εκκινηθεί" #: ulng.rsoperpacking msgid "Packing" msgstr "Πακετάρισμα" #: ulng.rsoperpackingfromto msgid "Packing from \"%s\" to \"%s\"" msgstr "Πακετάρισμα από \"%s\" σε \"%s\"" #: ulng.rsoperpackingsomethingto msgid "Packing \"%s\" to \"%s\"" msgstr "Πακετάρισμα \"%s\" σε \"%s\"" #: ulng.rsoperpaused msgid "Paused" msgstr "Έχει παυθεί" #: ulng.rsoperpausing msgid "Pausing" msgstr "Παύση" #: ulng.rsoperrunning msgid "Running" msgstr "Εκτέλεση" #: ulng.rsopersettingproperty msgid "Setting property" msgstr "Καθορισμός ιδιότητας" #: ulng.rsopersettingpropertyin msgid "Setting property in \"%s\"" msgstr "Καθορισμός ιδιότητας σε \"%s\"" #: ulng.rsopersettingpropertyof msgid "Setting property of \"%s\"" msgstr "Καθορισμός ιδιότητας των \"%s\"" #: ulng.rsopersplitting msgid "Splitting" msgstr "Διαμερισμός" #: ulng.rsopersplittingfromto msgid "Splitting \"%s\" to \"%s\"" msgstr "Διαμερισμός \"%s\"σε \"%s\"" #: ulng.rsoperstarting msgid "Starting" msgstr "Εκκίνηση" #: ulng.rsoperstopped msgid "Stopped" msgstr "Σταματημένο" #: ulng.rsoperstopping msgid "Stopping" msgstr "Σταμάτημα" #: ulng.rsopertesting msgid "Testing" msgstr "Δοκιμή" #: ulng.rsopertestingin msgid "Testing in \"%s\"" msgstr "Δοκιμή σε \"%s\"" #: ulng.rsopertestingsomething msgid "Testing \"%s\"" msgstr "Δοκιμή \"%s\"" #: ulng.rsoperverifyingchecksum msgid "Verifying checksum" msgstr "Επιβεβαίωση αθροίσματος ελέγχου" #: ulng.rsoperverifyingchecksumin msgid "Verifying checksum in \"%s\"" msgstr "Επιβεβαίωση αθροίσματος ελέγχου σε \"%s\"" #: ulng.rsoperverifyingchecksumof msgid "Verifying checksum of \"%s\"" msgstr "Επιβεβαίωση αθροίσματος ελέγχου του \"%s\"" #: ulng.rsoperwaitingforconnection msgid "Waiting for access to file source" msgstr "Αναμονή για πρόσβαση στην πηγή αρχείων" #: ulng.rsoperwaitingforfeedback msgid "Waiting for user response" msgstr "Αναμονή για απόκριση από τον χρήστη" #: ulng.rsoperwiping msgid "Wiping" msgstr "Ασφαλής Διαγραφή" #: ulng.rsoperwipingin msgid "Wiping in \"%s\"" msgstr "Ασφαλής Διαγραφή σε \"%s\"" #: ulng.rsoperwipingsomething msgid "Wiping \"%s\"" msgstr "Ασφαλής Διαγραφή \"%s\"" #: ulng.rsoperworking msgid "Working" msgstr "Επεξεργασία" #: ulng.rsoptaddfrommainpanel msgid "Add at &beginning;Add at the end;Smart add" msgstr "Προσθήκη στην αρχή;Προσθήκη στο τέλος;Έξυπνη προσθήκη" #: ulng.rsoptarchiveconfiguresavetochange msgid "To change current editing archive configuration, either APPLY or DELETE current editing one" msgstr "" #: ulng.rsoptarchiveradditonalcmd msgid "Mode dependent, additional command" msgstr "" #: ulng.rsoptarchiveraddonlynotempty msgid "Add if it is non-empty" msgstr "" #: ulng.rsoptarchiverarchivel msgid "Archive File (long name)" msgstr "" #: ulng.rsoptarchiverarchiver msgid "Select archiver executable" msgstr "" #: ulng.rsoptarchiverarchives msgid "Archive file (short name)" msgstr "" #: ulng.rsoptarchiverchangeencoding msgid "Change Archiver Listing Encoding" msgstr "" #: ulng.rsoptarchiverconfirmdelete msgid "Are you sure you want to delete: %s" msgstr "" #: ulng.rsoptarchiverdefaultexportfilename msgid "Exported Archiver Configuration" msgstr "" #: ulng.rsoptarchivererrorlevel msgid "errorlevel" msgstr "" #: ulng.rsoptarchiverexportcaption msgid "Export archiver configuration" msgstr "" #: ulng.rsoptarchiverexportdone msgid "Exportation of %d elements to file \"%s\" completed." msgstr "" #: ulng.rsoptarchiverexportprompt msgid "Select the one(s) you want to export" msgstr "" #: ulng.rsoptarchiverfilelistl msgid "Filelist (long names)" msgstr "" #: ulng.rsoptarchiverfilelists msgid "Filelist (short names)" msgstr "" #: ulng.rsoptarchiverimportcaption msgid "Import archiver configuration" msgstr "" #: ulng.rsoptarchiverimportdone msgid "Importation of %d elements from file \"%s\" completed." msgstr "" #: ulng.rsoptarchiverimportfile msgid "Select the file to import archiver configuration(s)" msgstr "" #: ulng.rsoptarchiverimportprompt msgid "Select the one(s) you want to import" msgstr "" #: ulng.rsoptarchiverjustname msgid "Use name only, without path" msgstr "" #: ulng.rsoptarchiverjustpath msgid "Use path only, without name" msgstr "" #: ulng.rsoptarchiverprograml msgid "Archive Program (long name)" msgstr "" #: ulng.rsoptarchiverprograms msgid "Archive Program (short name)" msgstr "" #: ulng.rsoptarchiverquoteall msgid "Quote all names" msgstr "" #: ulng.rsoptarchiverquotewithspace msgid "Quote names with spaces" msgstr "" #: ulng.rsoptarchiversinglefprocess msgid "Single filename to process" msgstr "" #: ulng.rsoptarchivertargetsubdir msgid "Target subdirecory" msgstr "" #: ulng.rsoptarchiveruseansi msgid "Use ANSI encoding" msgstr "" #: ulng.rsoptarchiveruseutf8 msgid "Use UTF8 encoding" msgstr "" #: ulng.rsoptarchiverwheretosave msgid "Enter location and filename where to save archiver configuration" msgstr "" #: ulng.rsoptarchivetypename msgid "Archive type name:" msgstr "Όνομα τύπου αρχειοθήκης:" #: ulng.rsoptassocpluginwith msgid "Associate plugin \"%s\" with:" msgstr "Συσχετισμός του προσθέτου \"%s\" με:" #: ulng.rsoptautosizecolumn msgid "First;Last;" msgstr "Πρώτο;Τελευταίο;" #: ulng.rsoptconfigsortorder msgid "Classic, legacy order;Alphabetic order (but language still first)" msgstr "Κλασική, σειρά legacy;Αλφαβητική σειρά (αλλά η γλώσσα ακόμη πρώτη)" #: ulng.rsoptdifferframeposition msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right" msgstr "Ενεργό πλαισιακό πάνελ στα αριστερά, ανενεργό στα δεξιά (legacy);Αριστερό πλαισιακό πάνελ στα αριστερά, δεξιό στα δεξιά" #: ulng.rsoptdisable msgid "Disable" msgstr "Απενεργοποίηση" #: ulng.rsoptenable msgctxt "ulng.rsoptenable" msgid "Enable" msgstr "Ενεργοποίηση" #: ulng.rsoptenterext msgid "Enter extension" msgstr "Εισάγετε επέκταση" #: ulng.rsoptfavoritetabswheretoaddinlist msgid "Add at beginning;Add at the end;Alphabetical sort" msgstr "Προσθήκη στην αρχή;Προσθήκη στο τέλος;Με Αλφαβητική σειρά" #: ulng.rsoptfileoperationsprogresskind msgid "separate window;minimized separate window;operations panel" msgstr "ξεχωριστό παράθυρο;ελαχιστοποιημένο ξεχωριστό παράθυρο;πάνελ λειτουργειών" #: ulng.rsoptfilesizeformat msgid "float;B;K;M;G" msgstr "float;B;K;M;G" #: ulng.rsopthotkeysadddeleteshortcutlong msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting." msgstr "Η συντόμευση %s για το cm_Delete θα κατοχυρωθεί, ώστε να χρησιμοποιηθεί για να γίνει αντιστροφή αυτής της ρύθμισης.." #: ulng.rsopthotkeysaddhotkey msgid "Add hotkey for %s" msgstr "Προσθήκη ειδικού πλήκτρου για %s" #: ulng.rsopthotkeysaddshortcutbutton msgid "Add shortcut" msgstr "Προσθήκη συντόμευσης" #: ulng.rsopthotkeyscannotsetshortcut msgid "Cannot set shortcut" msgstr "Αδυναμία καθορισμού συντόμευσης" #: ulng.rsopthotkeyschangeshortcut msgid "Change shortcut" msgstr "Αλλαγή συντόμευσης" #: ulng.rsopthotkeyscommand msgctxt "ulng.rsopthotkeyscommand" msgid "Command" msgstr "Εντολή" #: ulng.rsopthotkeysdeletetrashcanoverrides msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides" msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?" msgstr "Η συντόμευση %s για το cm_Delete έχει μία παράμετρο που αντικαθιστά αυτή τη ρύθμιση. Επιθυμείτε να αλλάξετε αυτή τη παράμετρο και να κάνετε χρήση των γενικών ρυθμίσεων;" #: ulng.rsopthotkeysdeletetrashcanparameterexists msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists" msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?" msgstr "Η συντόμευση %s για το cm_Delete πρέπει να έχει μία παράμετρο που να ταιριάζει με τη συντόμευση %s. Επιθυμείτε να την αλλάξετε;" #: ulng.rsopthotkeysdescription msgctxt "ulng.rsopthotkeysdescription" msgid "Description" msgstr "Περιγραφή" #: ulng.rsopthotkeysedithotkey msgid "Edit hotkey for %s" msgstr "Ρύθμιση ειδικού πλήκτρου για %s" #: ulng.rsopthotkeysfixparameter msgid "Fix parameter" msgstr "Διόρθωση παραμέτρου" #: ulng.rsopthotkeyshotkey msgctxt "ulng.rsopthotkeyshotkey" msgid "Hotkey" msgstr "Ειδικό Πλήκτρο" #: ulng.rsopthotkeyshotkeys msgctxt "ulng.rsopthotkeyshotkeys" msgid "Hotkeys" msgstr "Ειδικά Πλήκτρα" #: ulng.rsopthotkeysnohotkey msgid "" msgstr "<κανένα>" #: ulng.rsopthotkeysparameters msgctxt "ulng.rsopthotkeysparameters" msgid "Parameters" msgstr "Παράμετροι" #: ulng.rsopthotkeyssetdeleteshortcut msgid "Set shortcut to delete file" msgstr "Καθορισμός συντόμευσης για διαγραφή αρχείου" #: ulng.rsopthotkeysshortcutfordeletealreadyassigned msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?" msgstr "Για να λειτουργήσει αυτή η ρύθμιση με τη συντόμευση %s, η συντόμευση %s πρέπει να κατοχυρωθεί στο cm_Delete αλλά είναι ήδη εκχωρημένη στο %s. Επιθυμείτε να την αλλάξετε;" #: ulng.rsopthotkeysshortcutfordeleteissequence msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work." msgstr "Η συντόμευση %s για το cm_Delete είναι μία ακολουθία συντόμευσης για την οποία ένα ειδικό πλήκτρο που να απασχολεί το Shift δεν μπορεί να οριστεί. Αυτή η ρύθμιση πιθανώς δε θα λειτουργήσει." #: ulng.rsopthotkeysshortcutused msgid "Shortcut in use" msgstr "Συντόμευση σε χρήση" #: ulng.rsopthotkeysshortcutusedtext1 msgid "Shortcut %s is already used." msgstr "Συντόμευση %s έχει ήδη χρησιμοποιηθεί." #: ulng.rsopthotkeysshortcutusedtext2 msgid "Change it to %s?" msgstr "Αλλαγή σε %s;" #: ulng.rsopthotkeysusedby msgid "used for %s in %s" msgstr "χρησιμοποιείται για %s σε %s" #: ulng.rsopthotkeysusedwithdifferentparams msgid "used for this command but with different parameters" msgstr "χρησιμοποιείται για αυτή την εντολή αλλά με διαφορετικές παραμέτρους" #: ulng.rsoptionseditorarchivers msgctxt "ulng.rsoptionseditorarchivers" msgid "Archivers" msgstr "Εφαρμογές Συμπίεσης" #: ulng.rsoptionseditorautorefresh msgctxt "ulng.rsoptionseditorautorefresh" msgid "Auto refresh" msgstr "Αυτόματη Ανανέωση" #: ulng.rsoptionseditorbehavior msgctxt "ulng.rsoptionseditorbehavior" msgid "Behaviors" msgstr "Γενικές Ρυθμίσεις" #: ulng.rsoptionseditorbriefview msgctxt "ulng.rsoptionseditorbriefview" msgid "Brief" msgstr "Σύντομα" #: ulng.rsoptionseditorcolors msgctxt "ulng.rsoptionseditorcolors" msgid "Colors" msgstr "Χρώματα" #: ulng.rsoptionseditorcolumnsview msgid "Columns" msgstr "Στήλες" #: ulng.rsoptionseditorconfiguration msgctxt "ulng.rsoptionseditorconfiguration" msgid "Configuration" msgstr "Διαμόρφωση" #: ulng.rsoptionseditorcustomcolumns msgid "Custom columns" msgstr "Προσαρμοσμένες στήλες" #: ulng.rsoptionseditordirectoryhotlist msgctxt "ulng.rsoptionseditordirectoryhotlist" msgid "Directory Hotlist" msgstr "Κατάλογος Hotlist" #: ulng.rsoptionseditordraganddrop msgid "Drag & drop" msgstr "Μεταφορά & απόθεση" #: ulng.rsoptionseditordriveslistbutton msgid "Drives list button" msgstr "Κουμπιά Λίστας Οδηγών" #: ulng.rsoptionseditorfavoritetabs msgid "Favorite Tabs" msgstr "Αγαπημένες Καρτέλες" #: ulng.rsoptionseditorfileassicextra msgid "File associations extra" msgstr "Έξτρα Συσχετισμών Αρχείου" #: ulng.rsoptionseditorfileassoc msgctxt "ulng.rsoptionseditorfileassoc" msgid "File associations" msgstr "Συσχετισμοί Αρχείου" #: ulng.rsoptionseditorfilenewfiletypes msgctxt "ulng.rsoptionseditorfilenewfiletypes" msgid "New" msgstr "Νέο" #: ulng.rsoptionseditorfileoperations msgctxt "ulng.rsoptionseditorfileoperations" msgid "File operations" msgstr "Λειτουργίες Αρχείου" #: ulng.rsoptionseditorfilepanels msgctxt "ulng.rsoptionseditorfilepanels" msgid "File panels" msgstr "Πάνελ Αρχείων" #: ulng.rsoptionseditorfilesearch msgctxt "ulng.rsoptionseditorfilesearch" msgid "File search" msgstr "Αναζήτηση Αρχείου" #: ulng.rsoptionseditorfilesviews msgid "Files views" msgstr "Προβολές Αρχείων" #: ulng.rsoptionseditorfiletypes msgctxt "ulng.rsoptionseditorfiletypes" msgid "File types" msgstr "Τύποι Αρχείου" #: ulng.rsoptionseditorfoldertabs msgctxt "ulng.rsoptionseditorfoldertabs" msgid "Folder tabs" msgstr "Καρτέλες Φακέλων" #: ulng.rsoptionseditorfoldertabsextra msgid "Folder tabs extra" msgstr "Έξτρα Καρτελών Φακέλων" #: ulng.rsoptionseditorfonts msgctxt "ulng.rsoptionseditorfonts" msgid "Fonts" msgstr "Γραμματοσειρές" #: ulng.rsoptionseditorhighlighters msgid "Highlighters" msgstr "Μαρκαδόροι" #: ulng.rsoptionseditorhotkeys msgctxt "ulng.rsoptionseditorhotkeys" msgid "Hot keys" msgstr "Ειδικά Πλήκτρα" #: ulng.rsoptionseditoricons msgctxt "ulng.rsoptionseditoricons" msgid "Icons" msgstr "Εικονίδια" #: ulng.rsoptionseditorignorelist msgctxt "ulng.rsoptionseditorignorelist" msgid "Ignore list" msgstr "Λίστα Αγνοημένων" #: ulng.rsoptionseditorkeyboard msgid "Keys" msgstr "Πλήκτρα" #: ulng.rsoptionseditorlanguage msgctxt "ulng.rsoptionseditorlanguage" msgid "Language" msgstr "Γλώσσα" #: ulng.rsoptionseditorlayout msgctxt "ulng.rsoptionseditorlayout" msgid "Layout" msgstr "Διάταξη" #: ulng.rsoptionseditorlog msgctxt "ulng.rsoptionseditorlog" msgid "Log" msgstr "Καταγραφή" #: ulng.rsoptionseditormiscellaneous msgctxt "ulng.rsoptionseditormiscellaneous" msgid "Miscellaneous" msgstr "Διάφορα" #: ulng.rsoptionseditormouse msgid "Mouse" msgstr "Ποντίκι" #: ulng.rsoptionseditoroptionschanged msgid "" "Options have changed in \"%s\"\n" "\n" "Do you want to save modifications?\n" msgstr "" "Οι Ρυθμίσεις έχουν αλλάξει στο \"%s\"\n" "\n" "Επιθυμείτε αποθήκευση των αλλαγών?\n" #: ulng.rsoptionseditorplugins msgctxt "ulng.rsoptionseditorplugins" msgid "Plugins" msgstr "Πρόσθετα" #: ulng.rsoptionseditorquicksearch msgctxt "ulng.rsoptionseditorquicksearch" msgid "Quick search/filter" msgstr "Φίλτρο ταχείας αναζήτησης" #: ulng.rsoptionseditorterminal msgctxt "ulng.rsoptionseditorterminal" msgid "Terminal" msgstr "Τερματικό" #: ulng.rsoptionseditortoolbar msgid "Toolbar" msgstr "Γραμμή εργαλείων" #: ulng.rsoptionseditortools msgctxt "ulng.rsoptionseditortools" msgid "Tools" msgstr "Εργαλεία" #: ulng.rsoptionseditortooltips msgctxt "ulng.rsoptionseditortooltips" msgid "Tooltips" msgstr "Υποδείξεις" #: ulng.rsoptionseditortreeviewmenu msgctxt "ulng.rsoptionseditortreeviewmenu" msgid "Tree View Menu" msgstr "Μενού Προβολής Δέντρου" #: ulng.rsoptionseditortreeviewmenucolors msgid "Tree View Menu Colors" msgstr "Χρώματα Μενού Προβολής Δέντρου" #: ulng.rsoptletters msgid "None;Command Line;Quick Search;Quick Filter" msgstr "Κανένα;Γραμμή Εντολών;Ταχεία αναζήτηση;Γρήγορο Φίλτρο" #: ulng.rsoptmouseselectionbutton msgid "Left button;Right button;" msgstr "Αριστερό Κουμπί;Δεξιό Κουμπί;" #: ulng.rsoptnewfilesposition msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list" msgstr "στην κορυφή της λίστας αρχείου;μετά τους καταλόγους (αν οι κατάλογοι είναι τοποθετημένοι πριν τα αρχεία);σε ταξινομημένη θέση;στο τέλος της λίστας αρχείου" #: ulng.rsoptpluginalreadyassigned msgid "Plugin %s is already assigned for the following extensions:" msgstr "Το Πρόσθετο %s έχει ήδη εκχωρηθεί για τις ακόλουθες επεκτάσεις:" #: ulng.rsoptpluginsactive msgctxt "ulng.rsoptpluginsactive" msgid "Active" msgstr "Ενεργό" #: ulng.rsoptpluginsfilename msgctxt "ulng.rsoptpluginsfilename" msgid "File name" msgstr "Ονομασία αρχείου" #: ulng.rsoptpluginsname msgctxt "ulng.rsoptpluginsname" msgid "Name" msgstr "Όνομα" #: ulng.rsoptpluginsregisteredfor msgctxt "ulng.rsoptpluginsregisteredfor" msgid "Registered for" msgstr "Έχει καταχωρηθεί σε" #: ulng.rsoptsearchcase msgid "&Sensitive;&Insensitive" msgstr "Ενεργοποιημένο;Απενεργοποιημένο" #: ulng.rsoptsearchitems msgid "&Files;Di&rectories;Files a&nd Directories" msgstr "Αρχεία;Κατάλογοι;Αρχεία και Κατάλογοι" #: ulng.rsoptsearchopt msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session" msgstr "&Κρύψιμο του πάνελ φίλτρου όταν δεν είναι εστιασμένο;συνέχιση αποθήκευσης ρυθμίσεων μετατροπών για την επόμενη συνεδρία" #: ulng.rsoptsortcasesens msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)" msgstr "χωρίς διάκριση πεζών-κεφαλαίων;σύμφωνα με τις ρυθμίσεις εντοπιότητας (αΑβΒγΓ);το πρώτο πεζό μετά κεφαλαίο (ΑΒΓαβγ)" #: ulng.rsoptsortfoldermode msgid "sort by name and show first;sort like files and show first;sort like files" msgstr "ταξινόμηση κατά όνομα και εμφάνιση του πρώτου;ταξινόμηση σαν αρχεία και εμφάνιση του πρώτου;ταξινόμηση σαν αρχεία" #: ulng.rsoptsortmethod msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers" msgstr "Αλφαβητικά, σε σχέση με τον τονισμό;φυσική κατάταξη: αλφαβητικά και αριθμητικά" #: ulng.rsopttabsposition msgid "Top;Bottom;" msgstr "Κορυφή;Κάτω;" #: ulng.rsopttoolbarbuttontype msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u" msgstr "Διαχωριστικό;Εσωτερική εντολή;Εξωτερική εντολή;Μενού" #: ulng.rsopttypeofduplicatedrename msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext" msgstr "DC legacy - Αντιγραφή (x) όνομα_αρχείου.επέκταση;Windows - όνομα_αρχείου (x).επέκταση;Άλλα - όνομα_αρχείου(x).επέκταση" #: ulng.rsoptupdatedfilesposition msgid "don't change position;use the same setting as for new files;to sorted position" msgstr "χωρίς αλλαγή θέσης;χρήση της ίδιας ρύθμισης με τα νέα αρχεία;σε ταξινομημένη θέση" #: ulng.rspropscontains msgid "Files: %d, folders: %d" msgstr "Αρχεία: %d, Φάκελοι: %d" #: ulng.rspropserrchmod msgid "Can not change access rights for \"%s\"" msgstr "Αδυναμία αλλαγής δικαιωμάτων πρόσβασης για \"%s\"" #: ulng.rspropserrchown msgid "Can not change owner for \"%s\"" msgstr "Αδυναμία αλλαγής ιδιοκτησίας για \"%s\"" #: ulng.rspropsfile msgctxt "ulng.rspropsfile" msgid "File" msgstr "Αρχείο" #: ulng.rspropsfolder msgctxt "ulng.rspropsfolder" msgid "Directory" msgstr "Κατάλογος" #: ulng.rspropsnmdpipe msgid "Named pipe" msgstr "Ονομασμένο pipe" #: ulng.rspropssocket msgid "Socket" msgstr "Socket" #: ulng.rspropsspblkdev msgid "Special block device" msgstr "Ειδική block device" #: ulng.rspropsspchrdev msgid "Special character device" msgstr "Ειδική character device" #: ulng.rspropssymlink msgid "Symbolic link" msgstr "Συμβολoδεσμός" #: ulng.rspropsunknowntype msgid "Unknown type" msgstr "Άγνωστος τύπος" #: ulng.rssearchresult msgid "Search result" msgstr "Αναζήτηση αποτελέσματος" #: ulng.rssearchstatus msgid "SEARCH" msgstr "ΑΝΑΖΗΤΗΣΗ" #: ulng.rssearchtemplateunnamed msgid "" msgstr "<πρότυπο χωρίς όνομα>" #: ulng.rssearchwithdsxplugininprogress msgid "" "A file search using DSX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" "Μια αναζήτηση αρχείων με χρήση του προσθέτου DSX είναι ήδη σε εξέλιξη.\n" "Πρέπει να ολοκληρωθεί αυτή ώστε να φορτωθεί μια νέα.\n" #: ulng.rssearchwithwdxplugininprogress msgid "" "A file search using WDX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" "Μια αναζήτηση αρχείων με χρήση του προσθέτου WDX είναι ήδη σε εξέλιξη.\n" "Πρέπει να ολοκληρωθεί αυτή ώστε να φορτωθεί μια νέα.\n" #: ulng.rsselectdir msgid "Select a directory" msgstr "Επιλέξτε ένα κατάλογο" #: ulng.rsselectyoufindfileswindow msgid "Select your window" msgstr "Επιλογή επιθυμητού παραθύρου" #: ulng.rsshowhelpfor msgid "&Show help for %s" msgstr "Εμφάνιση βοήθειας για %s" #: ulng.rssimplewordall msgctxt "ulng.rssimplewordall" msgid "All" msgstr "Όλα" #: ulng.rssimplewordcategory msgctxt "ulng.rssimplewordcategory" msgid "Category" msgstr "Κατηγορία" #: ulng.rssimplewordcolumnsingular msgid "Column" msgstr "Στήλη" #: ulng.rssimplewordcommand msgctxt "ulng.rssimplewordcommand" msgid "Command" msgstr "Εντολή" #: ulng.rssimplewordfilename msgid "Filename" msgstr "Όνομα αρχείου" #: ulng.rssimplewordfiles msgid "files" msgstr "Αρχεία" #: ulng.rssimplewordletter msgid "Letter" msgstr "Γράμμα" #: ulng.rssimplewordparameter msgid "Param" msgstr "Παράμετρος" #: ulng.rssimplewordresult msgid "Result" msgstr "Αποτέλεσμα" #: ulng.rssimplewordworkdir msgid "WorkDir" msgstr "Κατάλογος Εργασίας" #: ulng.rssizeunitbytes msgid "Bytes" msgstr "Bytes" #: ulng.rssizeunitgbytes msgctxt "ulng.rssizeunitgbytes" msgid "Gigabytes" msgstr "Gigabytes" #: ulng.rssizeunitkbytes msgctxt "ulng.rssizeunitkbytes" msgid "Kilobytes" msgstr "Kilobytes" #: ulng.rssizeunitmbytes msgctxt "ulng.rssizeunitmbytes" msgid "Megabytes" msgstr "Megabytes" #: ulng.rssizeunittbytes msgid "Terabytes" msgstr "Terabytes" #: ulng.rsspacemsg msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)" msgstr "Αρχεία: %d, Κατάλογοι: %d, Μέγεθος: %s (%s bytes)" #: ulng.rsspliterrdirectory msgid "Unable to create target directory!" msgstr "Αδυναμία δημιουργίας καταλόγου στόχου!" #: ulng.rsspliterrfilesize msgid "Incorrect file size format!" msgstr " Μη Έγκυρος τύπος μεγέθους αρχείου!" #: ulng.rsspliterrsplitfile msgid "Unable to split the file!" msgstr "Αδυναμία διαμερισμού του Αρχείου!" #: ulng.rssplitmsgmanyparts msgid "The number of parts is more than 100! Continue?" msgstr "Ο αριθμός τμημάτων είναι παραπάνω από 100! Συνέχιση;" #: ulng.rssplitpredefinedsizes msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R" msgstr "Αυτόματα;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R" #: ulng.rssplitseldir msgid "Select directory:" msgstr "Επιλογή καταλόγου:" #: ulng.rsstraccents msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ" msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ" #: ulng.rsstraccentsstripped msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE" msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE" #: ulng.rsstrpreviewjustpreview msgid "Just preview" msgstr "Μόνο προεπισκόπηση" #: ulng.rsstrpreviewothers msgid "Others" msgstr "Άλλα" #: ulng.rsstrpreviewsearchingletters msgid "OU" msgstr "OU" #: ulng.rsstrpreviewsidenote msgid "Side note" msgstr "Υποσημείωση" #: ulng.rsstrpreviewwordwithoutsearched1 msgid "Flat" msgstr "Επίπεδο" #: ulng.rsstrpreviewwordwithoutsearched2 msgid "Limited" msgstr "Περιορισμένο" #: ulng.rsstrpreviewwordwithoutsearched3 msgid "Simple" msgstr "Απλό" #: ulng.rsstrpreviewwordwithsearched1 msgid "Fabulous" msgstr "Fabulous" #: ulng.rsstrpreviewwordwithsearched2 msgid "Marvelous" msgstr "Marvelous" #: ulng.rsstrpreviewwordwithsearched3 msgid "Tremendous" msgstr "Tremendous" #: ulng.rsstrtvmchoosedirhistory msgid "Choose your directory from Dir History" msgstr "Επιλογή καταλόγου από το Ιστορικό Καταλόγου" #: ulng.rsstrtvmchoosefavoritetabs msgid "Choose you Favorite Tabs:" msgstr "Επιλογή Αγαπημένων Καρτελών:" #: ulng.rsstrtvmchoosefromcmdlinehistory msgid "Choose your command from Command Line History" msgstr "Επιλογή Εντολής από το Ιστορικό Γραμμής Εντολών" #: ulng.rsstrtvmchoosefrommainmenu msgid "Choose your action from Main Menu" msgstr "Επιλογή Ενέργειας από το Βασικό Μενού" #: ulng.rsstrtvmchoosefromtoolbar msgid "Choose your action from Maintool bar" msgstr "Επιλογή Ενέργειας από τη γραμμή Βασικών Εργαλείων" #: ulng.rsstrtvmchoosehotdirectory msgid "Choose your directory from Hot Directory:" msgstr "Επιλογή καταλόγου από το Hot Directory:" #: ulng.rsstrtvmchooseviewhistory msgid "Choose your directory from File View History" msgstr "Επιλογή καταλόγου από το Ιστορικό Προβολής Αρχείου" #: ulng.rsstrtvmchooseyourfileordir msgid "Choose your file or your directory" msgstr "Επιλογή αρχείου ή καταλόγου" #: ulng.rssymerrcreate msgid "Error creating symlink." msgstr "Λάθος κατά τη δημιουργία συμβολοδεσμού." #: ulng.rssyndefaulttext msgctxt "ulng.rssyndefaulttext" msgid "Default text" msgstr "Προκαθορισμένο Κείμενο" #: ulng.rssynlangplaintext msgctxt "ulng.rssynlangplaintext" msgid "Plain text" msgstr "Απλό Κείμενο" #: ulng.rstabsactionondoubleclickchoices msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu" msgstr "Να μη γίνει τίποτα;Κλείσιμο καρτέλας;Πρόσβαση Αγαπημένων Καρτελών;Αναδυόμενο μενού Καρτελών" #: ulng.rstimeunitday msgctxt "ulng.rstimeunitday" msgid "Day(s)" msgstr "Μέρα(ες)" #: ulng.rstimeunithour msgid "Hour(s)" msgstr "Ώρα(ες)" #: ulng.rstimeunitminute msgid "Minute(s)" msgstr "Λεπτό(ά)" #: ulng.rstimeunitmonth msgid "Month(s)" msgstr "Μήνας(ες)" #: ulng.rstimeunitsecond msgid "Second(s)" msgstr "Δευτερόλεπτο(α)" #: ulng.rstimeunitweek msgid "Week(s)" msgstr "Εβδομάδα(ες)" #: ulng.rstimeunityear msgid "Year(s)" msgstr "Χρόνος(ια)" #: ulng.rstitlerenamefavtabs msgid "Rename Favorite Tabs" msgstr "Μετονομασία Αγαπημένων Καρτελών" #: ulng.rstitlerenamefavtabsmenu msgid "Rename Favorite Tabs sub-menu" msgstr "Μετονομασία υπο-μενού Αγαπημένων Καρτελών" #: ulng.rstooldiffer msgctxt "ulng.rstooldiffer" msgid "Differ" msgstr "Differ" #: ulng.rstooleditor msgctxt "ulng.rstooleditor" msgid "Editor" msgstr "Επεξεργαστής" #: ulng.rstoolerroropeningdiffer msgid "Error opening differ" msgstr "Λάθος ανοίγματος differ" #: ulng.rstoolerroropeningeditor msgid "Error opening editor" msgstr "Λάθος ανοίγματος επεξεργαστή" #: ulng.rstoolerroropeningterminal msgid "Error opening terminal" msgstr "Λάθος ανοίγματος τερματικού" #: ulng.rstoolerroropeningviewer msgid "Error opening viewer" msgstr "Λάθος ανοίγματος προβολέα" #: ulng.rstoolterminal msgctxt "ulng.rstoolterminal" msgid "Terminal" msgstr "Τερματικό" #: ulng.rstoolviewer msgctxt "ulng.rstoolviewer" msgid "Viewer" msgstr "Προβολέας" #: ulng.rsunhandledexceptionmessage msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program." msgstr "Παρακαλώ αναφέρετε αυτό το πρόβλημα στον αποσφαλματωτή με μία περιγραφή του τι έχετε κάνει και το ακόλουθο αρχείο:%sΠιέστε %s για να συνεχίσετε ή %s για απόρριψη του προγράμματος." #: ulng.rsvarbothpanelactivetoinactive msgid "Both panels, from active to inactive" msgstr "Και τα δύο πάνελ, από το ενεργό στο ανενεργό" #: ulng.rsvarbothpanellefttoright msgid "Both panels, from left to right" msgstr "Και τα δύο πάνελ, από τα αριστερά στα δεξιά" #: ulng.rsvarcurrentpath msgid "Path of panel" msgstr "Διαδρομή του πάνελ" #: ulng.rsvarencloseelement msgid "Enclose each name in brackets or what you want" msgstr "Βάλτε κάθε όνομα σε παρένθεση ή οτιδήποτε επιθυμείτε" #: ulng.rsvarfilenamenoext msgid "Just filename, no extension" msgstr "Μόνο όνομα αρχείου, χωρίς επέκταση" #: ulng.rsvarfullpath msgid "Complete filename (path+filename)" msgstr "Πλήρες όνομα αρχείου (διαδρομή και όνομα αρχείου)" #: ulng.rsvarhelpwith msgid "Help with \"%\" variables" msgstr "Βοήθεια για \"%\" μεταβλητές" #: ulng.rsvarinputparam msgid "Will request request user to enter a parameter with a default suggested value" msgstr "Θα ζητηθεί από το χρήστη να εισάγει μια παράμετρο με την προκαθορισμένη προτεινόμενη τιμή" #: ulng.rsvarleftpanel msgid "Left panel" msgstr "Αριστερό πάνελ" #: ulng.rsvarlistfilename msgid "Temporary filename of list of filenames" msgstr "Προσωρινό όνομα αρχείου τη λίστας με τα ονόματα αρχείων" #: ulng.rsvarlistfullfilename msgid "Temporary filename of list of complete filenames (path+filename)" msgstr "Προσωρινό όνομα αρχείου τη λίστας με τα ολοκληρωμένα ονόματα αρχείων (διαδρομή+όνομα αρχείου)" #: ulng.rsvarlistinutf16 msgid "Filenames in list in UTF-16 with BOM" msgstr "Ονόματα αρχείων λίστας σε UTF-16 με BOM" #: ulng.rsvarlistinutf16quoted msgid "Filenames in list in UTF-16 with BOM, inside double quotes" msgstr "Ονόματα αρχείων λίστας σε UTF-16 με BOM, μέσα σε διπλά εισαγωγικά" #: ulng.rsvarlistinutf8 msgid "Filenames in list in UTF-8" msgstr "Ονόματα αρχείων λίστας σε UTF-8" #: ulng.rsvarlistinutf8quoted msgid "Filenames in list in UTF-8, inside double quotes" msgstr "Ονόματα αρχείων λίστας σε UTF-8, μέσα σε διπλά εισαγωγικά" #: ulng.rsvarlistrelativefilename msgid "Temporary filename of list of filenames with relative path" msgstr "Προσωρινό όνομα αρχείου τη λίστας με τα ονόματα αρχείων με σχετική διαδρομή" #: ulng.rsvaronlyextension msgid "Only file extension" msgstr "Μόνο επέκταση αρχείου" #: ulng.rsvaronlyfilename msgid "Only filename" msgstr "Μόνο όνομα αρχείου" #: ulng.rsvarotherexamples msgid "Other example of what's possible" msgstr "Άλλο παράδειγμα για το τι είναι δυνατό" #: ulng.rsvarpath msgid "Path, without ending delimiter" msgstr "Διαδρομή, χωρίς τελικό οριοθέτη" #: ulng.rsvarpercentchangetopound msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign" msgstr "Από εδώ ως το τέλος της γραμμής, ο δείκτης της μεταβλητής επί τοις εκατό είναι το \"#\" σύμβολο" #: ulng.rsvarpercentsign msgid "Return the percent sign" msgstr "Επιστροφή του συμβόλου επί τοις εκατό" #: ulng.rsvarpoundchangetopercent msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign" msgstr "Από εδώ ως το τέλος της γραμμής, ο δείκτης της μεταβλητής επί τοις εκατό είναι πάλι το \"%\" σύμβολο" #: ulng.rsvarprependelement msgid "Prepend each name with \"-a \" or what you want" msgstr "Βάλτε ως πρόθυμα στα ονόματα ένα \"-α \" 'η ότι άλλο επιθυμείτε" #: ulng.rsvarpromptuserforparam msgid "%[Prompt user for param;Default value proposed]" msgstr "%[Ερώτηση χρήστη για παράμετρο;Πρόταση προκαθορισμένης τιμής]" #: ulng.rsvarrelativepathandfilename msgid "Filename with relative path" msgstr "Όνομα αρχείου με σχετική διαδρομή" #: ulng.rsvarrightpanel msgid "Right panel" msgstr "Δεξιό πάνελ" #: ulng.rsvarsecondelementrightpanel msgid "Full path of second selected file in right panel" msgstr "Πλήρης διαδρομή του δεύτερου επιλεγμένου αρχείου στο δεξιό πάνελ" #: ulng.rsvarshowcommandprior msgid "Show command prior execute" msgstr "Εμφάνιση εντολής προ εκτέλεσης" #: ulng.rsvarsimplemessage msgid "%[Simple message]" msgstr "%[Απλό μήνυμα]" #: ulng.rsvarsimpleshowmessage msgid "Will show a simple message" msgstr "Θα εμφανίσει ένα απλό μήνυμα" #: ulng.rsvarsourcepanel msgid "Active panel (source)" msgstr "Ενεργό πάνελ (πηγή)" #: ulng.rsvartargetpanel msgid "Inactive panel (target)" msgstr "Ανενεργό πάνελ (στόχος)" #: ulng.rsvarwillbequoted msgid "Filenames will be quoted from here (default)" msgstr "Τα ονόματα αρχείων θα μπουν σε εισαγωγικά από εδώ (προκαθορισμένο)" #: ulng.rsvarwilldointerminal msgid "Command will be done in terminal, remaining opened at the end" msgstr "Η Εντολή θα εκτελεστεί σε τερματικό που θα μείνει ανοικτό στο τέλος" #: ulng.rsvarwillhaveendingdelimiter msgid "Paths will have ending delimiter" msgstr "Οι Διαδρομές θα έχουν τελικό οριοθέτη" #: ulng.rsvarwillnotbequoted msgid "Filenames will not be quoted from here" msgstr "Τα ονόματα αρχείων δε θα μπουν σε εισαγωγικά από εδώ" #: ulng.rsvarwillnotdointerminal msgid "Command will be done in terminal, closed at the end" msgstr "Η εντολή θα πραγματοποιηθεί σε τερματικό που θα κλείσει στο τέλος" #: ulng.rsvarwillnothaveendingdelimiter msgid "Paths will not have ending delimiter (default)" msgstr "Οι Διαδρομές δε θα έχουν τελικό οριοθέτη (προκαθορισμένο)" #: ulng.rsvfsnetwork msgctxt "ulng.rsvfsnetwork" msgid "Network" msgstr "Δίκτυο" #: ulng.rsviewabouttext msgid "Internal Viewer of Double Commander." msgstr "Εσωτερικός Προβολέας του Double Commander." #: ulng.rsviewbadquality msgid "Bad Quality" msgstr "Κακή Ποιότητα" #: ulng.rsviewencoding msgctxt "ulng.rsviewencoding" msgid "Encoding" msgstr "Κωδικοποίηση" #: ulng.rsviewimagetype msgid "Image Type" msgstr "Τύπος Εικόνας" #: ulng.rsviewnewsize msgctxt "ulng.rsviewnewsize" msgid "New Size" msgstr "Νέο Μέγεθος" #: ulng.rsviewnotfound msgid "%s not found!" msgstr "%s δεν βρέθηκαν!" #: ulng.rsviewwithexternalviewer msgid "with external viewer" msgstr "με εξωτερικό προβολέα" #: ulng.rsviewwithinternalviewer msgid "with internal viewer" msgstr "με εσωτερικό προβολέα" #: ulng.rsxreplacements msgid "Number of replacement: %d" msgstr "Αριθμός αντικατάστασης: %d" #: ulng.rszeroreplacement msgid "No replacement took place." msgstr "Δεν πραγματοποιήθηκε καμία αντικατάσταση."