msgid "" msgstr "" "Project-Id-Version: Double Commander 0.7.8 beta\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: 2016-04-22 23:08+030\n" "PO-Revision-Date: 2017-07-08 07:12+0900\n" "Last-Translator: Sangjin \n" "Language-Team: Language \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Native-Language: 한국어\n" "Language: ko\n" "X-Generator: Poedit 2.0.2\n" #: fsyncdirsdlg.rscomparingpercent msgid "Comparing... %d%% (ESC to cancel)" msgstr "비교하기... %d%% (취소 ESC)" #: fsyncdirsdlg.rsdeleteright msgid "Right: Delete %d file(s)" msgstr "오른쪽: %d개 파일 삭제" #: fsyncdirsdlg.rsfilesfound msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)" msgstr "파일 찾음; %d (동일: %d, 다름: %d, 왼쪽 유일함: %d, 오른쪽 유일함: %d)" #: fsyncdirsdlg.rslefttorightcopy msgid "Left to Right: Copy %d files, total size: %d bytes" msgstr "왼쪽에서 오른쪽: %d개 파일 복사, 총 용량: %d 바이트" #: fsyncdirsdlg.rsrighttoleftcopy msgid "Right to Left: Copy %d files, total size: %d bytes" msgstr "오른쪽에서 왼쪽: %d 개 파일 복사, 총 용량: %d 바이트" #: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint msgid "Choose template..." msgstr "템플릿 선택..." #: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption msgid "C&heck free space" msgstr "사용 가능 공간 체크(&H)" #: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption msgid "Cop&y attributes" msgstr "속성 복사(&Y)" #: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption msgid "Copy o&wnership" msgstr "소유권 복사(&W)" #: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption msgid "Copy &permissions" msgstr "퍼미션 복사(&P)" #: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "날짜/시간 복사(&A)" #: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption msgid "Correct lin&ks" msgstr "링크 수정(&K)" #: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION" msgid "Drop readonly fla&g" msgstr "읽기전용 변경(&G)" #: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption msgid "E&xclude empty directories" msgstr "빈 폴더 제외(&X)" #: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption msgid "Fo&llow links" msgstr "링크 연결(&L)" #: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption msgid "&Reserve space" msgstr "공간 리버스(&R)" #: tfilesystemcopymoveoperationoptionsui.chkverify.caption msgid "&Verify" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint msgid "What to do when cannot set file time, attributes, etc." msgstr "시간, 속성을 지정할 수 없을 때" #: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption msgid "Use file template" msgstr "템플릿 파일 사용" #: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption msgid "When dir&ectory exists" msgstr "폴더가 존재할 때(&E)" #: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When &file exists" msgstr "파일이 존재할 때(&F)" #: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption msgid "When ca&nnot set property" msgstr "속성을 지정할 수 없을 때(&N)" #: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption msgid "" msgstr "<템플릿 없음>" #: tfrmabout.btnclose.caption msgctxt "TFRMABOUT.BTNCLOSE.CAPTION" msgid "&Close" msgstr "닫기(&C)" #: tfrmabout.btncopytoclipboard.caption msgid "Copy to clipboard" msgstr "클립보드로 복사" #: tfrmabout.caption msgctxt "TFRMABOUT.CAPTION" msgid "About" msgstr "Double Commander 정보" #: tfrmabout.lblbuild.caption msgctxt "tfrmabout.lblbuild.caption" msgid "Build" msgstr "빌드" #: tfrmabout.lblfreepascalver.caption msgctxt "tfrmabout.lblfreepascalver.caption" msgid "Free Pascal" msgstr "프리 파스칼언어" #: tfrmabout.lblhomepage.caption msgid "Home Page:" msgstr "홈페이지:" #: tfrmabout.lblhomepageaddress.caption msgid "http://doublecmd.sourceforge.net" msgstr "http://doublecmd.sourceforge.net" #: tfrmabout.lbllazarusver.caption msgctxt "tfrmabout.lbllazarusver.caption" msgid "Lazarus" msgstr "Lazarus" #: tfrmabout.lblrevision.caption msgctxt "TFRMABOUT.LBLREVISION.CAPTION" msgid "Revision" msgstr "수정" #: tfrmabout.lbltitle.caption msgctxt "TFRMABOUT.LBLTITLE.CAPTION" msgid "Double Commander" msgstr "더블 커맨더" #: tfrmabout.lblversion.caption msgctxt "tfrmabout.lblversion.caption" msgid "Version" msgstr "버전" #: tfrmattributesedit.btncancel.caption msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmattributesedit.btnok.caption msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmattributesedit.btnreset.caption msgid "&Reset" msgstr "재설정(&R)" #: tfrmattributesedit.caption msgid "Choose attributes" msgstr "속성 선택" #: tfrmattributesedit.cbarchive.caption msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION" msgid "&Archive" msgstr "보관(&A)" #: tfrmattributesedit.cbcompressed.caption msgid "Co&mpressed" msgstr "압축(&M)" #: tfrmattributesedit.cbdirectory.caption msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION" msgid "&Directory" msgstr "새 폴더(&D)" #: tfrmattributesedit.cbencrypted.caption msgid "&Encrypted" msgstr "암호화(&E)" #: tfrmattributesedit.cbhidden.caption msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION" msgid "&Hidden" msgstr "감추기(&H)" #: tfrmattributesedit.cbreadonly.caption msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION" msgid "Read o&nly" msgstr "읽기전용(&N)" #: tfrmattributesedit.cbsgid.caption msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmattributesedit.cbsparse.caption msgid "S&parse" msgstr "부족한(&P)" #: tfrmattributesedit.cbsticky.caption msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION" msgid "Sticky" msgstr "어려운" #: tfrmattributesedit.cbsuid.caption msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmattributesedit.cbsymlink.caption msgid "&Symlink" msgstr "심링크(&S)" #: tfrmattributesedit.cbsystem.caption msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION" msgid "S&ystem" msgstr "시스템(&Y)" #: tfrmattributesedit.cbtemporary.caption msgid "&Temporary" msgstr "임시파일(&T)" #: tfrmattributesedit.gbntfsattributes.caption msgid "NTFS attributes" msgstr "NTFS 속성" #: tfrmattributesedit.gbwingeneral.caption msgid "General attributes" msgstr "일반 속성" #: tfrmattributesedit.lblattrbitsstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "비트:" #: tfrmattributesedit.lblattrgroupstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "그룹" #: tfrmattributesedit.lblattrotherstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "다른 옵션" #: tfrmattributesedit.lblattrownerstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "소유자" #: tfrmattributesedit.lblexec.caption msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION" msgid "Execute" msgstr "실행" #: tfrmattributesedit.lblread.caption msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION" msgid "Read" msgstr "읽기" #: tfrmattributesedit.lbltextattrs.caption msgid "As te&xt:" msgstr "텍스트로(&X):" #: tfrmattributesedit.lblwrite.caption msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION" msgid "Write" msgstr "쓰기" #: tfrmbenchmark.caption msgid "Benchmark" msgstr "" #: tfrmbenchmark.lblbenchmarksize.caption msgid "Benchmark data size: %d MB" msgstr "" #: tfrmbenchmark.stgresult.columns[0].title.caption msgid "Hash" msgstr "" #: tfrmbenchmark.stgresult.columns[1].title.caption msgid "Time (ms)" msgstr "" #: tfrmbenchmark.stgresult.columns[2].title.caption msgid "Speed (MB/s)" msgstr "" #: tfrmchecksumcalc.caption msgctxt "TFRMCHECKSUMCALC.CAPTION" msgid "Calculate checksum..." msgstr "체크섬 계산..." #: tfrmchecksumcalc.cbopenafterjobiscomplete.caption msgid "Open checksum file after job is completed" msgstr "작업이 끝나면 체크섬 파일 열기" #: tfrmchecksumcalc.cbseparatefile.caption msgid "C&reate separate checksum file for each file" msgstr "각각의 파일에 분리된 체크섬 파일 생성(&R)" #: tfrmchecksumcalc.lblsaveto.caption msgid "&Save checksum file(s) to:" msgstr "체크섬 파일 저장(&S):" #: tfrmchecksumverify.btnclose.caption msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION" msgid "&Close" msgstr "닫기(&C)" #: tfrmchecksumverify.caption msgctxt "TFRMCHECKSUMVERIFY.CAPTION" msgid "Verify checksum..." msgstr "체크섬 검증..." #: tfrmconnectionmanager.btnadd.caption msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION" msgid "A&dd" msgstr "추가(&D)" #: tfrmconnectionmanager.btncancel.caption msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmconnectionmanager.btnconnect.caption msgid "C&onnect" msgstr "연결(&O)" #: tfrmconnectionmanager.btndelete.caption msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION" msgid "&Delete" msgstr "삭제(&D)" #: tfrmconnectionmanager.btnedit.caption msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION" msgid "&Edit" msgstr "편집(&E)" #: tfrmconnectionmanager.caption msgid "Connection manager" msgstr "연결 매니저" #: tfrmconnectionmanager.gbconnectto.caption msgid "Connect to:" msgstr "연결:" #: tfrmcopydlg.btnaddtoqueue.caption msgid "A&dd To Queue" msgstr "작업대기열에 더하기(&D)" #: tfrmcopydlg.btncancel.caption msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmcopydlg.btnoptions.caption msgid "O&ptions" msgstr "옵션(&P)" #: tfrmcopydlg.btnsaveoptions.caption msgid "Sa&ve these options as default" msgstr "이 옵션을 기본값으로 저장하기(&V)" #: tfrmcopydlg.caption msgctxt "TFRMCOPYDLG.CAPTION" msgid "Copy file(s)" msgstr "파일 복사하기" #: tfrmcopydlg.mnunewqueue.caption msgctxt "tfrmcopydlg.mnunewqueue.caption" msgid "New queue" msgstr "새 작업대기열" #: tfrmcopydlg.mnuqueue1.caption msgctxt "tfrmcopydlg.mnuqueue1.caption" msgid "Queue 1" msgstr "작업대기열 1" #: tfrmcopydlg.mnuqueue2.caption msgctxt "tfrmcopydlg.mnuqueue2.caption" msgid "Queue 2" msgstr "작업대기열 2" #: tfrmcopydlg.mnuqueue3.caption msgctxt "tfrmcopydlg.mnuqueue3.caption" msgid "Queue 3" msgstr "작업대기열 3" #: tfrmcopydlg.mnuqueue4.caption msgctxt "tfrmcopydlg.mnuqueue4.caption" msgid "Queue 4" msgstr "작업대기열 4" #: tfrmcopydlg.mnuqueue5.caption msgctxt "tfrmcopydlg.mnuqueue5.caption" msgid "Queue 5" msgstr "작업대기열 5" #: tfrmdescredit.actsavedescription.caption msgid "Save Description" msgstr "설명 저장" #: tfrmdescredit.btncancel.caption msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmdescredit.btnok.caption msgctxt "TFRMDESCREDIT.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmdescredit.caption msgid "File/folder comment" msgstr "파일/폴더 주석" #: tfrmdescredit.lbleditcommentfor.caption msgid "E&dit comment for:" msgstr "주석 편집하기(&D):" #: tfrmdescredit.lblencoding.caption msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION" msgid "&Encoding:" msgstr "인코딩(&E):" #: tfrmdescredit.lblfilename.caption msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION" msgid "???" msgstr "???" #: tfrmdiffer.actabout.caption msgctxt "TFRMDIFFER.ACTABOUT.CAPTION" msgid "About" msgstr "정보" #: tfrmdiffer.actautocompare.caption msgid "Auto Compare" msgstr "자동 비교하기" #: tfrmdiffer.actbinarycompare.caption msgid "Binary Mode" msgstr "바이너리 모드" #: tfrmdiffer.actcancelcompare.caption msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION" msgid "Cancel" msgstr "취소" #: tfrmdiffer.actcancelcompare.hint msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT" msgid "Cancel" msgstr "취소" #: tfrmdiffer.actcopylefttoright.caption msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION" msgid "Copy Block Right" msgstr "블럭 오른쪽 복사" #: tfrmdiffer.actcopylefttoright.hint msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT" msgid "Copy Block Right" msgstr "블럭 오른쪽 복사" #: tfrmdiffer.actcopyrighttoleft.caption msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION" msgid "Copy Block Left" msgstr "블럭 왼쪽 복사" #: tfrmdiffer.actcopyrighttoleft.hint msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT" msgid "Copy Block Left" msgstr "블럭 왼쪽 복사" #: tfrmdiffer.acteditcopy.caption msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "복사" #: tfrmdiffer.acteditcut.caption msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "자르기" #: tfrmdiffer.acteditdelete.caption msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "삭제" #: tfrmdiffer.acteditpaste.caption msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "붙여넣기" #: tfrmdiffer.acteditredo.caption msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "재실행" #: tfrmdiffer.acteditselectall.caption msgid "Select &All" msgstr "전부 선택(&A)" #: tfrmdiffer.acteditundo.caption msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "되돌리기" #: tfrmdiffer.actexit.caption msgctxt "TFRMDIFFER.ACTEXIT.CAPTION" msgid "E&xit" msgstr "종료(&X)" #: tfrmdiffer.actfirstdifference.caption msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION" msgid "First Difference" msgstr "첫 번째 차이점" #: tfrmdiffer.actfirstdifference.hint msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT" msgid "First Difference" msgstr "첫 번째 차이점" #: tfrmdiffer.actignorecase.caption msgid "Ignore Case" msgstr "이 경우 무시" #: tfrmdiffer.actignorewhitespace.caption msgid "Ignore Blanks" msgstr "공백 무시" #: tfrmdiffer.actkeepscrolling.caption msgid "Keep Scrolling" msgstr "스크롤 유지" #: tfrmdiffer.actlastdifference.caption msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION" msgid "Last Difference" msgstr "마지막 차이점" #: tfrmdiffer.actlastdifference.hint msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT" msgid "Last Difference" msgstr "마지막 차이점" #: tfrmdiffer.actlinedifferences.caption msgid "Line Differences" msgstr "줄 차이점" #: tfrmdiffer.actnextdifference.caption msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION" msgid "Next Difference" msgstr "다음 차이점" #: tfrmdiffer.actnextdifference.hint msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT" msgid "Next Difference" msgstr "다음 차이점" #: tfrmdiffer.actopenleft.caption msgid "Open Left..." msgstr "왼쪽 열기..." #: tfrmdiffer.actopenright.caption msgid "Open Right..." msgstr "오른쪽 열기..." #: tfrmdiffer.actpaintbackground.caption msgid "Paint Background" msgstr "백그라운드 칠하기" #: tfrmdiffer.actprevdifference.caption msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION" msgid "Previous Difference" msgstr "이전 차이점" #: tfrmdiffer.actprevdifference.hint msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT" msgid "Previous Difference" msgstr "이전 차이점" #: tfrmdiffer.actreload.caption msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION" msgid "&Reload" msgstr "재실행(&R)" #: tfrmdiffer.actreload.hint msgctxt "TFRMDIFFER.ACTRELOAD.HINT" msgid "Reload" msgstr "재실행" #: tfrmdiffer.actsave.caption msgctxt "TFRMDIFFER.ACTSAVE.CAPTION" msgid "Save" msgstr "저장" #: tfrmdiffer.actsave.hint msgctxt "TFRMDIFFER.ACTSAVE.HINT" msgid "Save" msgstr "저장" #: tfrmdiffer.actsaveas.caption msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION" msgid "Save as..." msgstr "새 이름 저장..." #: tfrmdiffer.actsaveas.hint msgctxt "TFRMDIFFER.ACTSAVEAS.HINT" msgid "Save as..." msgstr "새 이름 저장..." #: tfrmdiffer.actsaveleft.caption msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION" msgid "Save Left" msgstr "왼쪽 저장" #: tfrmdiffer.actsaveleft.hint msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT" msgid "Save Left" msgstr "왼쪽 저장" #: tfrmdiffer.actsaveleftas.caption msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION" msgid "Save Left As..." msgstr "왼쪽 새 이름 저장..." #: tfrmdiffer.actsaveleftas.hint msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT" msgid "Save Left As..." msgstr "왼쪽 새 이름 저장..." #: tfrmdiffer.actsaveright.caption msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION" msgid "Save Right" msgstr "오른쪽 저장" #: tfrmdiffer.actsaveright.hint msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT" msgid "Save Right" msgstr "오른쪽 저장" #: tfrmdiffer.actsaverightas.caption msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION" msgid "Save Right As..." msgstr "오른쪽 새 이름 저장..." #: tfrmdiffer.actsaverightas.hint msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT" msgid "Save Right As..." msgstr "오른쪽 새 이름 저장..." #: tfrmdiffer.actstartcompare.caption msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION" msgid "Compare" msgstr "비교하기" #: tfrmdiffer.actstartcompare.hint msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT" msgid "Compare" msgstr "비교하기" #: tfrmdiffer.btnleftencoding.hint msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT" msgid "Encoding" msgstr "인코딩" #: tfrmdiffer.btnrightencoding.hint msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT" msgid "Encoding" msgstr "인코딩" #: tfrmdiffer.caption msgctxt "TFRMDIFFER.CAPTION" msgid "Compare files" msgstr "파일 비교하기" #: tfrmdiffer.midivider1.caption msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider10.caption msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider2.caption msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider3.caption msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider4.caption msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider5.caption msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider6.caption msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider7.caption msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider8.caption msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider9.caption msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.miencodingleft.caption msgid "&Left" msgstr "왼쪽 방향키(&L)" #: tfrmdiffer.miencodingright.caption msgid "&Right" msgstr "오른쪽 방향키(&R)" #: tfrmdiffer.miseparator1.caption msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.miseparator2.caption msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.mnuactions.caption msgid "&Actions" msgstr "동작(&A)" #: tfrmdiffer.mnuedit.caption msgctxt "TFRMDIFFER.MNUEDIT.CAPTION" msgid "&Edit" msgstr "편집(&E)" #: tfrmdiffer.mnuencoding.caption msgctxt "TFRMDIFFER.MNUENCODING.CAPTION" msgid "En&coding" msgstr "인코딩(&C)" #: tfrmdiffer.mnufile.caption msgctxt "TFRMDIFFER.MNUFILE.CAPTION" msgid "&File" msgstr "파일(&F)" #: tfrmdiffer.mnuoptions.caption msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION" msgid "&Options" msgstr "설정(&O)" #: tfrmedithotkey.btnaddshortcut.hint msgid "Add new shortcut to sequence" msgstr "시퀀스에 새로운 단축키 지정" #: tfrmedithotkey.btncancel.caption msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmedithotkey.btnok.caption msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmedithotkey.btnremoveshortcut.hint msgid "Remove last shortcut from sequence" msgstr "시퀀스에 마지막 단축키 제거" #: tfrmedithotkey.btnselectfromlist.hint msgid "Select shortcut from list of remaining free available keys" msgstr "" #: tfrmedithotkey.cghkcontrols.caption msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION" msgid "Only for these controls" msgstr "이 제어에만" #: tfrmedithotkey.lblparameters.caption msgid "&Parameters (each in a separate line):" msgstr "매개변수 (분리된 각각의 줄)(&P):" #: tfrmedithotkey.lblshortcuts.caption msgid "Shortcuts:" msgstr "단축키:" #: tfrmeditor.actabout.caption msgctxt "TFRMEDITOR.ACTABOUT.CAPTION" msgid "About" msgstr "정보" #: tfrmeditor.actabout.hint msgctxt "TFRMEDITOR.ACTABOUT.HINT" msgid "About" msgstr "정보" #: tfrmeditor.actconfhigh.caption msgid "&Configuration" msgstr "환경설정(&C)" #: tfrmeditor.actconfhigh.hint msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT" msgid "Configuration" msgstr "환경설정" #: tfrmeditor.acteditcopy.caption msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "복사" #: tfrmeditor.acteditcopy.hint msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT" msgid "Copy" msgstr "복사" #: tfrmeditor.acteditcut.caption msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "자르기" #: tfrmeditor.acteditcut.hint msgctxt "TFRMEDITOR.ACTEDITCUT.HINT" msgid "Cut" msgstr "자르기" #: tfrmeditor.acteditdelete.caption msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "삭제" #: tfrmeditor.acteditdelete.hint msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT" msgid "Delete" msgstr "삭제" #: tfrmeditor.acteditfind.caption msgctxt "tfrmeditor.acteditfind.caption" msgid "&Find" msgstr "찾기(&F)" #: tfrmeditor.acteditfind.hint msgctxt "TFRMEDITOR.ACTEDITFIND.HINT" msgid "Find" msgstr "찾기" #: tfrmeditor.acteditfindnext.caption msgctxt "tfrmeditor.acteditfindnext.caption" msgid "Find next" msgstr "다음 찾기" #: tfrmeditor.acteditfindnext.hint msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT" msgid "Find next" msgstr "다음 찾기" #: tfrmeditor.acteditfindprevious.caption msgctxt "tfrmeditor.acteditfindprevious.caption" msgid "Find previous" msgstr "" #: tfrmeditor.acteditgotoline.caption msgctxt "tfrmeditor.acteditgotoline.caption" msgid "Goto Line..." msgstr "줄로 가기..." #: tfrmeditor.acteditlineendcr.caption msgctxt "tfrmeditor.acteditlineendcr.caption" msgid "Mac (CR)" msgstr "Mac (CR)" #: tfrmeditor.acteditlineendcr.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT" msgid "Mac (CR)" msgstr "Mac (CR)" #: tfrmeditor.acteditlineendcrlf.caption msgctxt "tfrmeditor.acteditlineendcrlf.caption" msgid "Windows (CRLF)" msgstr "윈도우즈(CRLF)" #: tfrmeditor.acteditlineendcrlf.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT" msgid "Windows (CRLF)" msgstr "윈도우즈 (CRLF)" #: tfrmeditor.acteditlineendlf.caption msgctxt "tfrmeditor.acteditlineendlf.caption" msgid "Unix (LF)" msgstr "유닉스 (LF)" #: tfrmeditor.acteditlineendlf.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT" msgid "Unix (LF)" msgstr "유닉스 (LF)" #: tfrmeditor.acteditpaste.caption msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "붙여넣기" #: tfrmeditor.acteditpaste.hint msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT" msgid "Paste" msgstr "붙여넣기" #: tfrmeditor.acteditredo.caption msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "재실행" #: tfrmeditor.acteditredo.hint msgctxt "TFRMEDITOR.ACTEDITREDO.HINT" msgid "Redo" msgstr "재실행" #: tfrmeditor.acteditrplc.caption msgid "&Replace" msgstr "바꾸기(&R)" #: tfrmeditor.acteditrplc.hint msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT" msgid "Replace" msgstr "바꾸기" #: tfrmeditor.acteditselectall.caption msgid "Select&All" msgstr "전체선택(&A)" #: tfrmeditor.acteditselectall.hint msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT" msgid "Select All" msgstr "전체선택" #: tfrmeditor.acteditundo.caption msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "되돌리기" #: tfrmeditor.acteditundo.hint msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT" msgid "Undo" msgstr "되돌리기" #: tfrmeditor.actfileclose.caption msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION" msgid "&Close" msgstr "닫기(&C)" #: tfrmeditor.actfileclose.hint msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT" msgid "Close" msgstr "닫기" #: tfrmeditor.actfileexit.caption msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION" msgid "E&xit" msgstr "종료(&X)" #: tfrmeditor.actfileexit.hint msgctxt "tfrmeditor.actfileexit.hint" msgid "Exit" msgstr "종료" #: tfrmeditor.actfilenew.caption msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION" msgid "&New" msgstr "새 파일(&N)" #: tfrmeditor.actfilenew.hint msgctxt "TFRMEDITOR.ACTFILENEW.HINT" msgid "New" msgstr "새 파일" #: tfrmeditor.actfileopen.caption msgid "&Open" msgstr "열기(&O)" #: tfrmeditor.actfileopen.hint msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT" msgid "Open" msgstr "열기" #: tfrmeditor.actfilereload.caption #, fuzzy msgctxt "tfrmeditor.actfilereload.caption" msgid "Reload" msgstr "다시 불러오기" #: tfrmeditor.actfilesave.caption msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION" msgid "&Save" msgstr "저장(&S)" #: tfrmeditor.actfilesave.hint msgctxt "TFRMEDITOR.ACTFILESAVE.HINT" msgid "Save" msgstr "저장" #: tfrmeditor.actfilesaveas.caption #, fuzzy #| msgid "Save &As.." msgid "Save &As..." msgstr "새 이름 저장(&A)..." #: tfrmeditor.actfilesaveas.hint msgid "Save As" msgstr "새 이름 저장" #: tfrmeditor.actsaveall.caption msgid "Sa&ve All" msgstr "전체 저장(&V)" #: tfrmeditor.actsaveall.hint msgid "Save All" msgstr "전체 저장" #: tfrmeditor.caption msgctxt "TFRMEDITOR.CAPTION" msgid "Editor" msgstr "편집기" #: tfrmeditor.help1.caption msgctxt "TFRMEDITOR.HELP1.CAPTION" msgid "&Help" msgstr "도움말(&H)" #: tfrmeditor.miedit.caption msgctxt "TFRMEDITOR.MIEDIT.CAPTION" msgid "&Edit" msgstr "편집(&E)" #: tfrmeditor.miencoding.caption msgctxt "TFRMEDITOR.MIENCODING.CAPTION" msgid "En&coding" msgstr "인코딩(&C)" #: tfrmeditor.miencodingin.caption msgid "Open as" msgstr "열기" #: tfrmeditor.miencodingout.caption msgctxt "tfrmeditor.miencodingout.caption" msgid "Save as" msgstr "새 이름 저장" #: tfrmeditor.mifile.caption msgctxt "TFRMEDITOR.MIFILE.CAPTION" msgid "&File" msgstr "파일(&F)" #: tfrmeditor.mihighlight.caption msgid "Syntax highlight" msgstr "구문 하이라이트" #: tfrmeditor.milineendtype.caption msgid "End Of Line" msgstr "끝 줄" #: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption #, fuzzy msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption" msgid "&Cancel" msgstr "취소(&C)" #: tfrmeditsearchreplace.buttonpanel.okbutton.caption #, fuzzy msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption" msgid "&OK" msgstr "확인(&O)" #: tfrmeditsearchreplace.cbsearchcasesensitive.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION" msgid "C&ase sensitivity" msgstr "대소문자 구분(&A)" #: tfrmeditsearchreplace.cbsearchfromcursor.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION" msgid "S&earch from caret" msgstr "(^)탈자부호 찾기(&E)" #: tfrmeditsearchreplace.cbsearchregexp.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION" msgid "&Regular expressions" msgstr "정규식 표현(&R)" #: tfrmeditsearchreplace.cbsearchselectedonly.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION" msgid "Selected &text only" msgstr "선택한 텍스트만(&T)" #: tfrmeditsearchreplace.cbsearchwholewords.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION" msgid "&Whole words only" msgstr "완전한 단어만(&W)" #: tfrmeditsearchreplace.gbsearchoptions.caption msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION" msgid "Option" msgstr "설정" #: tfrmeditsearchreplace.lblreplacewith.caption msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION" msgid "&Replace with:" msgstr "바꾸기(&R):" #: tfrmeditsearchreplace.lblsearchfor.caption msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION" msgid "&Search for:" msgstr "찾기(&S):" #: tfrmeditsearchreplace.rgsearchdirection.caption msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION" msgid "Direction" msgstr "방향" #: tfrmextractdlg.caption msgctxt "TFRMEXTRACTDLG.CAPTION" msgid "Unpack files" msgstr "압축풀기" #: tfrmextractdlg.cbextractpath.caption msgid "&Unpack path names if stored with files" msgstr "저장된 경로 함께 압축풀기(&U)" #: tfrmextractdlg.cbfilemask.text msgctxt "tfrmextractdlg.cbfilemask.text" msgid "*.*" msgstr "*.*" #: tfrmextractdlg.cbinseparatefolder.caption msgid "Unpack each archive to a &separate subdir (name of the archive)" msgstr "압축파일 하위폴더에 분리하여 풀기(&S)" #: tfrmextractdlg.cboverwrite.caption msgid "O&verwrite existing files" msgstr "기존파일 덮어쓰기(&V)" #: tfrmextractdlg.lblextractto.caption msgid "To the &directory:" msgstr "폴더로(&D):" #: tfrmextractdlg.lblfilemask.caption msgid "&Extract files matching file mask:" msgstr "파일 마스크와 일치하는 파일 추출(&E):" #: tfrmextractdlg.lblpassword.caption msgid "&Password for encrypted files:" msgstr "파일 암호(&P):" #: tfrmfileexecuteyourself.btnclose.caption msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION" msgid "&Close" msgstr "닫기(&C)" #: tfrmfileexecuteyourself.caption msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION" msgid "Wait..." msgstr "기다려 주세요..." #: tfrmfileexecuteyourself.lblfilename.caption msgid "File name:" msgstr "파일명:" #: tfrmfileexecuteyourself.lblfrompath.caption msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION" msgid "From:" msgstr "압축 대상:" #: tfrmfileexecuteyourself.lblprompt.caption msgid "Click on Close when the temporary file can be deleted!" msgstr "닫기를 누르면 임시파일이 삭제됩니다." #: tfrmfileop.btncancel.caption msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmfileop.btnminimizetopanel.caption msgid "&To panel" msgstr "아래로(&T)" #: tfrmfileop.btnviewoperations.caption msgid "&View all" msgstr "전체 보기(&V)" #: tfrmfileop.lblcurrentoperation.caption msgid "Current operation:" msgstr "현재 작업:" #: tfrmfileop.lblfrom.caption msgctxt "TFRMFILEOP.LBLFROM.CAPTION" msgid "From:" msgstr "압축 대상:" #: tfrmfileop.lblto.caption msgid "To:" msgstr "압축 위치:" #: tfrmfileproperties.btnclose.caption msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION" msgid "&Close" msgstr "닫기(&C)" #: tfrmfileproperties.btnsetproperties.caption msgid "&Set properties" msgstr "속성 설정(&S)" #: tfrmfileproperties.btnsetpropertiestoallfiles.caption msgid "Set to &all selected files" msgstr "선택한 모든 파일 설정(&A)" #: tfrmfileproperties.btnskipfile.caption msgid "Ski&p this file" msgstr "이 파일 건너뛰기(&P)" #: tfrmfileproperties.caption msgctxt "TFRMFILEPROPERTIES.CAPTION" msgid "Properties" msgstr "속성" #: tfrmfileproperties.cbsgid.caption msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmfileproperties.cbsticky.caption msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Sticky" #: tfrmfileproperties.cbsuid.caption msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmfileproperties.chkexecutable.caption msgid "Allow &executing file as program" msgstr "" #: tfrmfileproperties.gbowner.caption msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION" msgid "Owner" msgstr "소유자" #: tfrmfileproperties.lblattrbitsstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "비트:" #: tfrmfileproperties.lblattrgroupstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "그룹" #: tfrmfileproperties.lblattrotherstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "다른 옵션" #: tfrmfileproperties.lblattrownerstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "소유자" #: tfrmfileproperties.lblattrtext.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "-----------" #: tfrmfileproperties.lblattrtextstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "텍스트:" #: tfrmfileproperties.lblcontains.caption msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblcontainsstr.caption msgid "Contains:" msgstr "Contains:" #: tfrmfileproperties.lblexec.caption msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "실행" #: tfrmfileproperties.lblexecutable.caption msgid "Execute:" msgstr "" #: tfrmfileproperties.lblfile.caption msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION" msgid "File name" msgstr "파일명" #: tfrmfileproperties.lblfilename.caption msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblfilestr.caption msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION" msgid "File name" msgstr "파일명" #: tfrmfileproperties.lblfolder.caption msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblfolderstr.caption msgctxt "tfrmfileproperties.lblfolderstr.caption" msgid "Path:" msgstr "경로:" #: tfrmfileproperties.lblgroupstr.caption msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION" msgid "&Group" msgstr "그룹(&G)" #: tfrmfileproperties.lbllastaccess.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllastaccessstr.caption msgid "Last access:" msgstr "마지막 액세스:" #: tfrmfileproperties.lbllastmodif.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllastmodifstr.caption msgid "Last modification:" msgstr "마지막 변경:" #: tfrmfileproperties.lbllaststchange.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllaststchangestr.caption msgid "Last status change:" msgstr "마지막 상태 변경:" #: tfrmfileproperties.lbloctal.caption msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "8진법:" #: tfrmfileproperties.lblownerstr.caption msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION" msgid "O&wner" msgstr "소유자(&W)" #: tfrmfileproperties.lblread.caption msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "읽기" #: tfrmfileproperties.lblsize.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblsizestr.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION" msgid "Size:" msgstr "크기:" #: tfrmfileproperties.lblsymlink.caption msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblsymlinkstr.caption msgid "Symlink to:" msgstr "심볼링크 달기:" #: tfrmfileproperties.lbltype.caption msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbltypestr.caption msgid "Type:" msgstr "형태:" #: tfrmfileproperties.lblwrite.caption msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "쓰기" #: tfrmfileproperties.sgimage.columns[0].title.caption #, fuzzy msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption" msgid "Name" msgstr "파일명" #: tfrmfileproperties.sgimage.columns[1].title.caption #, fuzzy msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption" msgid "Value" msgstr "값" #: tfrmfileproperties.tsattributes.caption msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION" msgid "Attributes" msgstr "파일속성" #: tfrmfileproperties.tsplugins.caption #, fuzzy msgctxt "tfrmfileproperties.tsplugins.caption" msgid "Plugins" msgstr "플러그인" #: tfrmfileproperties.tsproperties.caption msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION" msgid "Properties" msgstr "속성" #: tfrmfinddlg.actcancel.caption #, fuzzy msgctxt "tfrmfinddlg.actcancel.caption" msgid "C&ancel" msgstr "취소(&A)" #: tfrmfinddlg.actcancelclose.caption msgid "Cancel search and close window" msgstr "" #: tfrmfinddlg.actclose.caption #, fuzzy msgctxt "tfrmfinddlg.actclose.caption" msgid "&Close" msgstr "닫기(&C)" #: tfrmfinddlg.actconfigfilesearchhotkeys.caption msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption" msgid "Configuration of hot keys" msgstr "" #: tfrmfinddlg.actedit.caption #, fuzzy msgctxt "tfrmfinddlg.actedit.caption" msgid "&Edit" msgstr "편집(&E)" #: tfrmfinddlg.actfeedtolistbox.caption #, fuzzy msgctxt "tfrmfinddlg.actfeedtolistbox.caption" msgid "Feed to &listbox" msgstr "목록상자에 적용(&L)" #: tfrmfinddlg.actfreefrommem.caption msgid "Cancel search, close and free from memory" msgstr "" #: tfrmfinddlg.actfreefrommemallothers.caption msgid "For all other \"Find files\", cancel, close and free from memory" msgstr "" #: tfrmfinddlg.actgotofile.caption #, fuzzy msgctxt "tfrmfinddlg.actgotofile.caption" msgid "&Go to file" msgstr "파일로 가기(&G)" #: tfrmfinddlg.actintellifocus.caption #, fuzzy msgctxt "tfrmfinddlg.actintellifocus.caption" msgid "Find Data" msgstr "자료 찾기" #: tfrmfinddlg.actlastsearch.caption #, fuzzy msgctxt "tfrmfinddlg.actlastsearch.caption" msgid "&Last search" msgstr "마지막 검색(&L)" #: tfrmfinddlg.actnewsearch.caption #, fuzzy msgctxt "tfrmfinddlg.actnewsearch.caption" msgid "&New search" msgstr "새 검색(&N)" #: tfrmfinddlg.actnewsearchclearfilters.caption msgid "New search (clear filters)" msgstr "" #: tfrmfinddlg.actpageadvanced.caption msgid "Go to page \"Advanced\"" msgstr "" #: tfrmfinddlg.actpageloadsave.caption msgid "Go to page \"Load/Save\"" msgstr "" #: tfrmfinddlg.actpagenext.caption msgid "Switch to Nex&t Page" msgstr "" #: tfrmfinddlg.actpageplugins.caption msgid "Go to page \"Plugins\"" msgstr "" #: tfrmfinddlg.actpageprev.caption msgid "Switch to &Previous Page" msgstr "" #: tfrmfinddlg.actpageresults.caption msgid "Go to page \"Results\"" msgstr "" #: tfrmfinddlg.actpagestandard.caption msgid "Go to page \"Standard\"" msgstr "" #: tfrmfinddlg.actstart.caption #, fuzzy msgctxt "tfrmfinddlg.actstart.caption" msgid "&Start" msgstr "실행(&S)" #: tfrmfinddlg.actview.caption #, fuzzy msgctxt "tfrmfinddlg.actview.caption" msgid "&View" msgstr "보기(&V)" #: tfrmfinddlg.btnaddattribute.caption msgctxt "tfrmfinddlg.btnaddattribute.caption" msgid "&Add" msgstr "추가(&A)" #: tfrmfinddlg.btnattrshelp.caption msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION" msgid "&Help" msgstr "도움말(&H)" #: tfrmfinddlg.btnsavetemplate.caption msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION" msgid "&Save" msgstr "저장(&S)" #: tfrmfinddlg.btnsearchdelete.caption msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION" msgid "&Delete" msgstr "삭제(&D)" #: tfrmfinddlg.btnsearchload.caption msgid "L&oad" msgstr "불러오기(&O)" #: tfrmfinddlg.btnsearchsave.caption msgid "S&ave" msgstr "저장(&A)" #: tfrmfinddlg.btnsearchsavewithstartingpath.caption msgid "Sa&ve with \"Start in directory\"" msgstr "시작 폴더 저장(&V)" #: tfrmfinddlg.btnsearchsavewithstartingpath.hint msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory" msgstr "만약 \"시작 폴더\"에 템플릿이 로딩되면 복구됨. 특정 폴더 검색을 수정하기 위해 사용." #: tfrmfinddlg.btnusetemplate.caption msgid "Use template" msgstr "템플릿 사용" #: tfrmfinddlg.caption msgctxt "TFRMFINDDLG.CAPTION" msgid "Find files" msgstr "찾은 파일" #: tfrmfinddlg.cbcasesens.caption msgid "Case sens&itive" msgstr "대소 문자 구분(&I)" #: tfrmfinddlg.cbdatefrom.caption msgid "&Date from:" msgstr "날짜부터(&D):" #: tfrmfinddlg.cbdateto.caption msgid "Dat&e to:" msgstr "날짜까지(&E):" #: tfrmfinddlg.cbfilesizefrom.caption msgid "S&ize from:" msgstr "크기부터(&I):" #: tfrmfinddlg.cbfilesizeto.caption msgid "Si&ze to:" msgstr "크기까지(&Z):" #: tfrmfinddlg.cbfindinarchive.caption msgid "Search in &archives" msgstr "압축파일에서 찾기(&A)" #: tfrmfinddlg.cbfindtext.caption msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION" msgid "Find &text in file" msgstr "파일의 텍스트에서 찾기(&T)" #: tfrmfinddlg.cbfollowsymlinks.caption msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION" msgid "Follow s&ymlinks" msgstr "심볼릭 링크 따라가기(&Y)" #: tfrmfinddlg.cbnotcontainingtext.caption msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION" msgid "Find files N&OT containing the text" msgstr "문자열 포함하지 않은 파일 찾기(&O)" #: tfrmfinddlg.cbnotolderthan.caption msgid "N&ot older than:" msgstr "오래되지 않은(&O):" #: tfrmfinddlg.cbopenedtabs.caption msgid "Opened tabs" msgstr "" #: tfrmfinddlg.cbpartialnamesearch.caption msgid "Searc&h for part of file name" msgstr "파일명에서 찾기(&H)" #: tfrmfinddlg.cbregexp.caption msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION" msgid "&Regular expression" msgstr "정규식(&R)" #: tfrmfinddlg.cbreplacetext.caption msgid "Re&place by" msgstr "바꾸기(&P)" #: tfrmfinddlg.cbselectedfiles.caption msgid "Selected directories and &files" msgstr "선택된 파일과 폴더(&F)" #: tfrmfinddlg.cbtextregexp.caption msgid "Regular &expression" msgstr "정규식(&E)" #: tfrmfinddlg.cbtimefrom.caption msgid "&Time from:" msgstr "시간부터(&T):" #: tfrmfinddlg.cbtimeto.caption msgid "Ti&me to:" msgstr "시간까지(&M):" #: tfrmfinddlg.cbuseplugin.caption msgid "&Use search plugin:" msgstr "검색 플러그인 사용(&U):" #: tfrmfinddlg.chkhex.caption msgid "Hexadecimal" msgstr "" #: tfrmfinddlg.cmbexcludedirectories.hint msgid "Enter directories names that should be excluded from search separated with \";\"" msgstr "\";\"로 검색 구분된 폴더명 입력" #: tfrmfinddlg.cmbexcludefiles.hint msgid "Enter files names that should be excluded from search separated with \";\"" msgstr "\";\"로 검색 구분된 파일명 입력" #: tfrmfinddlg.cmbfindfilemask.hint msgid "Enter files names separated with \";\"" msgstr "\";\"로 구분된 파일명 입력" #: tfrmfinddlg.gbdirectories.caption msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION" msgid "Directories" msgstr "새 폴더" #: tfrmfinddlg.gbfiles.caption msgctxt "TFRMFINDDLG.GBFILES.CAPTION" msgid "Files" msgstr "파일" #: tfrmfinddlg.gbfinddata.caption msgctxt "tfrmfinddlg.gbfinddata.caption" msgid "Find Data" msgstr "자료 찾기" #: tfrmfinddlg.lblattributes.caption msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION" msgid "Attri&butes" msgstr "속성(&B)" #: tfrmfinddlg.lblencoding.caption msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION" msgid "Encodin&g:" msgstr "인코딩(&G):" #: tfrmfinddlg.lblexcludedirectories.caption msgid "E&xclude subdirectories" msgstr "하위 폴더 제외(&X)" #: tfrmfinddlg.lblexcludefiles.caption msgid "&Exclude files" msgstr "파일 제외(&E)" #: tfrmfinddlg.lblfindfilemask.caption msgid "&File mask" msgstr "찾을 파일(&F)" #: tfrmfinddlg.lblfindpathstart.caption msgid "Start in &directory" msgstr "검색 폴더(&D)" #: tfrmfinddlg.lblsearchdepth.caption msgid "Search su&bdirectories:" msgstr "하위 디랙토리 검색(&B):" #: tfrmfinddlg.lbltemplateheader.caption msgid "&Previous searches:" msgstr "이전 검색(&P):" #: tfrmfinddlg.miaction.caption msgid "&Action" msgstr "" #: tfrmfinddlg.mifreefrommemallothers.caption msgid "For all others, cancel, close and free from memory" msgstr "" #: tfrmfinddlg.miopeninnewtab.caption msgid "Open In New Tab(s)" msgstr "새 탭에서 열기" #: tfrmfinddlg.mioptions.caption #, fuzzy msgctxt "tfrmfinddlg.mioptions.caption" msgid "Options" msgstr "옵션" #: tfrmfinddlg.miremovefromllist.caption msgid "Remove from list" msgstr "리스트에서 제거" #: tfrmfinddlg.miresult.caption msgid "&Result" msgstr "" #: tfrmfinddlg.mishowallfound.caption msgid "Show all found items" msgstr "찾은 항목 전체 표시" #: tfrmfinddlg.mishowineditor.caption msgid "Show In Editor" msgstr "편집기에서 표시" #: tfrmfinddlg.mishowinviewer.caption msgid "Show In Viewer" msgstr "뷰어에 표시" #: tfrmfinddlg.miviewtab.caption #, fuzzy msgctxt "tfrmfinddlg.miviewtab.caption" msgid "&View" msgstr "보기(&V)" #: tfrmfinddlg.tsadvanced.caption msgid "Advanced" msgstr "확장" #: tfrmfinddlg.tsloadsave.caption msgid "Load/Save" msgstr "불러오기/저장" #: tfrmfinddlg.tsplugins.caption msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION" msgid "Plugins" msgstr "플러그인" #: tfrmfinddlg.tsresults.caption msgid "Results" msgstr "결과" #: tfrmfinddlg.tsstandard.caption msgid "Standard" msgstr "일반" #: tfrmfindview.btnclose.caption msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmfindview.btnfind.caption msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION" msgid "&Find" msgstr "찾기(&F)" #: tfrmfindview.caption msgctxt "TFRMFINDVIEW.CAPTION" msgid "Find" msgstr "찾기" #: tfrmfindview.cbcasesens.caption msgid "C&ase sensitive" msgstr "대소문자 구분(&A)" #: tfrmhardlink.btncancel.caption msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmhardlink.btnok.caption msgctxt "TFRMHARDLINK.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmhardlink.caption msgid "Create hard link" msgstr "복사본 만들기" #: tfrmhardlink.lblexistingfile.caption msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "링크가 가리킬 대상(&D)" #: tfrmhardlink.lbllinktocreate.caption msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "링크명(&L)" #: tfrmhotdirexportimport.btnselectall.caption msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTALL.CAPTION" msgid "Import all!" msgstr "전체 가져오기!" #: tfrmhotdirexportimport.btnselectiondone.caption msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTIONDONE.CAPTION" msgid "Import selected" msgstr "선택 불러오기" #: tfrmhotdirexportimport.caption msgid "Select the entries your want to import" msgstr "불러오기 원하는 항목 선택" #: tfrmhotdirexportimport.lbhint.caption msgid "When clicking a sub-menu, it will select the whole menu" msgstr "하위 메뉴 선택시 전체 메뉴 선택" #: tfrmhotdirexportimport.lblhintholdcontrol.caption msgid "Hold CTRL and click entries to select multiple ones" msgstr "CTRL키 누른 상태에서 여러 개 파일 클릭 선택" #: tfrmlinker.btnsave.caption msgctxt "TFRMLINKER.BTNSAVE.CAPTION" msgid "..." msgstr "..." #: tfrmlinker.caption msgctxt "TFRMLINKER.CAPTION" msgid "Linker" msgstr "링커" #: tfrmlinker.gbsaveto.caption msgid "Save to..." msgstr "..에 저장" #: tfrmlinker.grbxcontrol.caption msgid "Item" msgstr "항목" #: tfrmlinker.lblfilename.caption msgctxt "TFRMLINKER.LBLFILENAME.CAPTION" msgid "&File name" msgstr "파일명(&F)" #: tfrmlinker.spbtndown.caption msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION" msgid "Do&wn" msgstr "아래(&W)" #: tfrmlinker.spbtndown.hint msgctxt "TFRMLINKER.SPBTNDOWN.HINT" msgid "Down" msgstr "아래 방향키" #: tfrmlinker.spbtnrem.caption msgctxt "TFRMLINKER.SPBTNREM.CAPTION" msgid "&Remove" msgstr "제거(&R)" #: tfrmlinker.spbtnrem.hint msgctxt "TFRMLINKER.SPBTNREM.HINT" msgid "Delete" msgstr "삭제" #: tfrmlinker.spbtnup.caption msgctxt "TFRMLINKER.SPBTNUP.CAPTION" msgid "&Up" msgstr "위 방향키(&U)" #: tfrmlinker.spbtnup.hint msgctxt "TFRMLINKER.SPBTNUP.HINT" msgid "Up" msgstr "위 방향키" #: tfrmmain.actabout.caption msgctxt "TFRMMAIN.ACTABOUT.CAPTION" msgid "&About" msgstr "정보(&A)" #: tfrmmain.actaddfilenametocmdline.caption msgid "Add file name to command line" msgstr "명령줄에 파일명 추가" #: tfrmmain.actaddnewsearch.caption msgid "New search instance..." msgstr "" #: tfrmmain.actaddpathandfilenametocmdline.caption msgid "Add path and file name to command line" msgstr "명령줄에 경로와 파일명 추가" #: tfrmmain.actaddpathtocmdline.caption msgid "Copy path to command line" msgstr "명령줄에 경로 복사" #: tfrmmain.actbenchmark.caption msgid "&Benchmark" msgstr "" #: tfrmmain.actbriefview.caption msgctxt "tfrmmain.actbriefview.caption" msgid "Brief view" msgstr "간략히 보기" #: tfrmmain.actbriefview.hint msgid "Brief View" msgstr "간략히 보기" #: tfrmmain.actcalculatespace.caption msgid "Calculate &Occupied Space" msgstr "차지한 공간 계산(&O)" #: tfrmmain.actchangedir.caption msgid "Change directory" msgstr "폴더 변경" #: tfrmmain.actchangedirtohome.caption msgid "Change directory to home" msgstr "home으로 폴더 변경" #: tfrmmain.actchangedirtoparent.caption msgid "Change Directory To Parent" msgstr "상위 폴더로 변경" #: tfrmmain.actchangedirtoroot.caption msgid "Change directory to root" msgstr "최상위 폴더로 변경" #: tfrmmain.actchecksumcalc.caption msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION" msgid "Calculate Check&sum..." msgstr "체크섬 계산(&S)..." #: tfrmmain.actchecksumverify.caption msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION" msgid "&Verify Checksum..." msgstr "체크섬 검증(&V)..." #: tfrmmain.actclearlogfile.caption msgid "Clear log file" msgstr "로그파일 삭제" #: tfrmmain.actclearlogwindow.caption msgid "Clear log window" msgstr "로그창 지우기 " #: tfrmmain.actclosealltabs.caption msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION" msgid "Close &All Tabs" msgstr "모든 탭 닫기(&A)" #: tfrmmain.actcloseduplicatetabs.caption msgid "Close Duplicate Tabs" msgstr "복제한 탭 닫기" #: tfrmmain.actclosetab.caption msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION" msgid "&Close Tab" msgstr "탭 닫기(&C)" #: tfrmmain.actcmdlinenext.caption msgid "Next Command Line" msgstr "다음 명령줄" #: tfrmmain.actcmdlinenext.hint msgid "Set command line to next command in history" msgstr "히스토리에 다음 명령줄로 저장" #: tfrmmain.actcmdlineprev.caption msgid "Previous Command Line" msgstr "이전 명령줄" #: tfrmmain.actcmdlineprev.hint msgid "Set command line to previous command in history" msgstr "히스토리에 이전 명령줄로 저장" #: tfrmmain.actcolumnsview.caption msgid "Full" msgstr "전체 보기" #: tfrmmain.actcolumnsview.hint msgid "Columns View" msgstr "파일속성열 보기" #: tfrmmain.actcomparecontents.caption msgid "Compare by &Contents" msgstr "내용 비교(&C)" #: tfrmmain.actcomparedirectories.caption msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION" msgid "Compare Directories" msgstr "폴더 비교" #: tfrmmain.actcomparedirectories.hint msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT" msgid "Compare Directories" msgstr "폴더 비교" #: tfrmmain.actconfigarchivers.caption msgid "Configuration of Archivers" msgstr "" #: tfrmmain.actconfigdirhotlist.caption msgctxt "TFRMMAIN.ACTCONFIGDIRHOTLIST.CAPTION" msgid "Configuration of Directory Hotlist" msgstr "폴더 바로 가기 설정" #: tfrmmain.actconfigfavoritetabs.caption msgid "Configuration of Favorite Tabs" msgstr "즐겨찾기탭 설정" #: tfrmmain.actconfigfoldertabs.caption msgid "Configuration of folder tabs" msgstr "폴더탭 설정" #: tfrmmain.actconfighotkeys.caption msgctxt "tfrmmain.actconfighotkeys.caption" msgid "Configuration of hot keys" msgstr "" #: tfrmmain.actconfigsavesettings.caption msgid "Save Settings" msgstr "" #: tfrmmain.actconfigsearches.caption msgid "Configuration of searches" msgstr "" #: tfrmmain.actconfigtoolbars.caption msgid "Toolbar..." msgstr "도구 모음..." #: tfrmmain.actconfigtreeviewmenus.caption msgctxt "tfrmmain.actconfigtreeviewmenus.caption" msgid "Configuration of Tree View Menu" msgstr "" #: tfrmmain.actconfigtreeviewmenuscolors.caption msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption" msgid "Configuration of Tree View Menu Colors" msgstr "" #: tfrmmain.actcontextmenu.caption msgid "Show context menu" msgstr "메뉴 표시" #: tfrmmain.actcopy.caption msgctxt "tfrmmain.actcopy.caption" msgid "Copy" msgstr "복사" #: tfrmmain.actcopyalltabstoopposite.caption msgid "Copy all tabs to opposite side" msgstr "모든 탭을 다른창에 복사" #: tfrmmain.actcopyfiledetailstoclip.caption msgid "Copy all shown &columns" msgstr "보이는 파일속성열 세부정보 전체 복사(&C)" #: tfrmmain.actcopyfullnamestoclip.caption msgid "Copy Filename(s) with Full &Path" msgstr "전체 경로 포함 복사(&P)" #: tfrmmain.actcopynamestoclip.caption msgid "Copy &Filename(s) to Clipboard" msgstr "파일명 클립보드로 복사(&F)" #: tfrmmain.actcopynoask.caption msgid "Copy files without asking for confirmation" msgstr "확인없이 파일 복사하기" #: tfrmmain.actcopypathnosepoffilestoclip.caption msgid "Copy Full Path of selected file(s) with no ending dir separator" msgstr "마지막 폴더 구분자 없이 산택파일 전체경로 복사" #: tfrmmain.actcopypathoffilestoclip.caption msgid "Copy Full Path of selected file(s)" msgstr "선택한 파일 전체 경로 복사" #: tfrmmain.actcopysamepanel.caption msgid "Copy to same panel" msgstr "같은창에 복사" #: tfrmmain.actcopytoclipboard.caption msgid "&Copy" msgstr "복사(&C)" #: tfrmmain.actcountdircontent.caption msgid "Sho&w Occupied Space" msgstr "차지한 용량 보기(&W)" #: tfrmmain.actcuttoclipboard.caption msgid "Cu&t" msgstr "자르기(&T)" #: tfrmmain.actdebugshowcommandparameters.caption msgid "Show Command Parameters" msgstr "명령어 매개변수 표시" #: tfrmmain.actdelete.caption msgctxt "TFRMMAIN.ACTDELETE.CAPTION" msgid "Delete" msgstr "삭제" #: tfrmmain.actdeletesearches.caption msgid "For all searches, cancel, close and free memory" msgstr "" #: tfrmmain.actdirhistory.caption msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION" msgid "Directory history" msgstr "폴더 히스토리" #: tfrmmain.actdirhotlist.caption msgid "Directory &Hotlist" msgstr "폴더 바로 가기 목록(&H)" #: tfrmmain.actdoanycmcommand.caption msgid "Select any command and execute it" msgstr "선택한 어떤 명령이든 실행" #: tfrmmain.actedit.caption msgctxt "tfrmmain.actedit.caption" msgid "Edit" msgstr "편집" #: tfrmmain.acteditcomment.caption msgid "Edit Co&mment..." msgstr "주석 편집(&M)..." #: tfrmmain.acteditnew.caption msgid "Edit new file" msgstr "새 파일 편집" #: tfrmmain.acteditpath.caption msgid "Edit path field above file list" msgstr "상위 파일 경로 편집" #: tfrmmain.actexchange.caption msgid "Swap &Panels" msgstr "창 바꾸기(&P)" #: tfrmmain.actexecutescript.caption msgid "Execute Script" msgstr "" #: tfrmmain.actexit.caption msgctxt "TFRMMAIN.ACTEXIT.CAPTION" msgid "E&xit" msgstr "종료(&E)" #: tfrmmain.actextractfiles.caption msgid "&Extract Files..." msgstr "파일 압축해제(&E)..." #: tfrmmain.actfileassoc.caption msgid "Configuration of File &Associations" msgstr "연결 프로그램 설정(&A)" #: tfrmmain.actfilelinker.caption msgid "Com&bine Files..." msgstr "파일 합치기(&B)..." #: tfrmmain.actfileproperties.caption msgid "Show &File Properties" msgstr "파일 속성 표시(&F)" #: tfrmmain.actfilespliter.caption msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION" msgid "Spl&it File..." msgstr "파일 쪼개기(&I)..." #: tfrmmain.actflatview.caption msgid "&Flat view" msgstr "일괄보기(하위폴더 포함)(&F)" #: tfrmmain.actfocuscmdline.caption msgid "Focus command line" msgstr "명령 라인 포커스" #: tfrmmain.actfocusswap.caption msgid "Swap focus" msgstr "" #: tfrmmain.actfocusswap.hint msgid "Switch between left and right file list" msgstr "" #: tfrmmain.actgotofirstfile.caption msgid "Place cursor on first file in list" msgstr "목록 첫 파일에 커서 두기" #: tfrmmain.actgotolastfile.caption msgid "Place cursor on last file in list" msgstr "목록의 마지막 파일에 커서 두기" #: tfrmmain.acthardlink.caption msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION" msgid "Create &Hard Link..." msgstr "복사본 만들기(&H)..." #: tfrmmain.acthelpindex.caption msgid "&Contents" msgstr "내용(&C)" #: tfrmmain.acthorizontalfilepanels.caption msgid "&Horizontal Panels Mode" msgstr "수평창 모드(&H)" #: tfrmmain.actkeyboard.caption msgid "&Keyboard" msgstr "단축키(&K)" #: tfrmmain.actleftbriefview.caption msgid "Brief view on left panel" msgstr "왼쪽차에 간략히 보기" #: tfrmmain.actleftcolumnsview.caption msgid "Columns view on left panel" msgstr "왼쪽창 파일속성열 보기" #: tfrmmain.actleftequalright.caption msgid "Left &= Right" msgstr "왼쪽창 &= 오른쪽창" #: tfrmmain.actleftflatview.caption msgid "&Flat view on left panel" msgstr "왼쪽창에 모든 파일보기(하위폴더 포함)(&F)" #: tfrmmain.actleftopendrives.caption msgid "Open left drive list" msgstr "왼쪽에 드라이브 목록 열기" #: tfrmmain.actleftreverseorder.caption msgid "Re&verse order on left panel" msgstr "왼쪽창에 역순으로 정렬(&V)" #: tfrmmain.actleftsortbyattr.caption msgid "Sort left panel by &Attributes" msgstr "왼쪽창에 파일 속성별로 정렬(&A)" #: tfrmmain.actleftsortbydate.caption msgid "Sort left panel by &Date" msgstr "왼쪽창에 날짜별로 정렬(&D)" #: tfrmmain.actleftsortbyext.caption msgid "Sort left panel by &Extension" msgstr "왼쪽창에 파일 확장자로 정렬(&E)" #: tfrmmain.actleftsortbyname.caption msgid "Sort left panel by &Name" msgstr "왼쪽창 이름순 정렬(&N)" #: tfrmmain.actleftsortbysize.caption msgid "Sort left panel by &Size" msgstr "왼쪽창 파일크기별 정렬(&S)" #: tfrmmain.actleftthumbview.caption msgid "Thumbnails view on left panel" msgstr "왼쪽창에 미리보기" #: tfrmmain.actloadfavoritetabs.caption msgid "Load tabs from Favorite Tabs" msgstr "즐겨찾기 탭에서 불러오기" #: tfrmmain.actloadselectionfromclip.caption msgid "Load Selection from Clip&board" msgstr "클립보드에서 선택 불러오기(&B)" #: tfrmmain.actloadselectionfromfile.caption msgid "&Load Selection from File..." msgstr "파일로 부터 선택 불러오기(&L)..." #: tfrmmain.actloadtabs.caption msgid "&Load Tabs from File" msgstr "파일로부터 탭 불러오기(&L)" #: tfrmmain.actmakedir.caption msgid "Create &Directory" msgstr "새 폴더 생성(&D)" #: tfrmmain.actmarkcurrentextension.caption msgid "Select All with the Same E&xtension" msgstr "같은 확장자 전체 선택(&X)" #: tfrmmain.actmarkcurrentname.caption msgid "Select all files with same name" msgstr "" #: tfrmmain.actmarkcurrentnameext.caption msgid "Select all files with same name and extension" msgstr "" #: tfrmmain.actmarkcurrentpath.caption msgid "Select all in same path" msgstr "" #: tfrmmain.actmarkinvert.caption msgid "&Invert Selection" msgstr "선택 반전(&I)" #: tfrmmain.actmarkmarkall.caption msgid "&Select All" msgstr "전체 선택(&S)" #: tfrmmain.actmarkminus.caption msgid "Unselect a Gro&up..." msgstr "그룹 선택해제(&U)..." #: tfrmmain.actmarkplus.caption msgid "Select a &Group..." msgstr "그룹 선택(&G)..." #: tfrmmain.actmarkunmarkall.caption msgid "&Unselect All" msgstr "선택 해제(&U)" #: tfrmmain.actminimize.caption msgid "Minimize window" msgstr "창 최소화" #: tfrmmain.actmultirename.caption msgid "Multi &Rename Tool" msgstr "파일명 변경 도구(&R)" #: tfrmmain.actnetworkconnect.caption msgid "Network &Connect..." msgstr "네트워크 연결(&C)..." #: tfrmmain.actnetworkdisconnect.caption msgid "Network &Disconnect" msgstr "네트워크 연결해제(&D)" #: tfrmmain.actnetworkquickconnect.caption msgid "Network &Quick Connect..." msgstr "네트워크 빠른 연결(&Q)..." #: tfrmmain.actnewtab.caption msgid "&New Tab" msgstr "새 탭(&N)" #: tfrmmain.actnextfavoritetabs.caption msgid "Load the Next Favorite Tabs in the list" msgstr "목록에 있는 다음 즐겨찾기 불러오기" #: tfrmmain.actnexttab.caption msgid "Switch to Nex&t Tab" msgstr "다음 탭(&T)" #: tfrmmain.actopen.caption msgctxt "TFRMMAIN.ACTOPEN.CAPTION" msgid "Open" msgstr "열기" #: tfrmmain.actopenarchive.caption msgid "Try open archive" msgstr "파일 열기 시도" #: tfrmmain.actopenbar.caption msgid "Open bar file" msgstr "상태바 파일 열기" #: tfrmmain.actopendirinnewtab.caption msgid "Open &Folder in a New Tab" msgstr "새 탭에 폴더 열기(&F)" #: tfrmmain.actopenvirtualfilesystemlist.caption msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION" msgid "Open &VFS List" msgstr "가상파일시스템(&VFS) 목록 열기" #: tfrmmain.actoperationsviewer.caption msgid "Operations &Viewer" msgstr "작업 뷰어열기(&V)" #: tfrmmain.actoptions.caption msgid "&Options..." msgstr "설정(&O)..." #: tfrmmain.actpackfiles.caption msgid "&Pack Files..." msgstr "파일 압축(&P)..." #: tfrmmain.actpanelssplitterperpos.caption msgid "Set splitter position" msgstr "쪼개는 위치 설정" #: tfrmmain.actpastefromclipboard.caption msgid "&Paste" msgstr "붙여넣기(&P)" #: tfrmmain.actpreviousfavoritetabs.caption msgid "Load the Previous Favorite Tabs in the list" msgstr "목록에 이전 즐겨찾기탭 불러오기" #: tfrmmain.actprevtab.caption msgid "Switch to &Previous Tab" msgstr "이전 탭과 바꾸기(&P)" #: tfrmmain.actquickfilter.caption msgid "Quick filter" msgstr "퀵 필터" #: tfrmmain.actquicksearch.caption msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION" msgid "Quick search" msgstr "빠른 검색" #: tfrmmain.actquickview.caption msgid "&Quick View Panel" msgstr "빠른 보기창(&Q)" #: tfrmmain.actrefresh.caption msgid "&Refresh" msgstr "새로고침(&R)" #: tfrmmain.actreloadfavoritetabs.caption msgid "Reload the last Favorite Tabs loaded" msgstr "마지막 불러들인 즐겨찾기탭 다시 불러오기" #: tfrmmain.actrename.caption msgctxt "tfrmmain.actrename.caption" msgid "Move" msgstr "이동" #: tfrmmain.actrenamenoask.caption msgid "Move/Rename files without asking for confirmation" msgstr "확인하지 않고 파일 이동/파일명 바꾸기" #: tfrmmain.actrenameonly.caption msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION" msgid "Rename" msgstr "파일명 바꾸기" #: tfrmmain.actrenametab.caption msgid "&Rename Tab" msgstr "탭 이름 바꾸기(&R)" #: tfrmmain.actresavefavoritetabs.caption msgid "Resave on the last Favorite Tabs loaded" msgstr "마지막 즐겨찾기탭 다시 저장" #: tfrmmain.actrestoreselection.caption msgid "&Restore Selection" msgstr "선택 복구(&R)" #: tfrmmain.actreverseorder.caption msgid "Re&verse Order" msgstr "역순 정렬(&V)" #: tfrmmain.actrightbriefview.caption msgid "Brief view on right panel" msgstr "오른쪽창에 간략히 보기" #: tfrmmain.actrightcolumnsview.caption msgid "Columns view on right panel" msgstr "오른쪽 창에 파일속성열 보기" #: tfrmmain.actrightequalleft.caption msgid "Right &= Left" msgstr "오른쪽창 &= 왼쪽창" #: tfrmmain.actrightflatview.caption msgid "&Flat view on right panel" msgstr "오른쪽 창에 보기(&F)" #: tfrmmain.actrightopendrives.caption msgid "Open right drive list" msgstr "드라이브 목록 열기" #: tfrmmain.actrightreverseorder.caption msgid "Re&verse order on right panel" msgstr "오른쪽 창에 역순 정렬(&V)" #: tfrmmain.actrightsortbyattr.caption msgid "Sort right panel by &Attributes" msgstr "속성으로 오른쪽창 정렬(&A)" #: tfrmmain.actrightsortbydate.caption msgid "Sort right panel by &Date" msgstr "날짜로 오른쪽창 정렬(&D)" #: tfrmmain.actrightsortbyext.caption msgid "Sort right panel by &Extension" msgstr "확장자로 오른쪽창 정렬(&E)" #: tfrmmain.actrightsortbyname.caption msgid "Sort right panel by &Name" msgstr "이름순 오른쪽창 정렬(&N)" #: tfrmmain.actrightsortbysize.caption msgid "Sort right panel by &Size" msgstr "크기순 오른쪽 창 정렬(&S)" #: tfrmmain.actrightthumbview.caption msgid "Thumbnails view on right panel" msgstr "오른쪽 창 썸네일 보기" #: tfrmmain.actrunterm.caption msgid "Run &Terminal" msgstr "명령 프롬프트 실행(&T)" #: tfrmmain.actsavefavoritetabs.caption msgid "Save current tabs to a New Favorite Tabs" msgstr "현재탭을 새 즐겨찾기탭으로 저장" #: tfrmmain.actsaveselection.caption msgid "Sa&ve Selection" msgstr "선택 저장(&V)" #: tfrmmain.actsaveselectiontofile.caption msgid "Save S&election to File..." msgstr "선택을 파일로 저장(&E)..." #: tfrmmain.actsavetabs.caption msgid "&Save Tabs to File" msgstr "탭을 파일로 저장(&S)" #: tfrmmain.actsearch.caption msgid "&Search..." msgstr "파일 찾기(&S)" #: tfrmmain.actsetalltabsoptiondirsinnewtab.caption msgid "All tabs Locked with Dir Opened in New Tabs" msgstr "열린 새탭을 전체 잠그기" #: tfrmmain.actsetalltabsoptionnormal.caption msgid "Set all tabs to Normal" msgstr "전체 탭 잠금 풀기" #: tfrmmain.actsetalltabsoptionpathlocked.caption msgid "Set all tabs to Locked" msgstr "전체 탭을 잠금으로 설정" #: tfrmmain.actsetalltabsoptionpathresets.caption msgid "All tabs Locked with Dir Changes Allowed" msgstr "폴더 변경이 허용된 모든 탭 잠금" #: tfrmmain.actsetfileproperties.caption msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION" msgid "Change &Attributes..." msgstr "속성 변경(&A)..." #: tfrmmain.actsettaboptiondirsinnewtab.caption msgid "Locked with Directories Opened in New &Tabs" msgstr "새탭으로 열려 잠긴 폴더(&T)" #: tfrmmain.actsettaboptionnormal.caption msgid "&Normal" msgstr "일반탭(&N)" #: tfrmmain.actsettaboptionpathlocked.caption msgid "&Locked" msgstr "잠금탭(&L)" #: tfrmmain.actsettaboptionpathresets.caption msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION" msgid "Locked with &Directory Changes Allowed" msgstr "폴더 변경이 허용되고 잠금(&D)" #: tfrmmain.actshellexecute.caption msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION" msgid "Open" msgstr "열기" #: tfrmmain.actshellexecute.hint msgid "Open using system associations" msgstr "시스템 연결설정으로 열기" #: tfrmmain.actshowbuttonmenu.caption msgid "Show button menu" msgstr "버튼 메뉴 표시" #: tfrmmain.actshowcmdlinehistory.caption msgid "Show command line history" msgstr "명령줄 히스토리 표시" #: tfrmmain.actshowmainmenu.caption msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION" msgid "Menu" msgstr "메뉴" #: tfrmmain.actshowsysfiles.caption msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION" msgid "Show &Hidden/System Files" msgstr "숨김/시스템 파일 보이기(&H)" #: tfrmmain.actsortbyattr.caption msgid "Sort by &Attributes" msgstr "속성으로 정렬(&A)" #: tfrmmain.actsortbydate.caption msgid "Sort by &Date" msgstr "날짜로 정렬(&D)" #: tfrmmain.actsortbyext.caption msgid "Sort by &Extension" msgstr "확장자로 정렬(&E)" #: tfrmmain.actsortbyname.caption msgid "Sort by &Name" msgstr "이름순 정렬(&N)" #: tfrmmain.actsortbysize.caption msgid "Sort by &Size" msgstr "크기순 정렬(&S)" #: tfrmmain.actsrcopendrives.caption msgid "Open drive list" msgstr "드라이브 목록 열기" #: tfrmmain.actswitchignorelist.caption msgid "Enable/disable ignore list file to not show file names" msgstr "파일명 목록 보이지 않기 무시 가능/불가능" #: tfrmmain.actsymlink.caption msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION" msgid "Create Symbolic &Link..." msgstr "바로 가기 생성(&L)..." #: tfrmmain.actsyncdirs.caption msgid "Synchronize dirs..." msgstr "폴더 동기화..." #: tfrmmain.acttargetequalsource.caption msgid "Target &= Source" msgstr "비활성창 &= 활성창" #: tfrmmain.acttestarchive.caption msgid "&Test Archive(s)" msgstr "압축파일 검사(&T)" #: tfrmmain.actthumbnailsview.caption msgctxt "tfrmmain.actthumbnailsview.caption" msgid "Thumbnails" msgstr "썸네일" #: tfrmmain.actthumbnailsview.hint msgid "Thumbnails View" msgstr "썸네일 보기" #: tfrmmain.acttogglefullscreenconsole.caption msgid "Toggle fullscreen mode console" msgstr "전체화면 콘솔 ON/OFF" #: tfrmmain.acttransferleft.caption msgid "Transfer dir under cursor to left window" msgstr "커서 아래 폴더 왼쪽창 전송" #: tfrmmain.acttransferright.caption msgid "Transfer dir under cursor to right window" msgstr "커서 아래 폴더 오른쪽창 전송" #: tfrmmain.acttreeview.caption msgid "&Tree View Panel" msgstr "트리뷰창(&T)" #: tfrmmain.actuniversalsingledirectsort.caption msgid "Sort according to parameters" msgstr "매개변수에 따라 정렬" #: tfrmmain.actunmarkcurrentextension.caption msgid "Unselect All with the Same Ex&tension" msgstr "같은 확장자 전체 선택해제(&T)" #: tfrmmain.actunmarkcurrentname.caption msgid "Unselect all files with same name" msgstr "" #: tfrmmain.actunmarkcurrentnameext.caption msgid "Unselect all files with same name and extension" msgstr "" #: tfrmmain.actunmarkcurrentpath.caption msgid "Unselect all in same path" msgstr "" #: tfrmmain.actview.caption msgctxt "tfrmmain.actview.caption" msgid "View" msgstr "보기" #: tfrmmain.actviewhistory.caption msgid "Show history of visited paths for active view" msgstr "활성보기에 방문 경로 히스토리 표시" #: tfrmmain.actviewhistorynext.caption msgid "Go to next entry in history" msgstr "히스토리 다음 항목 가기" #: tfrmmain.actviewhistoryprev.caption msgid "Go to previous entry in history" msgstr "히스토리 이전 항목 가기" #: tfrmmain.actviewlogfile.caption msgid "View log file" msgstr "로그파일 보기" #: tfrmmain.actviewsearches.caption msgid "View current search instances" msgstr "" #: tfrmmain.actvisithomepage.caption msgid "&Visit Double Commander Website" msgstr "더블 커맨더 웹사이트 방문(&V)" #: tfrmmain.actwipe.caption msgid "Wipe" msgstr "영구 삭제(휴지통X)" #: tfrmmain.actworkwithdirectoryhotlist.caption #, fuzzy #| msgid "Work with Directory Hotlist and paramters" msgid "Work with Directory Hotlist and parameters" msgstr "폴더 바로 가기 및 매개변수 작업" #: tfrmmain.btnf10.caption msgctxt "tfrmmain.btnf10.caption" msgid "Exit" msgstr "종료" #: tfrmmain.btnf7.caption msgctxt "TFRMMAIN.BTNF7.CAPTION" msgid "Directory" msgstr "새 폴더" #: tfrmmain.btnf8.caption msgctxt "TFRMMAIN.BTNF8.CAPTION" msgid "Delete" msgstr "삭제" #: tfrmmain.btnf9.caption msgctxt "tfrmmain.btnf9.caption" msgid "Terminal" msgstr "명령 프롬프트" #: tfrmmain.btnleftdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "*" #: tfrmmain.btnleftdirectoryhotlist.hint msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT" msgid "Directory Hotlist" msgstr "폴더 바로 가기" #: tfrmmain.btnleftequalright.caption msgctxt "tfrmmain.btnleftequalright.caption" msgid "<" msgstr "<" #: tfrmmain.btnleftequalright.hint msgid "Show current directory of the right panel in the left panel" msgstr "왼쪽창에 있는 오른쪽창의 현재 폴더 표시" #: tfrmmain.btnlefthome.caption msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION" msgid "~" msgstr "~" #: tfrmmain.btnlefthome.hint msgctxt "TFRMMAIN.BTNLEFTHOME.HINT" msgid "Go to home directory" msgstr "홈 디렉로티 가기" #: tfrmmain.btnleftroot.caption msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION" msgid "/" msgstr "/" #: tfrmmain.btnleftroot.hint msgctxt "TFRMMAIN.BTNLEFTROOT.HINT" msgid "Go to root directory" msgstr "최상위 폴더 가기" #: tfrmmain.btnleftup.caption msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION" msgid ".." msgstr ".." #: tfrmmain.btnleftup.hint msgctxt "TFRMMAIN.BTNLEFTUP.HINT" msgid "Go to parent directory" msgstr "상위 폴더 가기" #: tfrmmain.btnrightdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "*" #: tfrmmain.btnrightdirectoryhotlist.hint msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT" msgid "Directory Hotlist" msgstr "폴더 바로 가기" #: tfrmmain.btnrightequalleft.caption msgctxt "tfrmmain.btnrightequalleft.caption" msgid ">" msgstr ">" #: tfrmmain.btnrightequalleft.hint msgid "Show current directory of the left panel in the right panel" msgstr "오른쪽창에 있는 왼쪽창의 현재 폴더 보기" #: tfrmmain.btnrighthome.caption msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION" msgid "~" msgstr "~" #: tfrmmain.btnrightroot.caption msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION" msgid "/" msgstr "/" #: tfrmmain.btnrightup.caption msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION" msgid ".." msgstr ".." #: tfrmmain.caption msgctxt "TFRMMAIN.CAPTION" msgid "Double Commander" msgstr "더블커맨더" #: tfrmmain.lblcommandpath.caption msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION" msgid "Path" msgstr "경로" #: tfrmmain.mi2080.caption msgid "&20/80" msgstr "&20/80" #: tfrmmain.mi3070.caption msgid "&30/70" msgstr "&30/70" #: tfrmmain.mi4060.caption msgid "&40/60" msgstr "&40/60" #: tfrmmain.mi5050.caption msgid "&50/50" msgstr "&50/50" #: tfrmmain.mi6040.caption msgid "&60/40" msgstr "&60/40" #: tfrmmain.mi7030.caption msgid "&70/30" msgstr "&70/30" #: tfrmmain.mi8020.caption msgid "&80/20" msgstr "&80/20" #: tfrmmain.micancel.caption msgctxt "TFRMMAIN.MICANCEL.CAPTION" msgid "Cancel" msgstr "취소" #: tfrmmain.micopy.caption msgid "Copy..." msgstr "복사..." #: tfrmmain.mihardlink.caption msgctxt "TFRMMAIN.MIHARDLINK.CAPTION" msgid "Create link..." msgstr "링크 생성..." #: tfrmmain.milogclear.caption msgid "Clear" msgstr "지우기" #: tfrmmain.milogcopy.caption msgctxt "TFRMMAIN.MILOGCOPY.CAPTION" msgid "Copy" msgstr "복사" #: tfrmmain.miloghide.caption msgid "Hide" msgstr "감추기" #: tfrmmain.milogselectall.caption msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION" msgid "Select All" msgstr "전체 선택" #: tfrmmain.mimove.caption msgid "Move..." msgstr "이동..." #: tfrmmain.misymlink.caption msgctxt "TFRMMAIN.MISYMLINK.CAPTION" msgid "Create symlink..." msgstr "심링크 생성..." #: tfrmmain.mitaboptions.caption msgid "Tab options" msgstr "탭 설정" #: tfrmmain.mitrayiconexit.caption msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION" msgid "E&xit" msgstr "종료(&X)" #: tfrmmain.mitrayiconrestore.caption msgid "Restore" msgstr "복구" #: tfrmmain.mnualloperpause.caption msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION" msgid "||" msgstr "||" #: tfrmmain.mnualloperstart.caption msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION" msgid "Start" msgstr "실행" #: tfrmmain.mnualloperstop.caption msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION" msgid "Cancel" msgstr "취소" #: tfrmmain.mnucmd.caption msgid "&Commands" msgstr "명령(&C)" #: tfrmmain.mnuconfig.caption msgid "C&onfiguration" msgstr "환경설정(&O)" #: tfrmmain.mnufavoritetabs.caption msgid "Favorites" msgstr "즐겨찾기" #: tfrmmain.mnufiles.caption msgid "&Files" msgstr "파일(&F)" #: tfrmmain.mnuhelp.caption msgctxt "TFRMMAIN.MNUHELP.CAPTION" msgid "&Help" msgstr "도움말(&H)" #: tfrmmain.mnumark.caption msgid "&Mark" msgstr "선택(&M)" #: tfrmmain.mnunetwork.caption msgctxt "TFRMMAIN.MNUNETWORK.CAPTION" msgid "Network" msgstr "네트워크" #: tfrmmain.mnushow.caption msgid "&Show" msgstr "보기(&S)" #: tfrmmain.mnutaboptions.caption msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION" msgid "Tab &Options" msgstr "탭 설정(&O)" #: tfrmmain.mnutabs.caption msgid "&Tabs" msgstr "탭(&T)" #: tfrmmain.tbchangedir.caption msgid "CD" msgstr "CD" #: tfrmmain.tbcopy.caption msgctxt "TFRMMAIN.TBCOPY.CAPTION" msgid "Copy" msgstr "복사" #: tfrmmain.tbcut.caption msgctxt "TFRMMAIN.TBCUT.CAPTION" msgid "Cut" msgstr "자르기" #: tfrmmain.tbdelete.caption msgctxt "TFRMMAIN.TBDELETE.CAPTION" msgid "Delete" msgstr "삭제" #: tfrmmain.tbedit.caption msgctxt "TFRMMAIN.TBEDIT.CAPTION" msgid "Edit" msgstr "편집" #: tfrmmain.tbpaste.caption msgctxt "TFRMMAIN.TBPASTE.CAPTION" msgid "Paste" msgstr "붙여넣기" #: tfrmmaincommandsdlg.btncancel.caption msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmmaincommandsdlg.btnok.caption msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmmaincommandsdlg.caption msgid "Select your internal command" msgstr "내부명령어 선택" #: tfrmmaincommandsdlg.cbcategorysortornot.text msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text" msgid "Legacy sorted" msgstr "상속 정렬" #: tfrmmaincommandsdlg.cbcommandssortornot.text msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT" msgid "Legacy sorted" msgstr "상속 정렬" #: tfrmmaincommandsdlg.cbselectallcategorydefault.caption msgid "Select all categories by default" msgstr "기본값으로 전체 범주 선택하기" #: tfrmmaincommandsdlg.gbselection.caption msgid "Selection:" msgstr "선택:" #: tfrmmaincommandsdlg.lblcategory.caption msgid "&Categories:" msgstr "범주(&C):" #: tfrmmaincommandsdlg.lblcommandname.caption msgid "Command &name:" msgstr "명령 이름(&N):" #: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption msgid "&Filter:" msgstr "필터(&F):" #: tfrmmaincommandsdlg.lblhint.caption msgid "Hint:" msgstr "힌트:" #: tfrmmaincommandsdlg.lblhotkey.caption msgid "Hotkey:" msgstr "바로 가기:" #: tfrmmaincommandsdlg.lblselectedcommand.caption msgid "cm_name" msgstr "cm_name" #: tfrmmaincommandsdlg.lblselectedcommandcategory.caption msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDCATEGORY.CAPTION" msgid "Category" msgstr "카테고리" #: tfrmmaincommandsdlg.lblselectedcommandhelp.caption msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDHELP.CAPTION" msgid "Help" msgstr "도움말" #: tfrmmaincommandsdlg.lblselectedcommandhint.caption msgid "Hint" msgstr "힌트" #: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDHOTKEY.CAPTION" msgid "Hotkey" msgstr "단축키" #: tfrmmaskinputdlg.btnaddattribute.caption #, fuzzy msgctxt "tfrmmaskinputdlg.btnaddattribute.caption" msgid "&Add" msgstr "추가(&A)" #: tfrmmaskinputdlg.btnattrshelp.caption #, fuzzy msgctxt "tfrmmaskinputdlg.btnattrshelp.caption" msgid "&Help" msgstr "도움말(&H)" #: tfrmmaskinputdlg.btncancel.caption msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmmaskinputdlg.btndefinetemplate.caption msgid "&Define..." msgstr "정의(&D)..." #: tfrmmaskinputdlg.btnok.caption msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmmaskinputdlg.chkcasesensitive.caption msgid "Case sensitive" msgstr "" #: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption msgid "Ignore accents and ligatures" msgstr "" #: tfrmmaskinputdlg.lblattributes.caption msgid "Attri&butes:" msgstr "" #: tfrmmaskinputdlg.lblprompt.caption msgid "Input Mask:" msgstr "" #: tfrmmaskinputdlg.lblsearchtemplate.caption msgid "O&r select predefined selection type:" msgstr "또는 미리 정의된 선택형태 선택(&R):" #: tfrmmkdir.btncancel.caption msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmmkdir.btnok.caption msgctxt "TFRMMKDIR.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmmkdir.caption msgid "Create new directory" msgstr "새 폴더 생성" #: tfrmmkdir.lblmakedir.caption msgid "&Input new directory name:" msgstr "새 폴더명 입력(&I):" #: tfrmmodview.btnpath1.caption msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath2.caption msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath3.caption msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath4.caption msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath5.caption msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.caption msgctxt "TFRMMODVIEW.CAPTION" msgid "New Size" msgstr "새 크기" #: tfrmmodview.lblheight.caption msgid "Height :" msgstr "높이 :" #: tfrmmodview.lblpath1.caption msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION" msgid "1" msgstr "1" #: tfrmmodview.lblpath2.caption msgctxt "tfrmmodview.lblpath2.caption" msgid "2" msgstr "2" #: tfrmmodview.lblpath3.caption msgctxt "tfrmmodview.lblpath3.caption" msgid "3" msgstr "3" #: tfrmmodview.lblpath4.caption msgid "4" msgstr "4" #: tfrmmodview.lblpath5.caption msgid "5" msgstr "5" #: tfrmmodview.lblquality.caption msgid "Quality of compress to Jpg" msgstr "JPG 화질로 압축" #: tfrmmodview.lblwidth.caption msgid "Width :" msgstr "폭 :" #: tfrmmodview.rbbmp.caption msgid "BMP" msgstr "BMP" #: tfrmmodview.rbico.caption msgid "ICO" msgstr "ICO" #: tfrmmodview.rbjpg.caption msgid "JPG" msgstr "JPG" #: tfrmmodview.rbpng.caption msgid "PNG" msgstr "PNG" #: tfrmmodview.rbpnm.caption msgid "PNM" msgstr "PNM" #: tfrmmodview.teheight.text msgctxt "tfrmmodview.teheight.text" msgid "Height" msgstr "높이" #: tfrmmodview.tequality.text msgid "80" msgstr "80" #: tfrmmodview.tewidth.text msgctxt "TFRMMODVIEW.TEWIDTH.TEXT" msgid "Width" msgstr "폭" #: tfrmmsg.lblmsg.caption msgid "456456465465465" msgstr "" #: tfrmmultirename.btnclose.caption msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION" msgid "&Close" msgstr "닫기(&C)" #: tfrmmultirename.btndeletepreset.caption msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION" msgid "&Delete" msgstr "삭제(&D)" #: tfrmmultirename.btnedit.caption #, fuzzy msgctxt "tfrmmultirename.btnedit.caption" msgid "&Edit" msgstr "편집(&E)" #: tfrmmultirename.btnextmenu.caption msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION" msgid "..." msgstr "..." #: tfrmmultirename.btnloadpreset.caption msgid "&Load" msgstr "불러오기(&L)" #: tfrmmultirename.btnnamemenu.caption msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION" msgid "..." msgstr "..." #: tfrmmultirename.btnrename.caption msgctxt "tfrmmultirename.btnrename.caption" msgid "&Rename" msgstr "파일명 변경(&R)" #: tfrmmultirename.btnrestore.caption msgid "Reset &all" msgstr "전체 재설정(&A)" #: tfrmmultirename.btnsavepreset.caption msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION" msgid "&Save" msgstr "저장(&S)" #: tfrmmultirename.caption msgctxt "TFRMMULTIRENAME.CAPTION" msgid "MultiRename" msgstr "여러개 파일명 바꾸기" #: tfrmmultirename.cblog.caption msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION" msgid "Ena&ble" msgstr "가능(&B)" #: tfrmmultirename.cbregexp.caption msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION" msgid "Regular e&xpressions" msgstr "정규표현식(&X)" #: tfrmmultirename.cbusesubs.caption msgid "&Use substitution" msgstr "치환 사용(&U)" #: tfrmmultirename.cmbxwidth.text msgid "01" msgstr "01" #: tfrmmultirename.edinterval.text msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT" msgid "1" msgstr "1" #: tfrmmultirename.edpoc.text msgctxt "TFRMMULTIRENAME.EDPOC.TEXT" msgid "1" msgstr "1" #: tfrmmultirename.extension.caption msgid "[E] Extension" msgstr "[E] 확장자" #: tfrmmultirename.gbcounter.caption msgid "Counter" msgstr "일련 번호" #: tfrmmultirename.gbfindreplace.caption msgid "Find && Replace" msgstr "찾기 && 바꾸기" #: tfrmmultirename.gblog.caption msgid "Log Result" msgstr "로그 결과" #: tfrmmultirename.gbmaska.caption msgid "Mask" msgstr "마스크" #: tfrmmultirename.gbpresets.caption msgid "Presets" msgstr "프리셋" #: tfrmmultirename.lbext.caption msgid "&Extension" msgstr "확장자(&E)" #: tfrmmultirename.lbfind.caption msgid "&Find..." msgstr "찾기(&F)..." #: tfrmmultirename.lbinterval.caption msgid "&Interval" msgstr "간격(&I)" #: tfrmmultirename.lbname.caption msgid "File &Name" msgstr "파일명(&N)" #: tfrmmultirename.lbreplace.caption msgid "Re&place..." msgstr "바꾸기(&P)..." #: tfrmmultirename.lbstnb.caption msgid "S&tart Number" msgstr "시작 숫자(&T)" #: tfrmmultirename.lbwidth.caption msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION" msgid "&Width" msgstr "자릿수(&W)" #: tfrmmultirename.micounter.caption msgid "[C] Counter" msgstr "[C] 일련 번호" #: tfrmmultirename.miday.caption msgid "[D] Day" msgstr "[D] 일자" #: tfrmmultirename.miday1.caption msgid "[DD] Day (2 digits)" msgstr "[DD] 일자( 2 didgits)" #: tfrmmultirename.miday2.caption msgid "[DDD] Day of the week (short, e.g., \"mon\")" msgstr "[DDD] 요일(짧게,예,\"월\")" #: tfrmmultirename.miday3.caption msgid "[DDDD] Day of the week (long, e.g., \"monday\")" msgstr "[DDDD] 요일(길게, 예, \"월요일\")" #: tfrmmultirename.miextensionx.caption msgid "[Ex] Character at position x" msgstr "[Ex] 문자 위치 x" #: tfrmmultirename.miextensionxx.caption msgid "[Ex:y] Characters from position x to y" msgstr "[Ex:y] 문자 위치 x에서 y" #: tfrmmultirename.mihour.caption msgid "[h] Hour" msgstr "[h] 시간" #: tfrmmultirename.mihour1.caption msgid "[hh] Hour (2 digits)" msgstr "[hh] 시간 ( 2자리)" #: tfrmmultirename.miminute.caption msgid "[n] Minute" msgstr "[n] 분" #: tfrmmultirename.miminute1.caption msgid "[nn] Minute (2 digits)" msgstr "[nn] 분 (2자리)" #: tfrmmultirename.mimonth.caption msgid "[M] Month" msgstr "[M] 월" #: tfrmmultirename.mimonth1.caption msgid "[MM] Month (2 digits)" msgstr "[MM] 월 (2자리)" #: tfrmmultirename.mimonth2.caption msgid "[MMM] Month name (short, e.g., \"jan\")" msgstr "[MMM] 월 (짧게, 예, \"jan\")" #: tfrmmultirename.mimonth3.caption msgid "[MMMM] Month name (long, e.g., \"january\")" msgstr "[MMMM] 월 (길게, 예, \"january\")" #: tfrmmultirename.miname.caption msgid "[N] Name" msgstr "[N] 파일명" #: tfrmmultirename.minamex.caption msgid "[Nx] Character at position x" msgstr "[Nx] 문자 위치 x" #: tfrmmultirename.minamexx.caption msgid "[Nx:y] Characters from position x to y" msgstr "[Nx:y] 문자 위치 x에서 y까지" #: tfrmmultirename.minext.caption msgid "Time..." msgstr "시각..." #: tfrmmultirename.minextextension.caption msgid "Extension..." msgstr "확장자..." #: tfrmmultirename.minextname.caption msgid "Name..." msgstr "파일명..." #: tfrmmultirename.miplugin.caption msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION" msgid "Plugin" msgstr "플러그인" #: tfrmmultirename.misecond.caption msgid "[s] Second" msgstr "[s] 초" #: tfrmmultirename.misecond1.caption msgid "[ss] Second (2 digits)" msgstr "[ss] 초 (2자리)" #: tfrmmultirename.miyear.caption msgid "[Y] Year (2 digits)" msgstr "[Y] 년 (2 자리)" #: tfrmmultirename.miyear1.caption msgid "[YYYY] Year (4 digits)" msgstr "[YYYY] 년 (4 자리)" #: tfrmmultirename.mnueditnames.caption msgid "Edit names..." msgstr "" #: tfrmmultirename.mnuloadfromfile.caption msgid "Load names from file..." msgstr "" #: tfrmmultirename.n1.caption msgctxt "TFRMMULTIRENAME.N1.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n2.caption msgctxt "TFRMMULTIRENAME.N2.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n3.caption msgctxt "TFRMMULTIRENAME.N3.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n4.caption msgctxt "TFRMMULTIRENAME.N4.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n5.caption msgctxt "TFRMMULTIRENAME.N5.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.stringgrid.columns[0].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION" msgid "Old File Name" msgstr "오래된 파일명" #: tfrmmultirename.stringgrid.columns[1].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION" msgid "New File Name" msgstr "새 파일명" #: tfrmmultirename.stringgrid.columns[2].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION" msgid "File Path" msgstr "파일 경로" #: tfrmmultirenamewait.caption #, fuzzy msgctxt "tfrmmultirenamewait.caption" msgid "Double Commander" msgstr "더블 커맨더" #: tfrmmultirenamewait.lblmessage.caption msgid "Click OK when you have closed the editor to load the changed names!" msgstr "" #: tfrmopenwith.caption msgid "Choose an application" msgstr "응용 프로그램 선택" #: tfrmopenwith.chkcustomcommand.caption msgid "Custom command" msgstr "사용자 명령" #: tfrmopenwith.chksaveassociation.caption msgid "Save association" msgstr "관련성 저장" #: tfrmopenwith.chkuseasdefault.caption msgid "Set selected application as default action" msgstr "선택한 프로그램을 기본 프로그램으로 설정" #: tfrmopenwith.lblmimetype.caption msgid "File type to be opened: %s" msgstr "열린 파일 종류: %s" #: tfrmopenwith.milistoffiles.caption msgid "Multiple file names" msgstr "다중 파일명" #: tfrmopenwith.milistoffiles.hint msgid "%F" msgstr "%F" #: tfrmopenwith.milistofurls.caption msgid "Multiple URIs" msgstr "다중 URI" #: tfrmopenwith.milistofurls.hint msgid "%U" msgstr "%U" #: tfrmopenwith.misinglefilename.caption msgid "Single file name" msgstr "단일 파일명" #: tfrmopenwith.misinglefilename.hint msgid "%f" msgstr "%f" #: tfrmopenwith.misingleurl.caption msgid "Single URI" msgstr "단일 URI" #: tfrmopenwith.misingleurl.hint msgid "%u" msgstr "%u" #: tfrmoptions.btnapply.caption msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION" msgid "&Apply" msgstr "적용(&A)" #: tfrmoptions.btncancel.caption msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmoptions.btnok.caption msgctxt "TFRMOPTIONS.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmoptions.caption msgctxt "TFRMOPTIONS.CAPTION" msgid "Options" msgstr "설정" #: tfrmoptions.lblemptyeditor.caption msgid "Please select one of the subpages, this page does not contain any settings." msgstr "하위페이지를 선택하세요. 이 페이지는 어떤 설정도 포함하고 있지 않습니다." #: tfrmoptionsarchivers.btnarchiveradd.caption msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption" msgid "A&dd" msgstr "더하기(&D)" #: tfrmoptionsarchivers.btnarchiveraddhelper.hint msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverapply.caption msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption" msgid "A&pply" msgstr "적용(&P)" #: tfrmoptionsarchivers.btnarchivercopy.caption msgid "Cop&y" msgstr "복사" #: tfrmoptionsarchivers.btnarchiverdelete.caption msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption" msgid "Delete" msgstr "삭제(&E)" #: tfrmoptionsarchivers.btnarchiverdeletehelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverextracthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverlisthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverother.caption msgid "Oth&er..." msgstr "다른 옵션..." #: tfrmoptionsarchivers.btnarchiverrelativer.hint msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint" msgid "Some functions to select appropriate path" msgstr "적절한 경로를 선택하기위한 기능" #: tfrmoptionsarchivers.btnarchiverrename.caption msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption" msgid "&Rename" msgstr "파일명 바꾸기(&R)" #: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchivertesthelper.hint msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.bvlarchiverids.caption msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption" msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:" msgstr "" #: tfrmoptionsarchivers.bvlarchiveroptions.caption msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption" msgid "Options:" msgstr "옵션:" #: tfrmoptionsarchivers.bvlarchiverparsingmode.caption msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption" msgid "Format parsing mode:" msgstr "파싱모드로 포맷:" #: tfrmoptionsarchivers.chkarchiverenabled.caption msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption" msgid "E&nabled" msgstr "가능(&N)" #: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption msgid "De&bug mode" msgstr "디버그 모드(&B)" #: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption" msgid "S&how console output" msgstr "컨솔 결과 출력(&H)" #: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption msgid "Uni&x file attributes" msgstr "" #: tfrmoptionsarchivers.ckbarchiverunixpath.caption msgid "&Unix path delimiter \"/\"" msgstr "" #: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption msgid "Windows &file attributes" msgstr "" #: tfrmoptionsarchivers.ckbarchiverwindowspath.caption msgid "Windows path deli&miter \"\\\"" msgstr "" #: tfrmoptionsarchivers.lblarchiveradd.caption msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption" msgid "Add&ing:" msgstr "추가(&I):" #: tfrmoptionsarchivers.lblarchiverarchiver.caption msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption" msgid "Arc&hiver:" msgstr "압축기(&H):" #: tfrmoptionsarchivers.lblarchiverdelete.caption msgid "De&lete:" msgstr "삭제:" #: tfrmoptionsarchivers.lblarchiverdescription.caption msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption" msgid "De&scription:" msgstr "설명(&S):" #: tfrmoptionsarchivers.lblarchiverextension.caption msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption" msgid "E&xtension:" msgstr "확장자(&X):" #: tfrmoptionsarchivers.lblarchiverextract.caption msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption" msgid "Ex&tract:" msgstr "압축풀기(&T):" #: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption msgid "Extract &without path:" msgstr "경로없이 압축풀기:" #: tfrmoptionsarchivers.lblarchiveridposition.caption msgid "ID Po&sition:" msgstr "아이디 위치:" #: tfrmoptionsarchivers.lblarchiverids.caption msgid "&ID:" msgstr "아이디:" #: tfrmoptionsarchivers.lblarchiveridseekrange.caption msgid "ID See&k Range:" msgstr "아이디 찾기 영역:" #: tfrmoptionsarchivers.lblarchiverlist.caption msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption" msgid "&List:" msgstr "목록(&L):" #: tfrmoptionsarchivers.lblarchiverlistbox.caption msgid "Archi&vers:" msgstr "압축기:" #: tfrmoptionsarchivers.lblarchiverlistend.caption msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption" msgid "Listing &finish (optional):" msgstr "결과 목록 보기(선택사항)(&F):" #: tfrmoptionsarchivers.lblarchiverlistformat.caption msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption" msgid "Listing for&mat:" msgstr "목록 형태(&M):" #: tfrmoptionsarchivers.lblarchiverliststart.caption msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption" msgid "Listin&g start (optional):" msgstr "목록 실행(선택사항)(&G):" #: tfrmoptionsarchivers.lblarchiverpasswordquery.caption msgid "Password &query string:" msgstr "비밀번호 쿼리 문자열:" #: tfrmoptionsarchivers.lblarchiverselfextract.caption msgid "Create self extractin&g archive:" msgstr "자동 압축해제 파일 생셩:" #: tfrmoptionsarchivers.lblarchivertest.caption msgid "Tes&t:" msgstr "테스트:" #: tfrmoptionsarchivers.miarchiverautoconfigure.caption msgid "Auto Configure" msgstr "자동 구성(&U)" #: tfrmoptionsarchivers.miarchiverdisableall.caption msgid "Disable all" msgstr "" #: tfrmoptionsarchivers.miarchiverdiscardmodification.caption msgid "Discard modifications" msgstr "" #: tfrmoptionsarchivers.miarchiverenableall.caption msgid "Enable all" msgstr "" #: tfrmoptionsarchivers.miarchiverexport.caption msgctxt "tfrmoptionsarchivers.miarchiverexport.caption" msgid "Export..." msgstr "내보내기..." #: tfrmoptionsarchivers.miarchiverimport.caption msgctxt "tfrmoptionsarchivers.miarchiverimport.caption" msgid "Import..." msgstr "가져오기..." #: tfrmoptionsarchivers.miarchiversortarchivers.caption msgid "Sort archivers" msgstr "" #: tfrmoptionsarchivers.tbarchiveradditional.caption msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION" msgid "Additional" msgstr "부가 기능" #: tfrmoptionsarchivers.tbarchivergeneral.caption msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION" msgid "General" msgstr "일반" #: tfrmoptionsautorefresh.cbwatchattributeschange.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION" msgid "When &size, date or attributes change" msgstr "크기, 날자 또는 속성이 변경되었을 때(&S)" #: tfrmoptionsautorefresh.cbwatchexcludedirs.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION" msgid "For the following &paths and their subdirectories:" msgstr "다음 경로와 하위 디렉토리(&P):" #: tfrmoptionsautorefresh.cbwatchfilenamechange.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION" msgid "When &files are created, deleted or renamed" msgstr "파일이 만들어지면 삭제 또는 파일명 바꾸기(&F)" #: tfrmoptionsautorefresh.cbwatchonlyforeground.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION" msgid "When application is in the &background" msgstr "어플리케이션이 백그라운드에 실행될 때(&B)" #: tfrmoptionsautorefresh.gbautorefreshdisable.caption msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION" msgid "Disable auto-refresh" msgstr "자동 새로고침 불가" #: tfrmoptionsautorefresh.gbautorefreshenable.caption msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION" msgid "Refresh file list" msgstr "파일 목록 새로고침" #: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION" msgid "Al&ways show tray icon" msgstr "항상 트레이에 위치(&W)" #: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption msgid "Automatically &hide unmounted devices" msgstr "마운트되지 않은 디바이스 자동 숨기기(&H)" #: tfrmoptionsbehavior.cbminimizetotray.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION" msgid "Mo&ve icon to system tray when minimized" msgstr "최소화시 시스템 트레이로 이동(&V)" #: tfrmoptionsbehavior.cbonlyonce.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION" msgid "A&llow only one copy of DC at a time" msgstr "더블커맨더 오직 하나만 실행 허용(&L)" #: tfrmoptionsbehavior.edtdrivesblacklist.hint msgid "Here you can enter one or more drives or mount points, separated by \";\"." msgstr "\";\"로 구분된 하나 이상의 드라이브 입력" #: tfrmoptionsbehavior.lbldrivesblacklist.caption msgid "Drives &blacklist" msgstr "디바이스 제외리스트(&B)" #: tfrmoptionsbriefview.gbcolumns.caption msgid "Columns size" msgstr "파일속성열 제목 크기" #: tfrmoptionsbriefview.gbshowfileext.caption msgid "Show file extensions" msgstr "파일 확장자 표시" #: tfrmoptionsbriefview.rbaligned.caption msgid "ali&gned (with Tab)" msgstr "(탭)정렬(&G)" #: tfrmoptionsbriefview.rbdirectly.caption msgid "di&rectly after filename" msgstr "파일명 뒤에 폴더명(&R)" #: tfrmoptionsbriefview.rbuseautosize.caption msgid "Auto" msgstr "자동" #: tfrmoptionsbriefview.rbusefixedcount.caption msgid "Fixed columns count" msgstr "고정된 파일속성열 제목 세기" #: tfrmoptionsbriefview.rbusefixedwidth.caption msgid "Fixed columns width" msgstr "고정된 파일속성열 제목폭" #: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption msgid "Cut &text to column width" msgstr "파일속성열 제목 폭 텍스트 잘라내기(&T)" #: tfrmoptionscolumnsview.cbextendcellwidth.caption msgid "&Extend cell width if text is not fitting into column" msgstr "" #: tfrmoptionscolumnsview.cbgridhorzline.caption msgid "&Horizontal lines" msgstr "수평줄(&H)" #: tfrmoptionscolumnsview.cbgridvertline.caption msgid "&Vertical lines" msgstr "수직줄(&V)" #: tfrmoptionscolumnsview.chkautofillcolumns.caption msgid "A&uto fill columns" msgstr "자동 파일속성열 제목 채움(&U)" #: tfrmoptionscolumnsview.gbshowgrid.caption msgid "Show grid" msgstr "격자 표시" #: tfrmoptionscolumnsview.grpautosizecolumns.caption msgid "Auto-size columns" msgstr "자동 파일속성열 제목 크기" #: tfrmoptionscolumnsview.lblautosizecolumn.caption msgid "Auto si&ze column:" msgstr "자동 파일속성열 제목 크기(&Z):" #: tfrmoptionsconfiguration.btnconfigapply.caption msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION" msgid "A&pply" msgstr "적용(&P)" #: tfrmoptionsconfiguration.btnconfigedit.caption msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION" msgid "&Edit" msgstr "편집(&E)" #: tfrmoptionsconfiguration.cbcmdlinehistory.caption msgid "Co&mmand line history" msgstr "명령 프롬프트 히스토리(&M)" #: tfrmoptionsconfiguration.cbdirhistory.caption msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION" msgid "&Directory history" msgstr "폴더 히스토리(&D)" #: tfrmoptionsconfiguration.cbfilemaskhistory.caption msgid "&File mask history" msgstr "찾은 파일 히스토리(&F)" #: tfrmoptionsconfiguration.chksaveconfiguration.caption msgid "Sa&ve configuration" msgstr "환경설정 저장(&V)" #: tfrmoptionsconfiguration.chksearchreplacehistory.caption msgid "Searc&h/Replace history" msgstr "검색/바꾸기 히스토리(&H)" #: tfrmoptionsconfiguration.gbdirectories.caption #, fuzzy msgctxt "tfrmoptionsconfiguration.gbdirectories.caption" msgid "Directories" msgstr "폴더" #: tfrmoptionsconfiguration.gblocconfigfiles.caption msgid "Location of configuration files" msgstr "환경설정 파일 위치" #: tfrmoptionsconfiguration.gbsaveonexit.caption msgid "Save on exit" msgstr "저장후 종료" #: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption msgid "Sort order of configuration order in left tree" msgstr "왼쪽 트리에 환경설정 명령 정렬" #: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption msgid "Set on command line" msgstr "명령 프롬프트에 준비" #: tfrmoptionsconfiguration.lblhighlighters.caption msgid "Highlighters:" msgstr "" #: tfrmoptionsconfiguration.lbliconthemes.caption msgid "Icon themes:" msgstr "" #: tfrmoptionsconfiguration.lblthumbcache.caption msgid "Thumbnails cache:" msgstr "" #: tfrmoptionsconfiguration.rbprogramdir.caption msgid "P&rogram directory (portable version)" msgstr "프로그램 폴더(포터블 버전)(&R)" #: tfrmoptionsconfiguration.rbuserhomedir.caption msgid "&User home directory" msgstr "사용자 홈 폴더(&U)" #: tfrmoptionscustomcolumns.btnallallowovercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallallowovercolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnallbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallbackcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnallbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallbackcolor2.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnallcursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallcursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnallcursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallcursortext.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnallfont.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFONT.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallfont.hint msgctxt "tfrmoptionscustomcolumns.btnallfont.hint" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnallforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallforecolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT" msgid "Apply modification to all columns" msgstr "전부" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnallmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnallmarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION" msgid "All" msgstr "전부" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT" msgid "Apply modification to all columns" msgstr "모든 파일속성열 제목에 설정 적용" #: tfrmoptionscustomcolumns.btnbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursorbordercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORBORDERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION" msgid "&Delete" msgstr "삭제(&D)" #: tfrmoptionscustomcolumns.btnfont.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionscustomcolumns.btnforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btngotosetdefault.caption msgid "Go to set default" msgstr "기본설정 가기" #: tfrmoptionscustomcolumns.btngotosetdefault.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btninactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btninactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnnewconfig.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION" msgid "New" msgstr "새 파일" #: tfrmoptionscustomcolumns.btnnext.caption msgid "Next" msgstr "다음" #: tfrmoptionscustomcolumns.btnprev.caption msgid "Previous" msgstr "이전" #: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION" msgid "Rename" msgstr "파일명 바꾸기" #: tfrmoptionscustomcolumns.btnresetallowovercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetallowovercolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetbackcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetbackcolor2.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetcursorborder.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORBORDER.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursorborder.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetcursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetcursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursortext.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetfont.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetfont.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetforecolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetframecursor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetframecursor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetmarkcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT" msgid "Reset to default" msgstr "기본으로 재설정" #: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION" msgid "Save as" msgstr "새 이름 저장" #: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION" msgid "Save" msgstr "저장" #: tfrmoptionscustomcolumns.cballowovercolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBALLOWOVERCOLOR.CAPTION" msgid "Allow Overcolor" msgstr "채색 허용" #: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption msgid "When clicking to change something, change for all columns" msgstr "변경을 위해 클릭할 때 전체 파일 속성열 변경" #: tfrmoptionscustomcolumns.cbconfigcolumns.text msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT" msgid "General" msgstr "일반" #: tfrmoptionscustomcolumns.cbcursorborder.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCURSORBORDER.CAPTION" msgid "Cursor border" msgstr "커서 경계선" #: tfrmoptionscustomcolumns.cbuseframecursor.caption msgid "Use Frame Cursor" msgstr "프레임커서 사용" #: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption msgid "Use Inactive Selection Color" msgstr "비활성 선택 색상 사용" #: tfrmoptionscustomcolumns.cbuseinvertedselection.caption msgid "Use Inverted Selection" msgstr "반전 선택 사용" #: tfrmoptionscustomcolumns.chkusecustomview.caption msgid "Use custom font and color for this view" msgstr "이 보기를 사용자 글골과 색상 사용" #: tfrmoptionscustomcolumns.lblbackcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLBACKCOLOR.CAPTION" msgid "BackGround:" msgstr "배경:" #: tfrmoptionscustomcolumns.lblbackcolor2.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLBACKCOLOR2.CAPTION" msgid "Background 2:" msgstr "배경2:" #: tfrmoptionscustomcolumns.lblconfigcolumns.caption msgid "Con&figure columns view:" msgstr "파일속성열 제목 보기 환경설정(&F):" #: tfrmoptionscustomcolumns.lblcurrentcolumn.caption msgid "[Current Column Name]" msgstr "[현재 파일속성열 이름]" #: tfrmoptionscustomcolumns.lblcursorcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCURSORCOLOR.CAPTION" msgid "Cursor Color:" msgstr "커서 색상:" #: tfrmoptionscustomcolumns.lblcursortext.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCURSORTEXT.CAPTION" msgid "Cursor Text:" msgstr "커서 글자:" #: tfrmoptionscustomcolumns.lblfontname.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTNAME.CAPTION" msgid "Font:" msgstr "글꼴:" #: tfrmoptionscustomcolumns.lblfontsize.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION" msgid "Size:" msgstr "크기:" #: tfrmoptionscustomcolumns.lblforecolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFORECOLOR.CAPTION" msgid "Text Color:" msgstr "글자 색상:" #: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption" msgid "Inactive Cursor Color:" msgstr "비활성 커서 색상:" #: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption" msgid "Inactive Mark Color:" msgstr "비활성 마스크 색상:" #: tfrmoptionscustomcolumns.lblmarkcolor.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLMARKCOLOR.CAPTION" msgid "Mark Color:" msgstr "표시 색상:" #: tfrmoptionscustomcolumns.lblpreviewtop.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLPREVIEWTOP.CAPTION" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "미리보기 아래에 위치. 커서를 움직여 파일을 직접 선택할 수 있음" #: tfrmoptionscustomcolumns.lblworkingcolumn.caption msgid "Settings for column:" msgstr "파일속성열 설정:" #: tfrmoptionscustomcolumns.miaddcolumn.caption msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.MIADDCOLUMN.CAPTION" msgid "Add column" msgstr "파일속성열 추가하기" #: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption msgid "Position of frame panel after the comparison:" msgstr "비교후 창의 위치:" #: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption msgid "Add directory of the &active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption msgid "Add &directories of the active && inactive frames" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption msgid "Add directory I will bro&wse to" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption #, fuzzy msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption" msgid "Add a copy of the selected entry" msgstr "선택 목록 복사 추가" #: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption msgid "Add current &selected or active directories of active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddseparator.caption #, fuzzy msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption" msgid "Add a separator" msgstr "구분자 추가" #: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption msgid "Add a sub menu" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption #, fuzzy msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption" msgid "Add directory I will type" msgstr "타이핑 입력할 폴더 추가" #: tfrmoptionsdirectoryhotlist.actcollapseall.caption #, fuzzy msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption" msgid "Collapse all" msgstr "전부 접기" #: tfrmoptionsdirectoryhotlist.actcollapseitem.caption msgid "Collapse item" msgstr "" #: tfrmoptionsdirectoryhotlist.actcut.caption msgid "Cut selection of entries" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeleteall.caption msgid "Delete all!" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption #, fuzzy msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption" msgid "Delete selected item" msgstr "선택된 항목 삭제" #: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption msgid "Delete sub-menu and all its elements" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption msgid "Delete just sub-menu but keep elements" msgstr "" #: tfrmoptionsdirectoryhotlist.actexpanditem.caption msgid "Expand item" msgstr "" #: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption msgid "Focus tree window" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption msgid "Goto first item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotolastitem.caption msgid "Goto last item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotonextitem.caption msgid "Go to next item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption msgid "Go to previous item" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption msgid "Insert directory of the &active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption msgid "Insert &directories of the active && inactive frames" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption msgid "Insert directory I will bro&wse to" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption msgid "Insert a copy of the selected entry" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption msgid "Insert current &selected or active directories of active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertseparator.caption msgid "Insert a separator" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption msgid "Insert sub menu" msgstr "" #: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption #, fuzzy msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption" msgid "Insert directory I will type" msgstr "타이핑 입력할 폴더 삽입" #: tfrmoptionsdirectoryhotlist.actmovetonext.caption msgid "Move to next" msgstr "" #: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption msgid "Move to previous" msgstr "" #: tfrmoptionsdirectoryhotlist.actopenallbranches.caption #, fuzzy msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption" msgid "Open all branches" msgstr "모든 하위 트리 열기" #: tfrmoptionsdirectoryhotlist.actpaste.caption msgid "Paste what was cut" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption msgid "Search && replace in &path" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption msgid "Search && replace in both path and target" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption msgid "Search && replace in &target path" msgstr "" #: tfrmoptionsdirectoryhotlist.acttweakpath.caption msgid "Tweak path" msgstr "" #: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption msgid "Tweak target path" msgstr "" #: tfrmoptionsdirectoryhotlist.btnadd.caption #, fuzzy #| msgid "Add..." msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption" msgid "A&dd..." msgstr "추가..." #: tfrmoptionsdirectoryhotlist.btnbackup.caption #, fuzzy #| msgid "Backup..." msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption" msgid "Bac&kup..." msgstr "백업..." #: tfrmoptionsdirectoryhotlist.btndelete.caption #, fuzzy #| msgid "Delete..." msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption" msgid "De&lete..." msgstr "삭제..." #: tfrmoptionsdirectoryhotlist.btnexport.caption #, fuzzy #| msgid "Export..." msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption" msgid "E&xport..." msgstr "내보내기..." #: tfrmoptionsdirectoryhotlist.btnhelp.caption #, fuzzy #| msgid "Help" msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption" msgid "&Help" msgstr "도움말" #: tfrmoptionsdirectoryhotlist.btnimport.caption #, fuzzy #| msgid "Import..." msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption" msgid "Impo&rt..." msgstr "가져오기..." #: tfrmoptionsdirectoryhotlist.btninsert.caption #, fuzzy #| msgid "Insert..." msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption" msgid "&Insert..." msgstr "삽입..." #: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption #, fuzzy #| msgid "Miscellaneous..." msgid "&Miscellaneous..." msgstr "기타..." #: tfrmoptionsdirectoryhotlist.btnrelativepath.hint msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT" msgid "Some functions to select appropriate path" msgstr "적절한 경로 선택 기능" #: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVETARGET.HINT" msgid "Some functions to select appropriate target" msgstr "적절한 대상 파일 선택 기능" #: tfrmoptionsdirectoryhotlist.btnsort.caption #, fuzzy #| msgid "Sort..." msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption" msgid "&Sort..." msgstr "정렬..." #: tfrmoptionsdirectoryhotlist.cbaddtarget.caption #, fuzzy #| msgid "When adding directory, add also target" msgid "&When adding directory, add also target" msgstr "폴더 추가할 때 대상 파일로 추가" #: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption #, fuzzy #| msgid "Always expand tree" msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption" msgid "Alwa&ys expand tree" msgstr "항상 트리 확장" #: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption #, fuzzy #| msgid "Show only valid environment variables" msgid "Show only &valid environment variables" msgstr "유효 환경변수만 보이기" #: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption #, fuzzy #| msgid "In popup, show [path also]" msgid "In pop&up, show [path also]" msgstr "팝업, 보이기[또한 경로]" #: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRPATH.TEXT" msgid "Name, a-z" msgstr "파일명, a-z" #: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT" msgid "Name, a-z" msgstr "파일명, a-z" #: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption msgid "Directory Hotlist (reorder by drag && drop)" msgstr "즐겨찾기 디렉터리(드래그 && 드롭 재정렬)" #: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption" msgid "Other options" msgstr "다른 옵션" #: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION" msgid "Name:" msgstr "파일명:" #: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION" msgid "Path:" msgstr "경로:" #: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption #, fuzzy #| msgid "Target:" msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRTARGET.EDITLABEL.CAPTION" msgid "&Target:" msgstr "비활성창:" #: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption #, fuzzy #| msgid "...current level of item(s) selected only" msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption" msgid "...current le&vel of item(s) selected only" msgstr "...선택된 목록 현재 레벨" #: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption #, fuzzy #| msgid "Scan all hotdir's path to validate the ones that actually exist" msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHEXIST.CAPTION" msgid "Scan all &hotdir's path to validate the ones that actually exist" msgstr "바로 가기 경로 존재여부 점검하기" #: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption #, fuzzy #| msgid "Scan all hotdir's path && target to validate the ones that actually exist" msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHTARGETEXIST.CAPTION" msgid "&Scan all hotdir's path && target to validate the ones that actually exist" msgstr "바로 가기 경로 && 타깃 유효성 점검하기" #: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption #, fuzzy #| msgid "to a Directory Hotlist file (.hotlist)" msgid "to a Directory &Hotlist file (.hotlist)" msgstr "폴더 바로 가기 목록 파일(.hotlist)" #: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption #, fuzzy #| msgid "to a \"wincmd.ini\" of TC (keep existing)" msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption" msgid "to a \"wincmd.ini\" of TC (&keep existing)" msgstr "TC의 \"wincmd.ini\"로 (기존파일 유지)" #: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption #, fuzzy #| msgid "to a \"wincmd.ini\" of TC (erase existing)" msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption" msgid "to a \"wincmd.ini\" of TC (&erase existing)" msgstr "TC의 \"wincmd.ini\"로 (기존파일 삭제)" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption #, fuzzy #| msgid "Go to configure TC related info" msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption" msgid "Go to &configure TC related info" msgstr "TC(토탈커맨더)정보와 관련된 환경설정 가기" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption #, fuzzy #| msgid "Go to configure TC related info" msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION" msgid "Go to &configure TC related info" msgstr "TC(토탈커맨더)정보와 관련된 환경설정 가기" #: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption msgid "HotDirTestMenu" msgstr "바로 가기테스트메뉴" #: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption #, fuzzy #| msgid "from a Directory Hotlist file (.hotlist)" msgid "from a Directory &Hotlist file (.hotlist)" msgstr "폴더 바로 가기 파일로 부터(.hotlist)" #: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption #, fuzzy #| msgid "from \"wincmd.ini\" of TC" msgid "from \"&wincmd.ini\" of TC" msgstr "TC의 \"wincmd.ini\"로 부터" #: tfrmoptionsdirectoryhotlist.minavigate.caption msgid "&Navigate..." msgstr "" #: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption #, fuzzy #| msgid "Restore a backup of Directory Hotlist" msgid "&Restore a backup of Directory Hotlist" msgstr "폴더 바로 가기 백업에서 복구" #: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption #, fuzzy #| msgid "Save a backup of current Directory Hotlist" msgid "&Save a backup of current Directory Hotlist" msgstr "현재 폴더 바로 가기 백업 저장" #: tfrmoptionsdirectoryhotlist.misearchandreplace.caption #, fuzzy #| msgid "Search and replace..." msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption" msgid "Search and &replace..." msgstr "찾아 바꾸기..." #: tfrmoptionsdirectoryhotlist.misorteverything.caption #, fuzzy #| msgid "...everything, from A to Z!" msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption" msgid "...everything, from A to &Z!" msgstr "...A에서 Z까지 모두!" #: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption #, fuzzy #| msgid "...single group of item(s) only" msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption" msgid "...single &group of item(s) only" msgstr "...단일 그룹 목록만" #: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption #, fuzzy #| msgid "...content of submenu(s) selected, no sublevel" msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption" msgid "...&content of submenu(s) selected, no sublevel" msgstr "...하위메뉴 내용 선택, 하위수준 없음" #: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption #, fuzzy #| msgid "...content of submenu(s) selected and all sublevels" msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption" msgid "...content of submenu(s) selected and &all sublevels" msgstr "..선택된 하위 메뉴 내용과 모든 하위 수준" #: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption #, fuzzy #| msgid "Test resulting menu" msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MITESTRESULTINGHOTLISTMENU.CAPTION" msgid "Test resultin&g menu" msgstr "결과 메뉴 검증" #: tfrmoptionsdirectoryhotlist.mitweakpath.caption msgid "Tweak &path" msgstr "" #: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption msgid "Tweak &target path" msgstr "" #: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption #, fuzzy #| msgid "Addition from main panel:" msgid "Addition from main panel" msgstr "메인창에서 추가:" #: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption msgid "From all the supported formats, ask which one to use every time" msgstr "지원 가능한 모든 파일 형태를 항상 묻기" #: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)" msgstr "유니코드 텍스트 저장시, UTF8 형태로 저장(아니면 UTF16으로)" #: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption msgid "When dropping text, generate filename automatically (otherwise will prompt the user)" msgstr "텍스트 파일 드래그앤드롭할 때 자동으로 파일명 생성(아니면 사용자에게 묻기)" #: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption msgid "&Show confirmation dialog after drop" msgstr "드롭 후 확인창 표시(&S)" #: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption msgid "When drag && dropping text into panels:" msgstr "텍스트를 다른 창으로 드래그 && 드롭할 때:" #: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption msgid "Place the most desired format on top of list (use dag && drop):" msgstr "가장 원하는 파일 형태 상위로 이동(드래그 && 드롭):" #: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption msgid "(if the most desired is not present, we'll take second one and so on)" msgstr "(원하는 파일이 아니면 두번째로도 가능)" #: tfrmoptionsdragdrop.lblwarningforaskformat.caption msgid "(will not work with some source application, so try to uncheck if problem)" msgstr "(어떤 소스 프로그램에서는 작동하지 않으므로 문제 발생시 체크해제하세요.)" #: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption msgid "Show &file system" msgstr "파일 시스템 표시(&F)" #: tfrmoptionsdriveslistbutton.cbshowfreespace.caption msgid "Show fr&ee space" msgstr "사용 가능 공간 표시(&E)" #: tfrmoptionsdriveslistbutton.cbshowlabel.caption msgid "Show &label" msgstr "드라이브명 표시(&L)" #: tfrmoptionsdriveslistbutton.gbdriveslist.caption msgid "Drives list" msgstr "드라이브 목록" #: tfrmoptionseditor.chkautoindent.caption msgid "Auto Indent" msgstr "" #: tfrmoptionseditor.chkautoindent.hint msgid "Allows to indent the caret, when new line is created with , with the same amount of leading white space as the preceding line" msgstr "" #: tfrmoptionseditor.chkscrollpastendline.caption msgid "Caret past end of line" msgstr "탈자기호(^) 줄 끝" #: tfrmoptionseditor.chkscrollpastendline.hint msgid "Allows caret to go into empty space beyond end-of-line position" msgstr "" #: tfrmoptionseditor.chkshowspecialchars.caption msgid "Show special characters" msgstr "특수문자 표시" #: tfrmoptionseditor.chkshowspecialchars.hint msgid "Shows special characters for spaces and tabulations" msgstr "" #: tfrmoptionseditor.chktabindent.caption msgid "Tab indents blocks" msgstr "" #: tfrmoptionseditor.chktabindent.hint msgid "When active and act as block indent, unindent when text is selected" msgstr "" #: tfrmoptionseditor.chktabstospaces.caption msgid "Use spaces instead tab characters" msgstr "" #: tfrmoptionseditor.chktabstospaces.hint msgid "Converts tab characters to a specified number of space characters (when entering)" msgstr "" #: tfrmoptionseditor.chktrimtrailingspaces.caption msgid "Delete trailing spaces" msgstr "" #: tfrmoptionseditor.chktrimtrailingspaces.hint msgid "Auto delete trailing spaces, this applies only to edited lines" msgstr "" #: tfrmoptionseditor.gbinternaleditor.caption msgid "Internal editor options" msgstr "내부 편집기 옵션" #: tfrmoptionseditorcolors.backgroundlabel.caption msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption" msgid "Bac&kground" msgstr "배경(&K)" #: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION" msgid "Bac&kground" msgstr "배경(&K)" #: tfrmoptionseditorcolors.btnresetmask.hint msgid "Reset" msgstr "재설정" #: tfrmoptionseditorcolors.btnsavemask.hint msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT" msgid "Save" msgstr "저장" #: tfrmoptionseditorcolors.bvlattributesection.caption msgid "Element Attributes" msgstr "요소 속성" #: tfrmoptionseditorcolors.foregroundlabel.caption msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption" msgid "Fo®round" msgstr "전경(&R)" #: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION" msgid "Fo®round" msgstr "전경(&R)" #: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption msgid "&Text-mark" msgstr "텍스트 마크(&T)" #: tfrmoptionseditorcolors.tbtnglobal.caption msgid "Use (and edit) &global scheme settings" msgstr "사용(및 편집) 전역스킴(global shceme) 설정(&G)" #: tfrmoptionseditorcolors.tbtnlocal.caption msgid "Use &local scheme settings" msgstr "지역스킴(local scheme) 사용(&L)" #: tfrmoptionseditorcolors.textboldcheckbox.caption msgid "&Bold" msgstr "진하게(&B)" #: tfrmoptionseditorcolors.textboldradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION" msgid "In&vert" msgstr "반전(&V)" #: tfrmoptionseditorcolors.textboldradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION" msgid "O&ff" msgstr "끄기(&F)" #: tfrmoptionseditorcolors.textboldradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION" msgid "O&n" msgstr "켜기(&N)" #: tfrmoptionseditorcolors.textitaliccheckbox.caption msgid "&Italic" msgstr "기울임체(&I)" #: tfrmoptionseditorcolors.textitalicradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION" msgid "In&vert" msgstr "반전(&V)" #: tfrmoptionseditorcolors.textitalicradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION" msgid "O&ff" msgstr "끄기(&F)" #: tfrmoptionseditorcolors.textitalicradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION" msgid "O&n" msgstr "켜기(&N)" #: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption msgid "&Strike Out" msgstr "스트라이크 아웃(&S)" #: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION" msgid "In&vert" msgstr "반전(&V)" #: tfrmoptionseditorcolors.textstrikeoutradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION" msgid "O&ff" msgstr "끄기(&F)" #: tfrmoptionseditorcolors.textstrikeoutradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION" msgid "O&n" msgstr "켜기(&N)" #: tfrmoptionseditorcolors.textunderlinecheckbox.caption msgid "&Underline" msgstr "밑줄(&U)" #: tfrmoptionseditorcolors.textunderlineradioinvert.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption" msgid "In&vert" msgstr "반전(&V)" #: tfrmoptionseditorcolors.textunderlineradiooff.caption msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption" msgid "O&ff" msgstr "끄기(&F)" #: tfrmoptionseditorcolors.textunderlineradioon.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption" msgid "O&n" msgstr "켜기(&N)" #: tfrmoptionsfavoritetabs.btnadd.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION" msgid "Add..." msgstr "추가..." #: tfrmoptionsfavoritetabs.btndelete.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION" msgid "Delete..." msgstr "삭제..." #: tfrmoptionsfavoritetabs.btnimportexport.caption msgid "Import/Export" msgstr "가져오기/내보내기" #: tfrmoptionsfavoritetabs.btninsert.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION" msgid "Insert..." msgstr "삽입..." #: tfrmoptionsfavoritetabs.btnrename.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION" msgid "Rename" msgstr "이름 바꾸기" #: tfrmoptionsfavoritetabs.btnsort.caption msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION" msgid "Sort..." msgstr "정렬..." #: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text" msgid "None" msgstr "None" #: tfrmoptionsfavoritetabs.cbfullexpandtree.caption msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION" msgid "Always expand tree" msgstr "항상 트리구조 펴기" #: tfrmoptionsfavoritetabs.cbsavedirhistory.text msgctxt "TFRMOPTIONSFAVORITETABS.CBSAVEDIRHISTORY.TEXT" msgid "No" msgstr "No" #: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text" msgid "Left" msgstr "왼쪽" #: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text" msgid "Right" msgstr "오른쪽" #: tfrmoptionsfavoritetabs.gbfavoritetabs.caption msgid "Favorite Tabs list (reorder by drag && drop)" msgstr "즐겨찾기 탭 목록 (드래그 && 드롭 정렬)" #: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION" msgid "Other options" msgstr "기타 옵션" #: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption msgid "What to restore where for the selected entry:" msgstr "선택 항목 복구:" #: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption msgid "Existing tabs to keep:" msgstr "존재하는 탭 유지:" #: tfrmoptionsfavoritetabs.lblsavedirhistory.caption msgid "Save dir history:" msgstr "탭 히스토리 저장:" #: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption msgid "Tabs saved on left to be restored to:" msgstr "저장된 탭 왼쪽창에 복구:" #: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption msgid "Tabs saved on right to be restored to:" msgstr "저장된 탭 오른쪽창에 복구:" #: tfrmoptionsfavoritetabs.menuitem1.caption msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.menuitem2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miaddseparator.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION" msgid "a separator" msgstr "구분자" #: tfrmoptionsfavoritetabs.miaddseparator2.caption msgid "Add separator" msgstr "구분자 추가" #: tfrmoptionsfavoritetabs.miaddsubmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION" msgid "sub-menu" msgstr "하위 메뉴" #: tfrmoptionsfavoritetabs.miaddsubmenu2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION" msgid "Add sub-menu" msgstr "하위 메뉴 추가" #: tfrmoptionsfavoritetabs.micollapseall.caption msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION" msgid "Collapse all" msgstr "모두 없애기" #: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION" msgid "...current level of item(s) selected only" msgstr "...선택 목록 레벨" #: tfrmoptionsfavoritetabs.micutselection.caption msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION" msgid "Cut" msgstr "잘라내기" #: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION" msgid "delete all!" msgstr "모두 삭제!" #: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION" msgid "sub-menu and all its elements" msgstr "하위 메뉴와 모든 요소" #: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION" msgid "just sub-menu but keep elements" msgstr "요소를 유지하고 하위메뮤만" #: tfrmoptionsfavoritetabs.mideleteselectedentry.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION" msgid "selected item" msgstr "선택된 항목" #: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION" msgid "Delete selected item" msgstr "선택된 항목 삭제" #: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption msgid "Export selection to legacy .tab file(s)" msgstr "선택을 legacy.tab 파일로 내보내기" #: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption msgid "FavoriteTabsTestMenu" msgstr "즐겨찾기탭테스트메뉴" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption msgid "Import legacy .tab file(s) according to default setting" msgstr "기본 설정에 따라 legacy.tab 파일을 가져오기" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION" msgid "Import legacy .tab file(s) at selected position" msgstr "선택된 위치에 legacy.tab 파일 가져오기" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption" msgid "Import legacy .tab file(s) at selected position" msgstr "선택된 위치에 legacy.tab 파일 가져오기" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption msgid "Import legacy .tab file(s) at selected position in a sub menu" msgstr "하위 메뉴에 있는 선택된 위치에 legacy.tab 파일 가져오기" #: tfrmoptionsfavoritetabs.miinsertseparator.caption msgid "Insert separator" msgstr "구분자 삽입" #: tfrmoptionsfavoritetabs.miinsertsubmenu.caption msgid "Insert sub-menu" msgstr "하위메뉴 삽입" #: tfrmoptionsfavoritetabs.miopenallbranches.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION" msgid "Open all branches" msgstr "모든 하위 트리 열기" #: tfrmoptionsfavoritetabs.mipasteselection.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION" msgid "Paste" msgstr "붙여넣기" #: tfrmoptionsfavoritetabs.mirename.caption msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION" msgid "Rename" msgstr "이름 바꾸기" #: tfrmoptionsfavoritetabs.miseparator1.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator10.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR10.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator11.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR11.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator3.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR3.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator7.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR7.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator8.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR8.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator9.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR9.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.misorteverything.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTEVERYTHING.CAPTION" msgid "...everything, from A to Z!" msgstr "...A 에서 Z까지 모두!" #: tfrmoptionsfavoritetabs.misortsinglegroup.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP.CAPTION" msgid "...single group of item(s) only" msgstr "...단일 그룹 목록만" #: tfrmoptionsfavoritetabs.misortsinglegroup2.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP2.CAPTION" msgid "Sort single group of item(s) only" msgstr "단일 그룹 목록만 정렬" #: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLESUBMENU.CAPTION" msgid "...content of submenu(s) selected, no sublevel" msgstr "...선택된 하위메뉴 컨텐츠, 하이레벨 없음" #: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSUBMENUANDSUBLEVEL.CAPTION" msgid "...content of submenu(s) selected and all sublevels" msgstr "...선택된 하위 메뉴와 하위 레벨 컨텐츠" #: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption msgctxt "TFRMOPTIONSFAVORITETABS.MITESTRESULTINGFAVORITETABSMENU.CAPTION" msgid "Test resulting menu" msgstr "결과 메뉴 검증" #: tfrmoptionsfileassoc.btnaddact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNADDACT.CAPTION" msgid "Add" msgstr "추가" #: tfrmoptionsfileassoc.btnaddext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION" msgid "&Add" msgstr "추가(&A)" #: tfrmoptionsfileassoc.btnaddnewtype.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION" msgid "A&dd" msgstr "추가(&A)" #: tfrmoptionsfileassoc.btncloneact.caption msgid "Clone" msgstr "복제" #: tfrmoptionsfileassoc.btndownact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNDOWNACT.CAPTION" msgid "&Down" msgstr "아래 방향키(&D)" #: tfrmoptionsfileassoc.btneditext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION" msgid "Edit" msgstr "편집" #: tfrmoptionsfileassoc.btninsertact.caption msgctxt "tfrmoptionsfileassoc.btninsertact.caption" msgid "Insert" msgstr "삽입" #: tfrmoptionsfileassoc.btninsertext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION" msgid "Insert" msgstr "삽입" #: tfrmoptionsfileassoc.btnremoveact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVEACT.CAPTION" msgid "Remo&ve" msgstr "제거(&V)" #: tfrmoptionsfileassoc.btnremoveext.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVEEXT.CAPTION" msgid "Re&move" msgstr "제거(&M)" #: tfrmoptionsfileassoc.btnremovetype.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION" msgid "&Remove" msgstr "제거(&R)" #: tfrmoptionsfileassoc.btnrenametype.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNRENAMETYPE.CAPTION" msgid "R&ename" msgstr "이름 바꾸기(&E)" #: tfrmoptionsfileassoc.btnupact.caption msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION" msgid "&Up" msgstr "위 방향키(&U)" #: tfrmoptionsfileassoc.destartpath.hint msgid "Starting path of the command. Never quote this string." msgstr "명령의 시작경로. 이 문자열 인용 금지." #: tfrmoptionsfileassoc.edbactionname.hint msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you" msgstr "동작명. 시스템에 전달되지 않으며 기억을 위해 본인만 사용함." #: tfrmoptionsfileassoc.edtparams.hint msgid "Parameter to pass to the command. Long filename with spaces should be quoted." msgstr "명령에 넘길 매개변수. 공백이 있는 긴파일명 인용." #: tfrmoptionsfileassoc.fnecommand.hint msgid "Command to execute. Long filename with space should be quoted." msgstr "실행 명령. 공백있는 긴 파일명이 인용되어야 함." #: tfrmoptionsfileassoc.gbactiondescription.caption msgid "Action description:" msgstr "동작 설명:" #: tfrmoptionsfileassoc.gbactions.caption msgctxt "TFRMOPTIONSFILEASSOC.GBACTIONS.CAPTION" msgid "Actions" msgstr "액션" #: tfrmoptionsfileassoc.gbexts.caption msgctxt "TFRMOPTIONSFILEASSOC.GBEXTS.CAPTION" msgid "Extensions" msgstr "확장자" #: tfrmoptionsfileassoc.gbexts.hint msgid "Can be sorted by drag & drop" msgstr "드래그 & 드롭 정렬 가능" #: tfrmoptionsfileassoc.gbfiletypes.caption msgctxt "TFRMOPTIONSFILEASSOC.GBFILETYPES.CAPTION" msgid "File types" msgstr "파일 유형" #: tfrmoptionsfileassoc.gbicon.caption msgctxt "TFRMOPTIONSFILEASSOC.GBICON.CAPTION" msgid "Icon" msgstr "아이콘" #: tfrmoptionsfileassoc.lbactions.hint msgid "Actions may be sorted by drag & drop" msgstr "액션은 드래그 & 드롭으로 정렬 가능" #: tfrmoptionsfileassoc.lbexts.hint msgid "Extensions may be sorted by drag & drop" msgstr "확장자는 드래그 & 드롭으로 정렬 가능" #: tfrmoptionsfileassoc.lbfiletypes.hint msgid "File types may be sorted by drag & drop" msgstr "파일 종류는 드래그 & 드롭으로 정렬 가능" #: tfrmoptionsfileassoc.lblaction.caption msgctxt "TFRMOPTIONSFILEASSOC.LBLACTION.CAPTION" msgid "Action name:" msgstr "동작이름:" #: tfrmoptionsfileassoc.lblcommand.caption msgctxt "TFRMOPTIONSFILEASSOC.LBLCOMMAND.CAPTION" msgid "&Command:" msgstr "명령(&C):" #: tfrmoptionsfileassoc.lblexternalparameters.caption msgctxt "TFRMOPTIONSFILEASSOC.LBLEXTERNALPARAMETERS.CAPTION" msgid "Parameter&s:" msgstr "매개변수(&S):" #: tfrmoptionsfileassoc.lblstartpath.caption msgctxt "TFRMOPTIONSFILEASSOC.LBLSTARTPATH.CAPTION" msgid "Start pat&h:" msgstr "시작 경로(&H):" #: tfrmoptionsfileassoc.menuitem1.caption msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfileassoc.menuitem3.caption msgid "Custom with..." msgstr "사용자 설정..." #: tfrmoptionsfileassoc.micustom.caption msgid "Custom" msgstr "사용자 설정" #: tfrmoptionsfileassoc.miedit.caption msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION" msgid "Edit" msgstr "편집" #: tfrmoptionsfileassoc.mieditor.caption msgctxt "TFRMOPTIONSFILEASSOC.MIEDITOR.CAPTION" msgid "Open in Editor" msgstr "편집기에서 열기" #: tfrmoptionsfileassoc.mieditwith.caption msgid "Edit with..." msgstr "다른 편집기로 열기..." #: tfrmoptionsfileassoc.migetoutputfromcommand.caption msgctxt "TFRMOPTIONSFILEASSOC.MIGETOUTPUTFROMCOMMAND.CAPTION" msgid "Get output from command" msgstr "명령으로부터 결과 받기" #: tfrmoptionsfileassoc.miinternaleditor.caption msgid "Open in Internal Editor" msgstr "내장 편집기로 열기" #: tfrmoptionsfileassoc.miinternalviewer.caption msgid "Open in Internal Viewer" msgstr "내장뷰어로 열기" #: tfrmoptionsfileassoc.miopen.caption msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION" msgid "Open" msgstr "열기" #: tfrmoptionsfileassoc.miopenwith.caption msgid "Open with..." msgstr "다른 프로그램으로 열기..." #: tfrmoptionsfileassoc.miseparator.caption msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmoptionsfileassoc.mishell.caption msgctxt "TFRMOPTIONSFILEASSOC.MISHELL.CAPTION" msgid "Run in terminal" msgstr "명령 프롬프트에서 실행" #: tfrmoptionsfileassoc.miview.caption msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION" msgid "View" msgstr "보기" #: tfrmoptionsfileassoc.miviewer.caption msgctxt "TFRMOPTIONSFILEASSOC.MIVIEWER.CAPTION" msgid "Open in Viewer" msgstr "뷰어로 열기" #: tfrmoptionsfileassoc.miviewwith.caption msgid "View with..." msgstr "다른 뷰어로 보기..." #: tfrmoptionsfileassoc.sbtnicon.hint msgid "Click me to change icon!" msgstr "아이콘 변경하려면 클릭!" #: tfrmoptionsfileassocextra.cbexecuteviashell.caption msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXECUTEVIASHELL.CAPTION" msgid "Execute via shell" msgstr "쉘 명령으로 실행" #: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption msgid "Extended context menu" msgstr "확장 메뉴" #: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption msgid "File association configuration" msgstr "파일 연결 환경설정" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption msgid "Offer to add selection to file association when not included already" msgstr "파일 연결 없으면 선택된 파일 추가" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint" msgid "When accessing file association, offer to add current selected file if not already included in a configured file type" msgstr "파일 연결 작성할 때 현재 파일 형식 없으면 추가" #: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBOPENSYSTEMWITHTERMINALCLOSE.CAPTION" msgid "Execute via terminal and close" msgstr "명령 프롬프트에서 실행하고 닫기" #: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBOPENSYSTEMWITHTERMINALSTAYOPEN.CAPTION" msgid "Execute via terminal and stay open" msgstr "명령 프롬프트에서 실행하고 창 열어두기" #: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption msgid "Extended options items:" msgstr "목록 확장 옵션:" #: tfrmoptionsfileoperations.bvlconfirmations.caption msgctxt "TFRMOPTIONSFILEOPERATIONS.BVLCONFIRMATIONS.CAPTION" msgid "Show confirmation window for:" msgstr "확인창 보이기:" #: tfrmoptionsfileoperations.cbcopyconfirmation.caption msgid "Cop&y operation" msgstr "복사 작업(&Y)" #: tfrmoptionsfileoperations.cbdeleteconfirmation.caption msgid "&Delete operation" msgstr "삭제 연산(&D)" #: tfrmoptionsfileoperations.cbdeletetotrash.caption msgid "Dele&te to recycle bin (Shift key reverses this setting)" msgstr "휴지통으로 삭제(Shift 키 누르면 바로 삭제)(&T)" #: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption msgid "D&elete to trash operation" msgstr "휴지통으로 삭제(&E)" #: tfrmoptionsfileoperations.cbdropreadonlyflag.caption msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION" msgid "D&rop readonly flag" msgstr "읽기 전용 지정(&R)" #: tfrmoptionsfileoperations.cbmoveconfirmation.caption msgid "&Move operation" msgstr "파일 이동 연산(&M)" #: tfrmoptionsfileoperations.cbprocesscomments.caption msgid "&Process comments with files/folders" msgstr "파일/폴더에 프로세스 코멘트(&P)" #: tfrmoptionsfileoperations.cbrenameselonlyname.caption msgid "Select &file name without extension when renaming" msgstr "파일명 바꿀 때 확장자가 없는 파일 선택(&F)" #: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption msgid "Sho&w tab select panel in copy/move dialog" msgstr "복사/이동 대화상자에 선택된 탭 표시(&W)" #: tfrmoptionsfileoperations.cbskipfileoperror.caption msgid "S&kip file operations errors and write them to log window" msgstr "파일 작업 에러 건너뛰고 로그 파일에 저장하기(&K)" #: tfrmoptionsfileoperations.gbexecutingoperations.caption msgid "Executing operations" msgstr "작업 실행" #: tfrmoptionsfileoperations.gbuserinterface.caption msgid "User interface" msgstr "사용자 인터페이스" #: tfrmoptionsfileoperations.lblbuffersize.caption msgid "&Buffer size for file operations (in KB):" msgstr "파일 작업 버퍼 크기 (KB단위)(&B):" #: tfrmoptionsfileoperations.lblhashbuffersize.caption msgid "Buffer size for &hash calculation (in KB):" msgstr "해시 계산 버퍼 크기 (KB단위)(&H):" #: tfrmoptionsfileoperations.lblprogresskind.caption msgid "Show operations progress &initially in" msgstr "작업 프로세스 시작 지점 표시(&I)" #: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLTYPEOFDUPLICATEDRENAME.CAPTION" msgid "Duplicated name auto-rename style:" msgstr "파일명 복제 자동 이름 바꾸기 스타일:" #: tfrmoptionsfileoperations.lblwipepassnumber.caption msgid "&Number of wipe passes:" msgstr "삭제한 숫자(&N):" #: tfrmoptionsfilepanelscolors.btnbackcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnbackcolor2.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursortext.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnforecolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnindbackcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnindcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnmarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption msgid "Reset to DC default" msgstr "DC 기본값으로 재설정" #: tfrmoptionsfilepanelscolors.cballowovercolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION" msgid "Allow Overcolor" msgstr "색변경 허용" #: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption msgid "Use &Frame Cursor" msgstr "프레임 커서 사용(&F)" #: tfrmoptionsfilepanelscolors.cbbusegradientind.caption msgid "Use &Gradient Indicator" msgstr "그라이언트 표시 사용(&G)" #: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption msgid "Use Inactive Sel Color" msgstr "비활성 선택색 사용" #: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption msgid "U&se Inverted Selection" msgstr "반전 선택 사용(&S)" #: tfrmoptionsfilepanelscolors.cbusecursorborder.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION" msgid "Cursor border" msgstr "커서 경계선" #: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION" msgid "Drive Free Space Indicator" msgstr "드라이브 여유 공간 표시" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption msgid "Bac&kground:" msgstr "배경(&K):" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION" msgid "Backg&round 2:" msgstr "배경2(&R):" #: tfrmoptionsfilepanelscolors.lblcursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION" msgid "C&ursor Color:" msgstr "커서 색상(&U):" #: tfrmoptionsfilepanelscolors.lblcursortext.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION" msgid "Cursor Te&xt:" msgstr "커서 문자(&X):" #: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION" msgid "Inactive Cursor Color:" msgstr "비활성 커서 색상:" #: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION" msgid "Inactive Mark Color:" msgstr "비활성 마크 색상:" #: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption msgid "&Brightness level of inactive panel" msgstr "비활성 창의 밝기 레벨(&B)" #: tfrmoptionsfilepanelscolors.lblindbackcolor.caption msgid "In&dicator Back Color:" msgstr "배경색 표시기(&D):" #: tfrmoptionsfilepanelscolors.lblindcolor.caption msgid "&Indicator Fore Color:" msgstr "전경색 표시기(&I):" #: tfrmoptionsfilepanelscolors.lblmarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION" msgid "&Mark Color:" msgstr "마크 색상(&M):" #: tfrmoptionsfilepanelscolors.lblpreview.caption msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings." msgstr "아래는 미리보기임. 커서를 움직여서 실제 적용을 바로 확인." #: tfrmoptionsfilepanelscolors.lbltextcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION" msgid "T&ext Color:" msgstr "텍스트 색상(&E):" #: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption msgid "When launching file search, clear file mask filter" msgstr "" #: tfrmoptionsfilesearch.cbpartialnamesearch.caption #, fuzzy msgctxt "tfrmoptionsfilesearch.cbpartialnamesearch.caption" msgid "&Search for part of file name" msgstr "파일명 일부에서 검색(&S)" #: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption msgid "Show menu bar in \"Find files\"" msgstr "" #: tfrmoptionsfilesearch.dbtextsearch.caption #, fuzzy msgctxt "tfrmoptionsfilesearch.dbtextsearch.caption" msgid "Text search in files" msgstr "파일에서 텍스트 검색" #: tfrmoptionsfilesearch.gbfilesearch.caption #, fuzzy msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption" msgid "File search" msgstr "파일 검색" #: tfrmoptionsfilesearch.lblnewsearchfilters.caption msgid "Current filters with \"New search\" button:" msgstr "" #: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption #, fuzzy msgctxt "tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption" msgid "Default search template:" msgstr "기본 검색 템플릿:" #: tfrmoptionsfilesearch.rbusemmapinsearch.caption #, fuzzy msgctxt "tfrmoptionsfilesearch.rbusemmapinsearch.caption" msgid "Use memory mapping for search te&xt in files" msgstr "파일 텍스트 검색을 위해 메모리 매핑 사용(&X)" #: tfrmoptionsfilesearch.rbusestreaminsearch.caption #, fuzzy msgctxt "tfrmoptionsfilesearch.rbusestreaminsearch.caption" msgid "&Use stream for search text in files" msgstr "파일 텍스트 검색을 위해 스트림 사용(&U)" #: tfrmoptionsfilesviews.btnaddattribute.caption #, fuzzy msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption" msgid "&Add" msgstr "더하기(&A)" #: tfrmoptionsfilesviews.btnattrshelp.caption #, fuzzy msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption" msgid "&Help" msgstr "도움말(&H)" #: tfrmoptionsfilesviews.cbdblclicktoparent.caption msgid "Enable changing to &parent folder when double-clicking on empty part of file view" msgstr "" #: tfrmoptionsfilesviews.cbdelayloadingtabs.caption msgid "Do&n't load file list until a tab is activated" msgstr "탭이 활성화될 때까지 파일 목록 로드안 함(&N)" #: tfrmoptionsfilesviews.cbdirbrackets.caption msgid "S&how square brackets around directories" msgstr "폴더 주변에 사각형틀 표시(&H)" #: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption msgid "Hi&ghlight new and updated files" msgstr "변경 업데이트된 파일 하이라이트(&G)" #: tfrmoptionsfilesviews.cbinplacerename.caption msgid "Enable inplace &renaming when clicking twice on a name" msgstr "파일명 더블클릭 후 이름 바꾸기(&R)" #: tfrmoptionsfilesviews.cblistfilesinthread.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION" msgid "Load &file list in separate thread" msgstr "구분된 쓰레드에 파일 목록 리스트 불러오기(&F)" #: tfrmoptionsfilesviews.cbloadiconsseparately.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION" msgid "Load icons af&ter file list" msgstr "파일 목록 뒤에 아이콘 불어오기(&T)" #: tfrmoptionsfilesviews.cbshowsystemfiles.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION" msgid "Show s&ystem and hidden files" msgstr "시스템, 숨김파일 표시(&Y)" #: tfrmoptionsfilesviews.cbspacemovesdown.caption msgid "&When selecting files with , move down to next file (as with )" msgstr "<스페이스바>로 선택시 (Insert 키 사용처럼) 다음 파일 아래로 이동(&W)" #: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)" msgstr "" #: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption msgid "Use an independent attribute filter in mask input dialog each time" msgstr "" #: tfrmoptionsfilesviews.gbformatting.caption msgid "Formatting" msgstr "형식화(Formatting)" #: tfrmoptionsfilesviews.gbmarking.caption msgid "Marking/Unmarking entries" msgstr "" #: tfrmoptionsfilesviews.gbsorting.caption msgid "Sorting" msgstr "정렬" #: tfrmoptionsfilesviews.lbattributemask.caption msgid "Default attribute mask value to use:" msgstr "" #: tfrmoptionsfilesviews.lblcasesensitivity.caption msgid "Case s&ensitivity:" msgstr "대소문자 구별(&E):" #: tfrmoptionsfilesviews.lbldatetimeexample.caption msgid "Incorrect format" msgstr "잘못된 형식" #: tfrmoptionsfilesviews.lbldatetimeformat.caption msgid "&Date and time format:" msgstr "날짜 시간 형식(&D):" #: tfrmoptionsfilesviews.lblfilesizeformat.caption msgid "File si&ze format:" msgstr "파일 크기 형식(&Z):" #: tfrmoptionsfilesviews.lblnewfilesposition.caption #, fuzzy #| msgid "&Insert new files" msgid "&Insert new files:" msgstr "새 파일 삽입(&I)" #: tfrmoptionsfilesviews.lblsortfoldermode.caption msgid "So&rting directories:" msgstr "폴더 정렬(&R):" #: tfrmoptionsfilesviews.lblsortmethod.caption msgid "&Sort method:" msgstr "메소드 정렬(&S):" #: tfrmoptionsfilesviews.lblupdatedfilesposition.caption #, fuzzy #| msgid "&Move updated files" msgid "&Move updated files:" msgstr "업데이트 파일 이동(&M)" #: tfrmoptionsfiletypescolors.btnaddcategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION" msgid "A&dd" msgstr "추가(&D)" #: tfrmoptionsfiletypescolors.btnapplycategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION" msgid "A&pply" msgstr "적용(&P)" #: tfrmoptionsfiletypescolors.btncategorycolor.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfiletypescolors.btndeletecategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION" msgid "D&elete" msgstr "삭제(&D)" #: tfrmoptionsfiletypescolors.btnsearchtemplate.hint msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT" msgid "Template..." msgstr "템플릿..." #: tfrmoptionsfiletypescolors.gbfiletypescolors.caption msgid "File types colors (sort by drag&&drop)" msgstr "파일형태별 색상 (드래그 && 드롭 정렬)" #: tfrmoptionsfiletypescolors.lblcategoryattr.caption msgid "Category a&ttributes:" msgstr "범주 속성(&T):" #: tfrmoptionsfiletypescolors.lblcategorycolor.caption msgid "Category co&lor:" msgstr "범주 색상(&L):" #: tfrmoptionsfiletypescolors.lblcategorymask.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION" msgid "Category &mask:" msgstr "범주 마스크(&M):" #: tfrmoptionsfiletypescolors.lblcategoryname.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION" msgid "Category &name:" msgstr "범주명(&N):" #: tfrmoptionsfonts.btnpatheditfnt.caption #, fuzzy msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnsearchresultsfnt.caption #, fuzzy msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselconsolefnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnseleditfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnsellogfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselmainfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselviewerbookfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselviewfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.lblconsolefont.caption msgid "&Console font" msgstr "콘솔 글꼴(&C)" #: tfrmoptionsfonts.lbleditorfont.caption msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION" msgid "&Editor font" msgstr "편집기 글꼴(&E)" #: tfrmoptionsfonts.lbllogfont.caption msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION" msgid "&Log font" msgstr "로그 글꼴(&L)" #: tfrmoptionsfonts.lblmainfont.caption msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION" msgid "Main &font" msgstr "주 글꼴(&F)" #: tfrmoptionsfonts.lblpatheditfont.caption msgid "Path font" msgstr "" #: tfrmoptionsfonts.lblsearchresultsfont.caption msgid "Search results font" msgstr "" #: tfrmoptionsfonts.lblviewerbookfont.caption msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION" msgid "Viewer&Book Font" msgstr "뷰어책 글꼴(&B)" #: tfrmoptionsfonts.lblviewerfont.caption msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION" msgid "&Viewer font" msgstr "뷰어 글꼴(&V)" #: tfrmoptionshotkeys.actaddhotkey.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actaddhotkey.caption" msgid "Add &hotkey" msgstr "바로 가기 추가(&H)" #: tfrmoptionshotkeys.actcopy.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actcopy.caption" msgid "Copy" msgstr "복사" #: tfrmoptionshotkeys.actdelete.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actdelete.caption" msgid "Delete" msgstr "삭제" #: tfrmoptionshotkeys.actdeletehotkey.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption" msgid "&Delete hotkey" msgstr "바로 가기 삭제(&D)" #: tfrmoptionshotkeys.actedithotkey.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actedithotkey.caption" msgid "&Edit hotkey" msgstr "바로 가기 편집(&E)" #: tfrmoptionshotkeys.actnextcategory.caption msgid "Next category" msgstr "" #: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption msgid "Make popup the file related menu" msgstr "" #: tfrmoptionshotkeys.actpreviouscategory.caption msgid "Previous category" msgstr "" #: tfrmoptionshotkeys.actrename.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actrename.caption" msgid "Rename" msgstr "이름 바꾸기" #: tfrmoptionshotkeys.actrestoredefault.caption msgid "Restore DC default" msgstr "" #: tfrmoptionshotkeys.actsavenow.caption msgid "Save now" msgstr "" #: tfrmoptionshotkeys.actsortbycommand.caption msgid "Sort by command name" msgstr "" #: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption msgid "Sort by hotkeys (grouped)" msgstr "" #: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption msgid "Sort by hotkeys (one per row)" msgstr "" #: tfrmoptionshotkeys.lbfilter.caption msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION" msgid "&Filter" msgstr "필터(&F)" #: tfrmoptionshotkeys.lblcategories.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION" msgid "C&ategories:" msgstr "범주(&A):" #: tfrmoptionshotkeys.lblcommands.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION" msgid "Co&mmands:" msgstr "명령(&M):" #: tfrmoptionshotkeys.lblscfiles.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION" msgid "&Shortcut files:" msgstr "단축키 파일(&S):" #: tfrmoptionshotkeys.lblsortorder.caption msgid "So&rt order:" msgstr "" #: tfrmoptionshotkeys.micategories.caption msgid "Categories" msgstr "" #: tfrmoptionshotkeys.micommands.caption #, fuzzy msgctxt "tfrmoptionshotkeys.micommands.caption" msgid "Command" msgstr "명령어" #: tfrmoptionshotkeys.miseparator1.caption #, fuzzy msgctxt "tfrmoptionshotkeys.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionshotkeys.misortorder.caption msgid "Sort order" msgstr "" #: tfrmoptionsicons.cbiconsexclude.caption msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION" msgid "For the following &paths and their subdirectories:" msgstr "경로와 그 하위 폴더(&P):" #: tfrmoptionsicons.cbiconsinmenus.caption msgid "Show icons for actions in &menus" msgstr "메뉴 동작 아이콘 표시(&M)" #: tfrmoptionsicons.cbiconsinmenussize.text msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT" msgid "16x16" msgstr "16x16" #: tfrmoptionsicons.cbiconsonbuttons.caption msgid "Show icons on buttons" msgstr "" #: tfrmoptionsicons.cbiconsshowoverlay.caption msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION" msgid "Show o&verlay icons, e.g. for links" msgstr "오버레이 아이콘 표시(예, 링크)(&V)" #: tfrmoptionsicons.chkshowhiddendimmed.caption msgid "&Dimmed hidden files (slower)" msgstr "" #: tfrmoptionsicons.gbdisablespecialicons.caption msgid "Disable special icons" msgstr "특별 아이콘 사용안함" #: tfrmoptionsicons.gbiconssize.caption msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION" msgid " Icon size " msgstr "아이콘 크기" #: tfrmoptionsicons.gbicontheme.caption msgid "Icon theme" msgstr "" #: tfrmoptionsicons.gbshowicons.caption msgid "Show icons" msgstr "" #: tfrmoptionsicons.gbshowiconsmode.caption msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION" msgid " Show icons to the left of the filename " msgstr "파일명 왼쪽에 아이콘 표시하기" #: tfrmoptionsicons.lbldiskpanel.caption msgid "Disk panel:" msgstr "" #: tfrmoptionsicons.lblfilepanel.caption msgid "File panel:" msgstr "" #: tfrmoptionsicons.rbiconsshowall.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION" msgid "A&ll" msgstr "모두(&L)" #: tfrmoptionsicons.rbiconsshowallandexe.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION" msgid "All associated + &EXE/LNK (slow)" msgstr "모든 관계된 + EXE/LNK(천천히)(&E)" #: tfrmoptionsicons.rbiconsshownone.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION" msgid "&No icons" msgstr "아이콘 없음(&N)" #: tfrmoptionsicons.rbiconsshowstandard.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION" msgid "Only &standard icons" msgstr "기본 아이콘만(&S)" #: tfrmoptionsignorelist.btnaddsel.caption msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION" msgid "A&dd selected names" msgstr "선택된 파일명 추가(&D)" #: tfrmoptionsignorelist.btnaddselwithpath.caption msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION" msgid "Add selected names with &full path" msgstr "전체 경로 포함 파일명 추가(&F)" #: tfrmoptionsignorelist.btnrelativesavein.hint msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT" msgid "Some functions to select appropriate path" msgstr "적절한 경로 선택을 위한 기능" #: tfrmoptionsignorelist.chkignoreenable.caption msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION" msgid "&Ignore (don't show) the following files and folders:" msgstr "다음 파일과 폴더 무시(표시 안 함)(&I):" #: tfrmoptionsignorelist.lblsavein.caption msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION" msgid "&Save in:" msgstr "지정 장소에 저장(&S):" #: tfrmoptionskeyboard.cblynxlike.caption msgid "Le&ft, Right arrows change directory (Lynx-like movement)" msgstr "왼쪽, 오른쪽 화살표로 폴더 변경(리눅스처럼)(&F)" #: tfrmoptionskeyboard.gbtyping.caption msgid "Typing" msgstr "타이핑" #: tfrmoptionskeyboard.lblalt.caption #, fuzzy #| msgid "Alt+L&etters" msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION" msgid "Alt+L&etters:" msgstr "Alt+문자(&E)" #: tfrmoptionskeyboard.lblctrlalt.caption #, fuzzy #| msgid "Ctrl+Alt+Le&tters" msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION" msgid "Ctrl+Alt+Le&tters:" msgstr "Ctrl+Alt+문자(&T)" #: tfrmoptionskeyboard.lblnomodifier.caption #, fuzzy #| msgid "&Letters" msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION" msgid "&Letters:" msgstr "문자(&L)" #: tfrmoptionslayout.cbflatdiskpanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION" msgid "&Flat buttons" msgstr "단순 버튼(&F)" #: tfrmoptionslayout.cbflatinterface.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION" msgid "Flat i&nterface" msgstr "단순 인터페이스(&N)" #: tfrmoptionslayout.cbflattoolbar.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION" msgid "Flat b&uttons" msgstr "단순 버튼(&U)" #: tfrmoptionslayout.cbfreespaceind.caption msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION" msgid "Show fr&ee space indicator on drive label" msgstr "드라이브명에 저장 여유 공간 표시(&E)" #: tfrmoptionslayout.cblogwindow.caption msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION" msgid "Show lo&g window" msgstr "로그 윈도 표시(&G)" #: tfrmoptionslayout.cbpanelofoperations.caption msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION" msgid "Show panel of operation in background" msgstr "백그라운드에 작업수행 표시" #: tfrmoptionslayout.cbproginmenubar.caption msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION" msgid "Show common progress in menu bar" msgstr "메뉴바에 진행상태 표시" #: tfrmoptionslayout.cbshowcmdline.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION" msgid "Show command l&ine" msgstr "명령줄 표시(&I)" #: tfrmoptionslayout.cbshowcurdir.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION" msgid "Show current director&y" msgstr "현재 폴더 표시(&Y)" #: tfrmoptionslayout.cbshowdiskpanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION" msgid "Show &drive buttons" msgstr "드라이브 버튼 표시(&D)" #: tfrmoptionslayout.cbshowdrivefreespace.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION" msgid "Show free s&pace label" msgstr "저장 여유 공간 표시(&P)" #: tfrmoptionslayout.cbshowdriveslistbutton.caption msgid "Show drives list bu&tton" msgstr "드라이브 목록 버튼 표시(&T)" #: tfrmoptionslayout.cbshowkeyspanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION" msgid "Show function &key buttons" msgstr "기능키(F키) 버튼 표시(&K)" #: tfrmoptionslayout.cbshowmainmenu.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION" msgid "Show &main menu" msgstr "주요 메뉴 표시(&M)" #: tfrmoptionslayout.cbshowmaintoolbar.caption #, fuzzy #| msgid "Show &button bar" msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION" msgid "Show tool&bar" msgstr "버튼 바 표시(&B)" #: tfrmoptionslayout.cbshowshortdrivefreespace.caption msgid "Show short free space &label" msgstr "저장 여유공간 드라이브명 짧게 표시(&L)" #: tfrmoptionslayout.cbshowstatusbar.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION" msgid "Show &status bar" msgstr "상태바 표시(&S)" #: tfrmoptionslayout.cbshowtabheader.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION" msgid "S&how tabstop header" msgstr "탭위치 헤더 표시(&H)" #: tfrmoptionslayout.cbshowtabs.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION" msgid "Sho&w folder tabs" msgstr "폴더탭 표시(&W)" #: tfrmoptionslayout.cbtermwindow.caption msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION" msgid "Show te&rminal window" msgstr "명령 프롬프트창 표시(&R)" #: tfrmoptionslayout.cbtwodiskpanels.caption msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION" msgid "Show two drive button bars (fi&xed width, above file windows)" msgstr "(파일창위에 고정폭으로)두 개의 버튼 바 표시(&X)" #: tfrmoptionslayout.gbscreenlayout.caption msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION" msgid " Screen layout " msgstr "화면구성" #: tfrmoptionslog.btnrelativelogfile.hint msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT" msgid "Some functions to select appropriate path" msgstr "적절한 경로 선택을 위한 기능" #: tfrmoptionslog.btnviewlogfile.hint msgctxt "tfrmoptionslog.btnviewlogfile.hint" msgid "View log file content" msgstr "로그 파일 내용 보기" #: tfrmoptionslog.cbincludedateinlogfilename.caption msgid "Include date in log filename" msgstr "로그 파일명에 날짜 포함" #: tfrmoptionslog.cblogarcop.caption msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION" msgid "&Pack/Unpack" msgstr "압축/압축해제(&P)" #: tfrmoptionslog.cblogcommandlineexecution.caption msgid "External command line execution" msgstr "외부 명령줄 실행" #: tfrmoptionslog.cblogcpmvln.caption msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION" msgid "Cop&y/Move/Create link/symlink" msgstr "복사/이동/생성 링크/심링크(&Y)" #: tfrmoptionslog.cblogdelete.caption msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION" msgid "&Delete" msgstr "삭제(&D)" #: tfrmoptionslog.cblogdirop.caption msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION" msgid "Crea&te/Delete directories" msgstr "생성/삭제 폴더(&T)" #: tfrmoptionslog.cblogerrors.caption msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION" msgid "Log &errors" msgstr "에러 로그(&E)" #: tfrmoptionslog.cblogfile.caption msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION" msgid "C&reate a log file:" msgstr "로그파일 생성(&R):" #: tfrmoptionslog.cbloginfo.caption msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION" msgid "Log &information messages" msgstr "로그 정보 메시지(&I)" #: tfrmoptionslog.cblogstartshutdown.caption msgid "Start/shutdown" msgstr "시작/종료" #: tfrmoptionslog.cblogsuccess.caption msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION" msgid "Log &successful operations" msgstr "작업 성공 로그(&S)" #: tfrmoptionslog.cblogvfs.caption msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION" msgid "&File system plugins" msgstr "파일 시스템 플러그인(&F)" #: tfrmoptionslog.gblogfile.caption msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION" msgid "File operation log file" msgstr "파일 작업 로그 파일" #: tfrmoptionslog.gblogfileop.caption msgid "Log operations" msgstr "로그 작업" #: tfrmoptionslog.gblogfilestatus.caption msgid "Operation status" msgstr "작업 상태" #: tfrmoptionsmisc.btnoutputpathfortoolbar.caption msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT" msgid "Some functions to select appropriate path" msgstr "적절한 경로 선택을 위한 기능" #: tfrmoptionsmisc.btnrelativetcconfigfile.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT" msgid "Some functions to select appropriate path" msgstr "적절한 경로 선택을 위한 기능" #: tfrmoptionsmisc.btnrelativetcexecutablefile.hint msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT" msgid "Some functions to select appropriate path" msgstr "적절한 경로 선택을 위한 기능" #: tfrmoptionsmisc.btnthumbcompactcache.caption msgid "&Remove thumbnails for no longer existing files" msgstr "더 이상 존재하지 않는 파일 썸네일 제거(&R)" #: tfrmoptionsmisc.btnviewconfigfile.hint msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT" msgid "View log file content" msgstr "로그 파일 내용 보기" #: tfrmoptionsmisc.chkdesccreateunicode.caption msgid "Create new with the encoding:" msgstr "" #: tfrmoptionsmisc.chkgotoroot.caption msgid "Always &go to the root of a drive when changing drives" msgstr "드라이브 변경시 항상 최상위로 가기(&G)" #: tfrmoptionsmisc.chkshowwarningmessages.caption msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION" msgid "Show &warning messages (\"OK\" button only)" msgstr "경고 메시지 표시(\"확인\"버튼만) (&W)" #: tfrmoptionsmisc.chkthumbsave.caption msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION" msgid "&Save thumbnails in cache" msgstr "캐시에 썸네일 저장(&S)" #: tfrmoptionsmisc.dblthumbnails.caption msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION" msgid "Thumbnails" msgstr "썸네일" #: tfrmoptionsmisc.gbfilecomments.caption msgid "File comments (descript.ion)" msgstr "" #: tfrmoptionsmisc.gbtcexportimport.caption msgid "Regarding TC export/import:" msgstr "TC(토탈 커맨더) 내보내기/가져오기 기능 관련:" #: tfrmoptionsmisc.lbldescrdefaultencoding.caption msgid "Default encoding:" msgstr "" #: tfrmoptionsmisc.lbltcconfig.caption msgid "Configuration file:" msgstr "환경설정 파일:" #: tfrmoptionsmisc.lbltcexecutable.caption msgid "TC executable:" msgstr "TC(토탈 커맨더) 실행:" #: tfrmoptionsmisc.lbltcpathfortool.caption msgid "Toolbar output path:" msgstr "도구상자 내보내기 경로:" #: tfrmoptionsmisc.lblthumbpixels.caption msgid "pixels" msgstr "픽셀" #: tfrmoptionsmisc.lblthumbseparator.caption msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION" msgid "X" msgstr "X" #: tfrmoptionsmisc.lblthumbsize.caption msgid "&Thumbnail size:" msgstr "썸네일 크기(&T):" #: tfrmoptionsmouse.cbselectionbymouse.caption msgid "&Selection by mouse" msgstr "마우스로 선택(&S)" #: tfrmoptionsmouse.chkmouseselectioniconclick.caption msgid "By clic&king on icon" msgstr "" #: tfrmoptionsmouse.gbscrolling.caption msgid "Scrolling" msgstr "스크롤" #: tfrmoptionsmouse.gbselection.caption msgid "Selection" msgstr "선택" #: tfrmoptionsmouse.lblmousemode.caption msgid "&Mode:" msgstr "모드(&M):" #: tfrmoptionsmouse.rbscrolllinebyline.caption msgid "&Line by line" msgstr "한줄씩(&L)" #: tfrmoptionsmouse.rbscrolllinebylinecursor.caption msgid "Line by line &with cursor movement" msgstr "커서 동작과 함께 한줄씩(&W)" #: tfrmoptionsmouse.rbscrollpagebypage.caption msgid "&Page by page" msgstr "한 페이지씩(&P)" #: tfrmoptionsplugins.btnaddplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION" msgid "A&dd" msgstr "추가(&D)" #: tfrmoptionsplugins.btnconfigplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION" msgid "Con&figure" msgstr "환경설정(&F)" #: tfrmoptionsplugins.btnenableplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION" msgid "E&nable" msgstr "가능(&N)" #: tfrmoptionsplugins.btnremoveplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION" msgid "&Remove" msgstr "제거(&R)" #: tfrmoptionsplugins.btntweakplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION" msgid "&Tweak" msgstr "조정(&T)" #: tfrmoptionsplugins.lbldsxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION" msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)" msgstr "다른 검색 알고리듬 또는 외부프로그램(예,\"locate\"처럼) 검색 플러그인 허용(&H)" #: tfrmoptionsplugins.lblwcxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION" msgid "Pack&er plugins are used to work with archives" msgstr "압축파일에 외부 압축 플러그인 사용(&E)" #: tfrmoptionsplugins.lblwdxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION" msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool" msgstr "Mp3태그나 이미지 속성 표시, 검색, 파일명 변경도구 플러그인 허용(&G)" #: tfrmoptionsplugins.lblwfxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION" msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC." msgstr "다른 운영체제나 팜(Palm)/포켓PC(PocketPC)처럼 외부 디바이스 파일에 접근할 수 있는 플러그인 허용(&L)" #: tfrmoptionsplugins.lblwlxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION" msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)" msgstr "이미지, 스프레드 시트, 데이타베이스 &뷰어 플러그인 허용(F3, Ctrl+Q)(&W)" #: tfrmoptionsplugins.stgplugins.columns[0].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION" msgid "Active" msgstr "활성" #: tfrmoptionsplugins.stgplugins.columns[1].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION" msgid "Plugin" msgstr "플러그인" #: tfrmoptionsplugins.stgplugins.columns[2].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION" msgid "Registered for" msgstr "등록" #: tfrmoptionsplugins.stgplugins.columns[3].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION" msgid "File name" msgstr "파일명" #: tfrmoptionsplugins.tsdsx.caption msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION" msgid "&Search plugins (.DSX)" msgstr "검색 플러그인(.DSX)(&S)" #: tfrmoptionsplugins.tswcx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION" msgid "Pac&ker plugins (.WCX)" msgstr "압축 플러그인(.WCX)(&K)" #: tfrmoptionsplugins.tswdx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION" msgid "Content pl&ugins (.WDX)" msgstr "컨텐츠 플러그인(.WDX)(&U)" #: tfrmoptionsplugins.tswfx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION" msgid "F&ile system plugins (.WFX)" msgstr "파일 시스템 플러그인(.WFX)(&I)" #: tfrmoptionsplugins.tswlx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION" msgid "&Viewer plugins (.WLX)" msgstr "뷰어 플러그인(.WLX)(&V)" #: tfrmoptionsquicksearchfilter.cbexactbeginning.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION" msgid "&Beginning (name must start with first typed character)" msgstr "첫 문자(입력한 첫글자로 반드시 시작되는 파일명)(&B)" #: tfrmoptionsquicksearchfilter.cbexactending.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION" msgid "En&ding (last character before a typed dot . must match)" msgstr "끝 문자(점(.)앞에 입력한 마지막 글자 일치)(&D)" #: tfrmoptionsquicksearchfilter.cgpoptions.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION" msgid "Options" msgstr "옵션" #: tfrmoptionsquicksearchfilter.gbexactnamematch.caption msgid "Exact name match" msgstr "일치된 파일명" #: tfrmoptionsquicksearchfilter.rgpsearchcase.caption msgid "Search case" msgstr "검색조건" #: tfrmoptionsquicksearchfilter.rgpsearchitems.caption msgid "Search for these items" msgstr "목록 검색" #: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption msgid "Keep renamed name when unlocking a tab" msgstr "탭 잠금이 해제될 때 바꾼뀐 파일명 유지" #: tfrmoptionstabs.cbtabsactivateonclick.caption msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION" msgid "Activate target &panel when clicking on one of its Tabs" msgstr "탭 클릭시 대상 창 활성화(&P)" #: tfrmoptionstabs.cbtabsalwaysvisible.caption msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION" msgid "&Show tab header also when there is only one tab" msgstr "한개의 탭이 있을 때 탭 헤더 표시(&S)" #: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption msgid "Close duplicate tabs when closing application" msgstr "프로그램 종료시 복제한 탭 닫기" #: tfrmoptionstabs.cbtabsconfirmcloseall.caption msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION" msgid "Con&firm close all tabs" msgstr "모든 탭 닫기 확인(&F)" #: tfrmoptionstabs.cbtabsconfirmcloselocked.caption msgid "Confirm close locked tabs" msgstr "잠긴 탭 닫기 확인" #: tfrmoptionstabs.cbtabslimitoption.caption msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION" msgid "&Limit tab title length to" msgstr "탭 이름 길이 제한(&L)" #: tfrmoptionstabs.cbtabslockedasterisk.caption msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION" msgid "Show locked tabs &with an asterisk *" msgstr "잠금탭에 * 표시(&W)" #: tfrmoptionstabs.cbtabsmultilines.caption msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION" msgid "&Tabs on multiple lines" msgstr "여러 줄의 탭(&T)" #: tfrmoptionstabs.cbtabsopenforeground.caption msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION" msgid "Ctrl+&Up opens new tab in foreground" msgstr "Ctrl+위 방향키 새탭을 열기(&U)" #: tfrmoptionstabs.cbtabsopennearcurrent.caption msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION" msgid "Open &new tabs near current tab" msgstr "현재탭 옆에 새 탭 열기(&N)" #: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption msgid "Reuse existing tab when possible" msgstr "가능할 경우 존재하는 탭 재사용" #: tfrmoptionstabs.cbtabsshowclosebutton.caption msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION" msgid "Show ta&b close button" msgstr "탭 닫기 버튼 표시(&B)" #: tfrmoptionstabs.cbtabsshowdriveletter.caption msgid "Always show drive letter in tab title" msgstr "탭 타이틀에 드라이브명 항상 표시" #: tfrmoptionstabs.gbtabs.caption msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION" msgid "Folder tabs headers" msgstr "폴더 탭 헤더" #: tfrmoptionstabs.lblchar.caption msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION" msgid "characters" msgstr "문자" #: tfrmoptionstabs.lbltabsactionondoubleclick.caption msgid "Action to do when double click on a tab:" msgstr "탭을 더블클릭 했을 때 동작:" #: tfrmoptionstabs.lbltabsposition.caption msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION" msgid "Ta&bs position" msgstr "탭 위치(&B)" #: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTEXISTINGTABSTOKEEP.TEXT" msgid "None" msgstr "없음" #: tfrmoptionstabsextra.cbdefaultsavedirhistory.text msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTSAVEDIRHISTORY.TEXT" msgid "No" msgstr "No" #: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELLEFTSAVED.TEXT" msgid "Left" msgstr "왼쪽 화살표 키" #: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELRIGHTSAVED.TEXT" msgid "Right" msgstr "오른쪽 화살표 키" #: tfrmoptionstabsextra.cbgotoconfigafterresave.caption msgid "Goto to Favorite Tabs Configuration after resaving" msgstr "재 저장이후 즐겨찾기탭 환경설정으로 가기" #: tfrmoptionstabsextra.cbgotoconfigaftersave.caption msgid "Goto to Favorite Tabs Configuration after saving a new one" msgstr "새 파일로 저장 후 즐겨찾기탭 환경설정으로 가기" #: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)" msgstr "즐겨찾기 탭 기타 옵션 허용(예, 복구시 대상 탭 옆 선정 등)" #: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption msgid "Default extra settings when saving new Favorite Tabs:" msgstr "새 즐겨찾기탭 저장시 기타옵션 기본으로 설정:" #: tfrmoptionstabsextra.gbtabs.caption msgid "Folder tabs headers extra" msgstr "폴더 탭 헤더 기타설정" #: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption msgid "When restoring tab, existing tabs to keep:" msgstr "탭 복구시 기존탭 유지:" #: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption msgid "Tabs saved on left will be restored to:" msgstr "왼쪽창에 저장된 탭이 복구될 곳:" #: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption msgid "Tabs saved on right will be restored to:" msgstr "오른쪽창에 저장된 탭이 복구될 곳:" #: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption msgctxt "TFRMOPTIONSTABSEXTRA.LBLFAVORITETABSSAVEDIRHISTORY.CAPTION" msgid "Keep saving dir history with Favorite Tabs:" msgstr "즐겨찾기 탭과 폴더 히스토리 저장 유지:" #: tfrmoptionstabsextra.rgwheretoadd.caption msgid "Default position in menu when saving a new Favorite Tabs:" msgstr "새 즐겨찾기탭 추가시 메뉴 기본 위치:" #: tfrmoptionsterminal.edrunintermcloseparams.hint #, fuzzy msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{명령}은 명령 프롬프트에서 실행을 반영하기 위해 이곳에 일반적으로 위치해야 함." #: tfrmoptionsterminal.edrunintermstayopenparams.hint #, fuzzy msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{명령}은 명령 프롬프트에서 실행을 반영하기 위해 이곳에 일반적으로 위치해야 함." #: tfrmoptionsterminal.edruntermparams.hint #, fuzzy msgctxt "tfrmoptionsterminal.edruntermparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{명령}은 명령 프롬프트에서 실행을 반영하기 위해 이곳에 일반적으로 위치해야 함." #: tfrmoptionsterminal.gbjustrunterminal.caption msgid "Command for just running terminal:" msgstr "명령 프롬프트 실행을 위한 명령어:" #: tfrmoptionsterminal.gbruninterminalclose.caption msgid "Command for running a command in terminal and close after:" msgstr "명령 프롬프트 실행 및 닫은 후의 명령어:" #: tfrmoptionsterminal.gbruninterminalstayopen.caption msgid "Command for running a command in terminal and stay open:" msgstr "명령 프롬프트 실행과 열린 상태에서의 명령어:" #: tfrmoptionsterminal.lbrunintermclosecmd.caption #, fuzzy msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption" msgid "Command:" msgstr "명령어:" #: tfrmoptionsterminal.lbrunintermcloseparams.caption #, fuzzy msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption" msgid "Parameters:" msgstr "매개변수:" #: tfrmoptionsterminal.lbrunintermstayopencmd.caption #, fuzzy msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption" msgid "Command:" msgstr "명령어:" #: tfrmoptionsterminal.lbrunintermstayopenparams.caption #, fuzzy msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption" msgid "Parameters:" msgstr "매개변수:" #: tfrmoptionsterminal.lbruntermcmd.caption #, fuzzy msgctxt "tfrmoptionsterminal.lbruntermcmd.caption" msgid "Command:" msgstr "명령어:" #: tfrmoptionsterminal.lbruntermparams.caption #, fuzzy msgctxt "tfrmoptionsterminal.lbruntermparams.caption" msgid "Parameters:" msgstr "매개변수:" #: tfrmoptionstoolbar.btnclonebutton.caption msgid "C&lone button" msgstr "버튼 복제(&L)" #: tfrmoptionstoolbar.btndeletebutton.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION" msgid "&Delete" msgstr "삭제(&D)" #: tfrmoptionstoolbar.btnedithotkey.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION" msgid "Edit hot&key" msgstr "단축키 편집(&K)" #: tfrmoptionstoolbar.btninsertbutton.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION" msgid "&Insert new button" msgstr "새 버튼 삽입(&I)" #: tfrmoptionstoolbar.btnopencmddlg.caption msgid "Select" msgstr "선택" #: tfrmoptionstoolbar.btnopenfile.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstoolbar.btnother.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNOTHER.CAPTION" msgid "Other..." msgstr "다른 옵션..." #: tfrmoptionstoolbar.btnremovehotkey.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION" msgid "Remove hotke&y" msgstr "단축키 제거(&Y)" #: tfrmoptionstoolbar.btnstartpath.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstoolbar.btnsuggestiontooltip.caption msgid "Suggest" msgstr "제안" #: tfrmoptionstoolbar.btnsuggestiontooltip.hint msgid "Have DC suggest the tooltip based on button type, command and parameters" msgstr "버튼형태, 명령어와 매개변수에 따라 풍선도움말 제공" #: tfrmoptionstoolbar.cbflatbuttons.caption msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption" msgid "&Flat buttons" msgstr "기본 버튼(&F)" #: tfrmoptionstoolbar.cbreporterrorwithcommands.caption msgid "Report errors with commands" msgstr "명령어와 함께 오류 보고" #: tfrmoptionstoolbar.edtinternalparameters.hint msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters." msgstr "명령어 매개변수 각 줄에 입력. F1키 도움말 보기" #: tfrmoptionstoolbar.gbgroupbox.caption msgid "Appearance" msgstr "모양" #: tfrmoptionstoolbar.lblbarsize.caption msgid "&Bar size:" msgstr "도구바 크기(&B):" #: tfrmoptionstoolbar.lblexternalcommand.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION" msgid "Comman&d:" msgstr "명령어(&D):" #: tfrmoptionstoolbar.lblexternalparameters.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION" msgid "Parameter&s:" msgstr "매개변수(&S):" #: tfrmoptionstoolbar.lblhelponinternalcommand.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION" msgid "Help" msgstr "도움말" #: tfrmoptionstoolbar.lblhotkey.caption msgid "Hot key:" msgstr "단축키:" #: tfrmoptionstoolbar.lbliconfile.caption msgid "Ico&n:" msgstr "아이콘(&N):" #: tfrmoptionstoolbar.lbliconsize.caption msgid "Icon si&ze:" msgstr "아이콘 크기(&Z):" #: tfrmoptionstoolbar.lblinternalcommand.caption msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption" msgid "Co&mmand:" msgstr "명령어(&M):" #: tfrmoptionstoolbar.lblinternalparameters.caption msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption" msgid "&Parameters:" msgstr "매개변수(&P):" #: tfrmoptionstoolbar.lblstartpath.caption msgctxt "tfrmoptionstoolbar.lblstartpath.caption" msgid "Start pat&h:" msgstr "시작 경로(&H):" #: tfrmoptionstoolbar.lbltooltip.caption msgid "&Tooltip:" msgstr "풍선도움말(&T):" #: tfrmoptionstoolbar.miaddallcmds.caption msgid "Add toolbar with ALL DC commands" msgstr "모든 더블커맨더 명령 도구상자 추가" #: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption msgid "for an external command" msgstr "외부명령" #: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption msgid "for an internal command" msgstr "내부명령" #: tfrmoptionstoolbar.miaddseparatorsubmenu.caption msgid "for a separator" msgstr "구분자" #: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption msgid "for a sub-tool bar" msgstr "하위 도구상자" #: tfrmoptionstoolbar.mibackup.caption msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION" msgid "Backup..." msgstr "백업..." #: tfrmoptionstoolbar.miexport.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION" msgid "Export..." msgstr "내보내기..." #: tfrmoptionstoolbar.miexportcurrent.caption msgid "Current toolbar..." msgstr "현재 도구상자..." #: tfrmoptionstoolbar.miexportcurrenttodcbar.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION" msgid "to a Toolbar File (.toolbar)" msgstr "툴바 파일(.toolbar)로" #: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION" msgid "to a TC .BAR file (keep existing)" msgstr "TC.BAR 파일로(기존 파일 유지)" #: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION" msgid "to a TC .BAR file (erase existing)" msgstr "TC.BAR 파일로(기존 파일 지우기)" #: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "TC \"wincmd.ini로 (기존파일 유지)\"" #: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "TC \"wincmd.ini로 (기존파일 지우기)" #: tfrmoptionstoolbar.miexportseparator1.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator2.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator3.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator4.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexporttop.caption msgid "Top toolbar..." msgstr "최상위 도구상자..." #: tfrmoptionstoolbar.miexporttoptobackup.caption msgid "Save a backup of Toolbar" msgstr "도구상자 백업 저장" #: tfrmoptionstoolbar.miexporttoptodcbar.caption msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption" msgid "to a Toolbar File (.toolbar)" msgstr "도구상자 파일로(.toolbar)" #: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption" msgid "to a TC .BAR file (keep existing)" msgstr "TC .BAR 파일로(기존파일 유지)" #: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption" msgid "to a TC .BAR file (erase existing)" msgstr "TC .BAR 파일로(기존파일 지우기)" #: tfrmoptionstoolbar.miexporttoptotcinikeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "TC \"wincmd.ini로 (기존파일 유지)" #: tfrmoptionstoolbar.miexporttoptotcininokeep.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "TC \"wincmd.ini로 (기존파일 지우기)" #: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "현재 선택 바로 다음" #: tfrmoptionstoolbar.miexternalcommandfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "첫번째 요소로" #: tfrmoptionstoolbar.miexternalcommandlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION" msgid "as last element" msgstr "마지막 요소로" #: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "바로 전 선택" #: tfrmoptionstoolbar.miimport.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION" msgid "Import..." msgstr "가져오기..." #: tfrmoptionstoolbar.miimportbackup.caption msgid "Restore a backup of Toolbar" msgstr "도구상자 백업 복구" #: tfrmoptionstoolbar.miimportbackupaddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "현재 도구상자에 추가" #: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "현재 도구상자에 새 도구상자 추가" #: tfrmoptionstoolbar.miimportbackupaddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "최상위 도구상자에 새 도구상자 추가" #: tfrmoptionstoolbar.miimportbackupaddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "최상위 도구상자에 추가" #: tfrmoptionstoolbar.miimportbackupreplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "최상위 도구상자 교체" #: tfrmoptionstoolbar.miimportdcbar.caption msgid "from a Toolbar File (.toolbar)" msgstr "도구상자(.toolbar)파일로 부터" #: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption" msgid "to add to current toolbar" msgstr "현재 도구상자 추가" #: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "현재 도구상자에 새로운 도구상자 추가" #: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "최상위 도구상자에 새로운 도구상자 추가" #: tfrmoptionstoolbar.miimportdcbaraddtop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption" msgid "to add to top toolbar" msgstr "최상위 도구상자에 추가" #: tfrmoptionstoolbar.miimportdcbarreplacetop.caption msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption" msgid "to replace top toolbar" msgstr "최상위 도구상자 교체" #: tfrmoptionstoolbar.miimportseparator.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miimporttcbar.caption msgid "from a single TC .BAR file" msgstr "단일 TC.BAR 파일로 부터" #: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "현재 도구상자 추가" #: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "현재 도구상자에 새로운 도구상자 추가" #: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "최상위 도구상자에 새 도구상자 추가" #: tfrmoptionstoolbar.miimporttcbaraddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "최상위 도구상자 추가" #: tfrmoptionstoolbar.miimporttcbarreplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "최상위 도구상자 교체" #: tfrmoptionstoolbar.miimporttcini.caption msgid "from \"wincmd.ini\" of TC..." msgstr "TC \"wincmd.ini\"로 부터..." #: tfrmoptionstoolbar.miimporttciniaddcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION" msgid "to add to current toolbar" msgstr "현재 도구상자 추가" #: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION" msgid "to add to a new toolbar to current toolbar" msgstr "현재 도구상자에 새 도구상자 추가" #: tfrmoptionstoolbar.miimporttciniaddmenutop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION" msgid "to add to a new toolbar to top toolbar" msgstr "최상위 도구상자에 새 도구상자 추가" #: tfrmoptionstoolbar.miimporttciniaddtop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION" msgid "to add to top toolbar" msgstr "최상위 도구상자에 추가" #: tfrmoptionstoolbar.miimporttcinireplacetop.caption msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION" msgid "to replace top toolbar" msgstr "최상위 도구상자 교체" #: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "현재 선택 바로 뒤" #: tfrmoptionstoolbar.miinternalcommandfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "첫번째 요소로서" #: tfrmoptionstoolbar.miinternalcommandlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION" msgid "as last element" msgstr "마지막 요소로서" #: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "현재 선택 바로 이전" #: tfrmoptionstoolbar.misearchandreplace.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION" msgid "Search and replace..." msgstr "찾아 바꾸기..." #: tfrmoptionstoolbar.miseparator1.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator10.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator11.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator13.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator14.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator2.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator6.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator7.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator8.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator9.caption msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparatoraftercurrent.caption msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption" msgid "just after current selection" msgstr "현재 선택 바로 뒤" #: tfrmoptionstoolbar.miseparatorfirstitem.caption msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption" msgid "as first element" msgstr "첫번째 요소로서" #: tfrmoptionstoolbar.miseparatorlastelement.caption msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption" msgid "as last element" msgstr "마지막 요소로서" #: tfrmoptionstoolbar.miseparatorpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption" msgid "just prior current selection" msgstr "현재 선택 바로 이전" #: tfrmoptionstoolbar.misrcrplallofall.caption msgid "in all of all the above..." msgstr "모든 것 위에..." #: tfrmoptionstoolbar.misrcrplclickseparator.caption msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmoptionstoolbar.misrcrplcommands.caption msgid "in all commands..." msgstr "모든 명령..." #: tfrmoptionstoolbar.misrcrpliconnames.caption msgid "in all icon names..." msgstr "모든 아이콘명..." #: tfrmoptionstoolbar.misrcrplparameters.caption msgid "in all parameters..." msgstr "모든 매개변수..." #: tfrmoptionstoolbar.misrcrplstartpath.caption msgid "in all start path..." msgstr "모든 시작경로에..." #: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION" msgid "just after current selection" msgstr "현재 선택 바로 뒤" #: tfrmoptionstoolbar.misubtoolbarfirstelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION" msgid "as first element" msgstr "첫번째 요소로서" #: tfrmoptionstoolbar.misubtoolbarlastelement.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION" msgid "as last element" msgstr "마지막 요소로서" #: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION" msgid "just prior current selection" msgstr "현재 선택 바로 이전" #: tfrmoptionstoolbar.rgtoolitemtype.caption msgid "Button type" msgstr "버튼 형태" #: tfrmoptionstoolbase.btnrelativetoolpath.hint msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT" msgid "Some functions to select appropriate path" msgstr "적절한 경로 선택을 위한 기능" #: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption msgid "&Keep terminal window open after executing program" msgstr "프로그램 실행 후 명령 프롬프트 창 유지(&K)" #: tfrmoptionstoolbase.cbtoolsruninterminal.caption msgid "&Execute in terminal" msgstr "명령 프롬프트창에서 실행(&E)" #: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption msgid "&Use external program" msgstr "외부 프로그램 사용(&U)" #: tfrmoptionstoolbase.lbltoolsparameters.caption msgid "A&dditional parameters" msgstr "부가 매개변수(&D)" #: tfrmoptionstoolbase.lbltoolspath.caption msgid "&Path to program to execute" msgstr "실행 프로그램 경로(&P)" #: tfrmoptionstooltips.btnaddfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION" msgid "A&dd" msgstr "추가(&D)" #: tfrmoptionstooltips.btnapplyfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION" msgid "A&pply" msgstr "적용(&P)" #: tfrmoptionstooltips.btndeletefields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION" msgid "D&elete" msgstr "삭제(&E)" #: tfrmoptionstooltips.btnfieldslist.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstooltips.btnfieldssearchtemplate.hint msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT" msgid "Template..." msgstr "템플릿..." #: tfrmoptionstooltips.chkshowtooltip.caption msgctxt "TFRMOPTIONSTOOLTIPS.CHKSHOWTOOLTIP.CAPTION" msgid "&Show tooltip for files in the file panel" msgstr "파일창에서 풍선도움말 표시(&S)" #: tfrmoptionstooltips.gbcustomfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION" msgid "Custom fields by file type" msgstr "파일 형태에 따른 사용자 필드" #: tfrmoptionstooltips.lblfieldslist.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION" msgid "Category &hint:" msgstr "범주 힌트(&H):" #: tfrmoptionstooltips.lblfieldsmask.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION" msgid "Category &mask:" msgstr "범주 마스크(&M):" #: tfrmoptionstooltips.lblfieldsname.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION" msgid "Category &name:" msgstr "범주명(&N):" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption msgid "With double-click on the bar on top of a file panel" msgstr "" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption" msgid "With the menu and internal command" msgstr "" #: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption msgid "Double click in tree select and exit" msgstr "" #: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption" msgid "With the menu and internal command" msgstr "" #: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption msgid "With double-click on a tab (if configured for it)" msgstr "" #: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption msgid "When using the keyboard shortcut, it will exit the window returning the current choice" msgstr "" #: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption msgid "Single mouse click in tree select and exit" msgstr "" #: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption msgid "Use it for Command Line History" msgstr "" #: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption msgid "Use it for the Dir History" msgstr "" #: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption msgid "Use it for the View History (Visited paths for active view)" msgstr "" #: tfrmoptionstreeviewmenu.gbbehavior.caption msgid "Behavior regarding selection:" msgstr "" #: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption msgid "Tree View Menus related options:" msgstr "" #: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption msgid "Where to use Tree View Menus:" msgstr "" #: tfrmoptionstreeviewmenu.lblnote.caption msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another." msgstr "" #: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption msgid "With Directory Hotlist:" msgstr "" #: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption msgid "With Favorite Tabs:" msgstr "" #: tfrmoptionstreeviewmenu.lblusewithhistory.caption msgid "With History:" msgstr "" #: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btncursorcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption msgid "Use and display keyboard shortcut for choosing items" msgstr "" #: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption msgid "Layout and colors options:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption msgid "Background color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption msgid "Cursor color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption msgid "Found text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption msgid "Found text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption msgid "Normal text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption msgid "Normal text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblpreview.caption msgid "Tree View Menu Preview:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption msgid "Secondary text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption msgid "Secondary text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption msgid "Shortcut color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption msgid "Shortcut under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption msgid "Unselectable text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption msgid "Unselectable under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample." msgstr "" #: tfrmoptionsviewer.btnbackviewercolor.caption msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsviewer.btnfontviewercolor.caption msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsviewer.gbviewerbookmode.caption msgid "Viewer Book Mode" msgstr "책보기 모드 뷰어" #: tfrmoptionsviewer.gbviewerexample.caption msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION" msgid "Example" msgstr "예" #: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption msgid "&Background color in book viewer" msgstr "책보기 보드 뷰어의 배경색(&B)" #: tfrmoptionsviewer.lblfontcolorviewerbook.caption msgid "&Font color in book viewer" msgstr "책보기 모드 글꼴 색상(&F)" #: tfrmoptionsviewer.lblnumbercolumnsviewer.caption msgid "&Number of columns in book viewer" msgstr "책보기 모드 단 숫자(&N)" #: tfrmpackdlg.btnconfig.caption msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION" msgid "Con&figure" msgstr "환경설정(&F)" #: tfrmpackdlg.caption msgctxt "TFRMPACKDLG.CAPTION" msgid "Pack files" msgstr "파일 압축" #: tfrmpackdlg.cbcreateseparatearchives.caption msgid "C&reate separate archives, one per selected file/dir" msgstr "파일/폴더 선택에 따라 하나씩 분리 압축파일 생성(&R)" #: tfrmpackdlg.cbcreatesfx.caption msgid "Create self e&xtracting archive" msgstr "자동 압축해제 파일 생성(&X)" #: tfrmpackdlg.cbencrypt.caption msgid "Encr&ypt" msgstr "암호화(&Y)" #: tfrmpackdlg.cbmovetoarchive.caption msgid "Mo&ve to archive" msgstr "압축파일로 이동(&V)" #: tfrmpackdlg.cbmultivolume.caption msgid "&Multiple disk archive" msgstr "다중 디스크 압축파일(&M)" #: tfrmpackdlg.cbotherplugins.caption msgid "=>" msgstr "=>" #: tfrmpackdlg.cbputintarfirst.caption msgid "P&ut in the TAR archive first" msgstr "TAR 압축파일 우선 넣기(&U)" #: tfrmpackdlg.cbstoredir.caption msgid "Also &pack path names (only recursed)" msgstr "경로 이름 함께 압축(only recursed) (&P)" #: tfrmpackdlg.lblprompt.caption msgid "Pack file(s) to the file:" msgstr "특정 파일에 압축:" #: tfrmpackdlg.rgpacker.caption msgid "Packer" msgstr "압축기" #: tfrmpackinfodlg.btnclose.caption msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION" msgid "&Close" msgstr "종료(&C)" #: tfrmpackinfodlg.btnunpackallandexec.caption msgid "Unpack &all and execute" msgstr "모두 압축 해제 후 실행(&A)" #: tfrmpackinfodlg.btnunpackandexec.caption msgid "&Unpack and execute" msgstr "압축해제 후 실행(&U)" #: tfrmpackinfodlg.caption msgctxt "TFRMPACKINFODLG.CAPTION" msgid "Properties of packed file" msgstr "압축 파일 속성" #: tfrmpackinfodlg.lblattributes.caption msgid "Attributes:" msgstr "속성:" #: tfrmpackinfodlg.lblcompressionratio.caption msgid "Compression ratio:" msgstr "압축율:" #: tfrmpackinfodlg.lbldate.caption msgid "Date:" msgstr "날짜:" #: tfrmpackinfodlg.lblmethod.caption msgid "Method:" msgstr "압축방법:" #: tfrmpackinfodlg.lbloriginalsize.caption msgid "Original size:" msgstr "원본 크기:" #: tfrmpackinfodlg.lblpackedfile.caption msgid "File:" msgstr "파일:" #: tfrmpackinfodlg.lblpackedsize.caption msgid "Packed size:" msgstr "압축 크기:" #: tfrmpackinfodlg.lblpacker.caption msgid "Packer:" msgstr "압축기:" #: tfrmpackinfodlg.lbltime.caption msgid "Time:" msgstr "시간:" #: tfrmquicksearch.btncancel.caption msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION" msgid "X" msgstr "X" #: tfrmquicksearch.btncancel.hint msgid "Close filter panel" msgstr "필터창 닫기" #: tfrmquicksearch.edtsearch.hint msgid "Enter text to search for or filter by" msgstr "검색 또는 필터링을 위한 텍스트 입력" #: tfrmquicksearch.sbcasesensitive.caption msgid "Aa" msgstr "Aa" #: tfrmquicksearch.sbcasesensitive.hint msgid "Case Sensitive" msgstr "대소문자 구분" #: tfrmquicksearch.sbdirectories.caption msgid "D" msgstr "D" #: tfrmquicksearch.sbdirectories.hint msgctxt "tfrmquicksearch.sbdirectories.hint" msgid "Directories" msgstr "폴더" #: tfrmquicksearch.sbfiles.caption msgid "F" msgstr "F" #: tfrmquicksearch.sbfiles.hint msgctxt "tfrmquicksearch.sbfiles.hint" msgid "Files" msgstr "파일" #: tfrmquicksearch.sbmatchbeginning.caption msgid "{" msgstr "{" #: tfrmquicksearch.sbmatchbeginning.hint msgid "Match Beginning" msgstr "검색 일치 시작" #: tfrmquicksearch.sbmatchending.caption msgid "}" msgstr "}" #: tfrmquicksearch.sbmatchending.hint msgid "Match Ending" msgstr "검색 일치 끝" #: tfrmquicksearch.tglfilter.caption msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION" msgid "Filter" msgstr "필터" #: tfrmquicksearch.tglfilter.hint msgid "Toggle between search or filter" msgstr "검색 또는 필터 on/off 토글버튼" #: tfrmsearchplugin.btnadd.caption msgid "&More rules" msgstr "더 많은 규칙(&M)" #: tfrmsearchplugin.btndelete.caption msgid "L&ess rules" msgstr "적은 규칙(&E)" #: tfrmsearchplugin.chkuseplugins.caption msgid "Use &content plugins, combine with:" msgstr "플러그인 사용, 함께 결합(&C):" #: tfrmsearchplugin.headercontrol.sections[0].text msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT" msgid "Plugin" msgstr "플러그인" #: tfrmsearchplugin.headercontrol.sections[1].text msgid "Field" msgstr "필드" #: tfrmsearchplugin.headercontrol.sections[2].text msgid "Operator" msgstr "연산자" #: tfrmsearchplugin.headercontrol.sections[3].text msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[3].TEXT" msgid "Value" msgstr "값" #: tfrmsearchplugin.rband.caption msgid "&AND (all match)" msgstr "AND (모두 일치) (&A)" #: tfrmsearchplugin.rbor.caption msgid "&OR (any match)" msgstr "OR (하나라도 일치) (&O)" #: tfrmselecttextrange.btppanel.cancelbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION" msgid "Cancel" msgstr "취소" #: tfrmselecttextrange.btppanel.closebutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION" msgid "&Close" msgstr "종료(&C)" #: tfrmselecttextrange.btppanel.helpbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION" msgid "&Help" msgstr "도움말(&H)" #: tfrmselecttextrange.btppanel.okbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmselecttextrange.lblselecttext.caption msgid "&Select the characters to insert:" msgstr "문자 삽입 선택(&S)" #: tfrmsetfileproperties.btncancel.caption msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmsetfileproperties.btnok.caption msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmsetfileproperties.caption msgctxt "TFRMSETFILEPROPERTIES.CAPTION" msgid "Change attributes" msgstr "속성 변경" #: tfrmsetfileproperties.cbsgid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "SGID(Set Group ID)" #: tfrmsetfileproperties.cbsticky.caption msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Sticky 비트" #: tfrmsetfileproperties.cbsuid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "SUID(Set User ID)" #: tfrmsetfileproperties.chkarchive.caption msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION" msgid "Archive" msgstr "보관 가능" #: tfrmsetfileproperties.chkcreationtime.caption msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION" msgid "Created:" msgstr "생성됨:" #: tfrmsetfileproperties.chkhidden.caption msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION" msgid "Hidden" msgstr "숨김" #: tfrmsetfileproperties.chklastaccesstime.caption msgid "Accessed:" msgstr "실행됨:" #: tfrmsetfileproperties.chklastwritetime.caption msgid "Modified:" msgstr "수정됨:" #: tfrmsetfileproperties.chkreadonly.caption msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION" msgid "Read only" msgstr "읽기전용" #: tfrmsetfileproperties.chkrecursive.caption msgid "Including subfolders" msgstr "하위 폴더 포함" #: tfrmsetfileproperties.chksystem.caption msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION" msgid "System" msgstr "시스템" #: tfrmsetfileproperties.gbtimesamp.caption msgid "Timestamp properties" msgstr "타임스탬프 속성" #: tfrmsetfileproperties.gbunixattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION" msgid "Attributes" msgstr "속성" #: tfrmsetfileproperties.gbwinattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION" msgid "Attributes" msgstr "속성" #: tfrmsetfileproperties.lblattrbitsstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "비트:" #: tfrmsetfileproperties.lblattrgroupstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "그룹" #: tfrmsetfileproperties.lblattrinfo.caption msgctxt "tfrmsetfileproperties.lblattrinfo.caption" msgid "(gray field means unchanged value)" msgstr "(회색 필드는 값이 변경되지 않았음을 의미)" #: tfrmsetfileproperties.lblattrotherstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "다른 옵션" #: tfrmsetfileproperties.lblattrownerstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "소유자" #: tfrmsetfileproperties.lblattrtext.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "-----------" #: tfrmsetfileproperties.lblattrtextstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "텍스트:" #: tfrmsetfileproperties.lblexec.caption msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "실행" #: tfrmsetfileproperties.lblmodeinfo.caption msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION" msgid "(gray field means unchanged value)" msgstr "(회색 필드는 값이 변경되지 않았음을 의미)" #: tfrmsetfileproperties.lbloctal.caption msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "8진법:" #: tfrmsetfileproperties.lblread.caption msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "읽기" #: tfrmsetfileproperties.lblwrite.caption msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "쓰기" #: tfrmsplitter.btncancel.caption msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmsplitter.btnftchoice.caption msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION" msgid "..." msgstr "..." #: tfrmsplitter.btnok.caption msgctxt "TFRMSPLITTER.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmsplitter.btnrelativeftchoice.hint msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT" msgid "Some functions to select appropriate path" msgstr "적절한 경로 선택을 위한 기능" #: tfrmsplitter.caption msgctxt "TFRMSPLITTER.CAPTION" msgid "Splitter" msgstr "구분자" #: tfrmsplitter.cbrequireacrc32verificationfile.caption msgid "Require a CRC32 verification file" msgstr "CRC32 확인 필요" #: tfrmsplitter.cmbxsize.text msgid "1457664B - 3.5\"" msgstr "1457664B - 3.5\"" #: tfrmsplitter.grbxfile.caption msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION" msgid "File name" msgstr "파일명" #: tfrmsplitter.grbxsize.caption msgid "Size and number of parts" msgstr "부분의 크기와 숫자" #: tfrmsplitter.lbdirtarget.caption msgid "Directory &target" msgstr "목표 폴더(&T)" #: tfrmsplitter.lbfilesource.caption msgid "File &source" msgstr "파일 소스(&S)" #: tfrmsplitter.lblnumberparts.caption msgid "&Number of parts" msgstr "부분 갯수(&N)" #: tfrmsplitter.rbtnbyte.caption msgid "&Bytes" msgstr "바이트(&B)" #: tfrmsplitter.rbtngigab.caption msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION" msgid "&Gigabytes" msgstr "기가바이트(&G)" #: tfrmsplitter.rbtnkilob.caption msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION" msgid "&Kilobytes" msgstr "킬로바이트(&K)" #: tfrmsplitter.rbtnmegab.caption msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION" msgid "&Megabytes" msgstr "메가바이트(&M)" #: tfrmstartingsplash.caption msgctxt "TFRMSTARTINGSPLASH.CAPTION" msgid "Double Commander" msgstr "더블 커맨더" #: tfrmstartingsplash.lblbuild.caption msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION" msgid "Build" msgstr "빌드" #: tfrmstartingsplash.lblfreepascalver.caption msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION" msgid "Free Pascal" msgstr "Free 파스칼" #: tfrmstartingsplash.lbllazarusver.caption msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION" msgid "Lazarus" msgstr "Lazarus" #: tfrmstartingsplash.lbloperatingsystem.caption msgid "Operating System" msgstr "운영체제" #: tfrmstartingsplash.lblplatform.caption msgid "Platform" msgstr "플랫폼" #: tfrmstartingsplash.lblrevision.caption msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION" msgid "Revision" msgstr "개정" #: tfrmstartingsplash.lbltitle.caption msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION" msgid "Double Commander" msgstr "더블 커맨더" #: tfrmstartingsplash.lblversion.caption msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION" msgid "Version" msgstr "버전" #: tfrmstartingsplash.lblwidgetsetver.caption msgid "WidgetsetVer" msgstr "WidgetsetVer" #: tfrmsymlink.btncancel.caption msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmsymlink.btnok.caption msgctxt "TFRMSYMLINK.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmsymlink.caption msgid "Create symbolic link" msgstr "바로 가기 생성" #: tfrmsymlink.chkuserelativepath.caption msgid "Use &relative path when possible" msgstr "" #: tfrmsymlink.lblexistingfile.caption msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "링크가 가리킬 목적지(&D)" #: tfrmsymlink.lbllinktocreate.caption msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "링크명(&L)" #: tfrmsyncdirsdlg.actselectclear.caption msgid "Remove selection" msgstr "" #: tfrmsyncdirsdlg.actselectcopydefault.caption msgid "Select for copying (default direction)" msgstr "" #: tfrmsyncdirsdlg.actselectcopylefttoright.caption msgid "Select for copying -> (left to right)" msgstr "" #: tfrmsyncdirsdlg.actselectcopyreverse.caption msgid "Reverse copy direction" msgstr "" #: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption msgid "Select for copying <- (right to left)" msgstr "" #: tfrmsyncdirsdlg.actselectdeleteright.caption msgid "Select for deleting -> (right)" msgstr "" #: tfrmsyncdirsdlg.btnclose.caption msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION" msgid "Close" msgstr "종료" #: tfrmsyncdirsdlg.btncompare.caption msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION" msgid "Compare" msgstr "비교" #: tfrmsyncdirsdlg.btnseldir1.caption msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION" msgid ">>" msgstr ">>" #: tfrmsyncdirsdlg.btnseldir2.caption msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION" msgid ">>" msgstr ">>" #: tfrmsyncdirsdlg.btnsynchronize.caption msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption" msgid "Synchronize" msgstr "동기화" #: tfrmsyncdirsdlg.caption msgid "Synchronize directories" msgstr "폴더 동기화" #: tfrmsyncdirsdlg.cbextfilter.text msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT" msgid "*.*" msgstr "*.*" #: tfrmsyncdirsdlg.chkasymmetric.caption msgid "asymmetric" msgstr "비대칭" #: tfrmsyncdirsdlg.chkbycontent.caption msgid "by content" msgstr "내용별" #: tfrmsyncdirsdlg.chkignoredate.caption msgid "ignore date" msgstr "날짜 무시" #: tfrmsyncdirsdlg.chkonlyselected.caption msgid "only selected" msgstr "선택만" #: tfrmsyncdirsdlg.chksubdirs.caption msgid "Subdirs" msgstr "하위 폴더" #: tfrmsyncdirsdlg.groupbox1.caption msgid "Show:" msgstr "표시:" #: tfrmsyncdirsdlg.headerdg.columns[0].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION" msgid "Name" msgstr "파일명" #: tfrmsyncdirsdlg.headerdg.columns[1].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION" msgid "Size" msgstr "크기" #: tfrmsyncdirsdlg.headerdg.columns[2].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION" msgid "Date" msgstr "날짜" #: tfrmsyncdirsdlg.headerdg.columns[3].title.caption msgid "<=>" msgstr "<=>" #: tfrmsyncdirsdlg.headerdg.columns[4].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION" msgid "Date" msgstr "날짜" #: tfrmsyncdirsdlg.headerdg.columns[5].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION" msgid "Size" msgstr "크기" #: tfrmsyncdirsdlg.headerdg.columns[6].title.caption msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION" msgid "Name" msgstr "파일명" #: tfrmsyncdirsdlg.label1.caption msgid "(in main window)" msgstr "(메인창)" #: tfrmsyncdirsdlg.menuitemcompare.caption msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION" msgid "Compare" msgstr "비교" #: tfrmsyncdirsdlg.menuitemviewleft.caption msgid "View left" msgstr "왼쪽창 보기" #: tfrmsyncdirsdlg.menuitemviewright.caption msgid "View right" msgstr "오른쪽창 보기" #: tfrmsyncdirsdlg.sbcopyleft.caption msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION" msgid "<" msgstr "<" #: tfrmsyncdirsdlg.sbcopyright.caption msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION" msgid ">" msgstr ">" #: tfrmsyncdirsdlg.sbduplicates.caption msgid "duplicates" msgstr "복제" #: tfrmsyncdirsdlg.sbequal.caption msgid "=" msgstr "=" #: tfrmsyncdirsdlg.sbnotequal.caption msgid "!=" msgstr "!=" #: tfrmsyncdirsdlg.sbsingles.caption msgid "singles" msgstr "단일" #: tfrmsyncdirsdlg.statusbar1.panels[0].text msgid "Please press \"Compare\" to start" msgstr "시작하려면 \"비교하기\"를 누르세요" #: tfrmsyncdirsperformdlg.caption msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION" msgid "Synchronize" msgstr "동기화" #: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption msgid "Confirm overwrites" msgstr "덮어쓰기 확인" #: tfrmtreeviewmenu.caption msgctxt "tfrmtreeviewmenu.caption" msgid "Tree View Menu" msgstr "" #: tfrmtreeviewmenu.lblsearchingentry.caption msgid "Select your hot directory:" msgstr "" #: tfrmtreeviewmenu.pmicasesensitive.caption msgid "Search is case sensitive" msgstr "" #: tfrmtreeviewmenu.pmifullcollapse.caption msgid "Full collapse" msgstr "" #: tfrmtreeviewmenu.pmifullexpand.caption msgid "Full expand" msgstr "" #: tfrmtreeviewmenu.pmiignoreaccents.caption msgid "Search ignore accents and ligatures" msgstr "" #: tfrmtreeviewmenu.pminotcasesensitive.caption msgid "Search is not case sensitive" msgstr "" #: tfrmtreeviewmenu.pminotignoreaccents.caption msgid "Search is strict regarding accents and ligatures" msgstr "" #: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption msgid "Don't show the branch content \"just\" because the searched string is found in the branche name" msgstr "" #: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption msgid "If searched string is found in a branch name, show the whole branch even if elements don't match" msgstr "" #: tfrmtreeviewmenu.tbcancelandquit.hint msgid "Close Tree View Menu" msgstr "" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint" msgid "Configuration of Tree View Menu" msgstr "" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint" msgid "Configuration of Tree View Menu Colors" msgstr "" #: tfrmtweakplugin.btnadd.caption msgid "A&dd new" msgstr "새 파일 추가(&D)" #: tfrmtweakplugin.btncancel.caption msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "취소(&C)" #: tfrmtweakplugin.btnchange.caption msgid "C&hange" msgstr "변경(&H)" #: tfrmtweakplugin.btndefault.caption msgid "De&fault" msgstr "기본값(&F)" #: tfrmtweakplugin.btnok.caption msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION" msgid "&OK" msgstr "확인(&O)" #: tfrmtweakplugin.btnremove.caption msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION" msgid "&Remove" msgstr "제거(&R)" #: tfrmtweakplugin.caption msgctxt "TFRMTWEAKPLUGIN.CAPTION" msgid "Tweak plugin" msgstr "플러그인 수정" #: tfrmtweakplugin.cbpk_caps_by_content.caption msgid "De&tect archive type by content" msgstr "내용에 의해 압축파일 감지(&T)" #: tfrmtweakplugin.cbpk_caps_delete.caption msgid "Can de&lete files" msgstr "파일 삭제 가능(&L)" #: tfrmtweakplugin.cbpk_caps_encrypt.caption msgid "Supports e&ncryption" msgstr "암호화 지원(&N)" #: tfrmtweakplugin.cbpk_caps_hide.caption msgid "Sho&w as normal files (hide packer icon)" msgstr "일반 파일로서 표시(압축파일 아이콘 감추기)(&W)" #: tfrmtweakplugin.cbpk_caps_mempack.caption msgid "Supports pac&king in memory" msgstr "메모리에서 압축 지원(&K)" #: tfrmtweakplugin.cbpk_caps_modify.caption msgid "Can &modify existing archives" msgstr "압축파일 수정 가능(&M)" #: tfrmtweakplugin.cbpk_caps_multiple.caption msgid "&Archive can contain multiple files" msgstr "압축파일 여러개 파일 포함 가능(&A)" #: tfrmtweakplugin.cbpk_caps_new.caption msgid "Can create new archi&ves" msgstr "새 압축파일 생성 가능(&V)" #: tfrmtweakplugin.cbpk_caps_options.caption msgid "S&upports the options dialogbox" msgstr "옵션 대화상자 지원(&U)" #: tfrmtweakplugin.cbpk_caps_searchtext.caption msgid "Allow searchin&g for text in archives" msgstr "압축파일 내부 텍스트 검색 허용(&G)" #: tfrmtweakplugin.lbldescription.caption msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION" msgid "&Description:" msgstr "설명(&D):" #: tfrmtweakplugin.lbldetectstr.caption msgid "D&etect string:" msgstr "문자열 감지(&E):" #: tfrmtweakplugin.lblextension.caption msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION" msgid "&Extension:" msgstr "확장자(&E):" #: tfrmtweakplugin.lblflags.caption msgid "Flags:" msgstr "표시문자:" #: tfrmtweakplugin.lblname.caption msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION" msgid "&Name:" msgstr "파일명(&N):" #: tfrmtweakplugin.lblplugin.caption msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION" msgid "&Plugin:" msgstr "플러그인(&P):" #: tfrmtweakplugin.lblplugin1.caption msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION" msgid "&Plugin:" msgstr "플러그인(&P):" #: tfrmviewer.actabout.caption msgctxt "TFRMVIEWER.ACTABOUT.CAPTION" msgid "About Viewer..." msgstr "뷰어 정보..." #: tfrmviewer.actabout.hint msgid "Displays the About message" msgstr "정보 메시지 화면 표시" #: tfrmviewer.actchangeencoding.caption msgid "Change encoding" msgstr "" #: tfrmviewer.actcopyfile.caption msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION" msgid "Copy File" msgstr "파일 복사" #: tfrmviewer.actcopyfile.hint msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT" msgid "Copy File" msgstr "파일 복사" #: tfrmviewer.actcopytoclipboard.caption #, fuzzy msgctxt "tfrmviewer.actcopytoclipboard.caption" msgid "Copy To Clipboard" msgstr "클립보드로 복사" #: tfrmviewer.actcopytoclipboardformatted.caption msgid "Copy To Clipboard Formatted" msgstr "" #: tfrmviewer.actdeletefile.caption msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION" msgid "Delete File" msgstr "파일 삭제" #: tfrmviewer.actdeletefile.hint msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT" msgid "Delete File" msgstr "파일 삭제" #: tfrmviewer.actexitviewer.caption #, fuzzy msgctxt "tfrmviewer.actexitviewer.caption" msgid "E&xit" msgstr "종료(&X)" #: tfrmviewer.actfind.caption #, fuzzy msgctxt "tfrmviewer.actfind.caption" msgid "Find" msgstr "찾기" #: tfrmviewer.actfindnext.caption #, fuzzy msgctxt "tfrmviewer.actfindnext.caption" msgid "Find next" msgstr "다음 찾기" #: tfrmviewer.actfindprev.caption msgctxt "tfrmviewer.actfindprev.caption" msgid "Find previous" msgstr "" #: tfrmviewer.actfullscreen.caption #, fuzzy msgctxt "tfrmviewer.actfullscreen.caption" msgid "Full Screen" msgstr "전체화면" #: tfrmviewer.actimagecenter.caption #, fuzzy msgctxt "tfrmviewer.actimagecenter.caption" msgid "Center" msgstr "가운데" #: tfrmviewer.actloadnextfile.caption msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION" msgid "&Next" msgstr "다음(&N)" #: tfrmviewer.actloadnextfile.hint msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT" msgid "Load Next File" msgstr "다음 파일 불러오기" #: tfrmviewer.actloadprevfile.caption msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION" msgid "&Previous" msgstr "이전(&P)" #: tfrmviewer.actloadprevfile.hint msgid "Load Previous File" msgstr "이전 파일 불러오기" #: tfrmviewer.actmirrorhorz.caption msgid "Mirror Horizontally" msgstr "" #: tfrmviewer.actmirrorhorz.hint #, fuzzy msgctxt "tfrmviewer.actmirrorhorz.hint" msgid "Mirror" msgstr "미러" #: tfrmviewer.actmirrorvert.caption msgid "Mirror Vertically" msgstr "" #: tfrmviewer.actmovefile.caption msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION" msgid "Move File" msgstr "파일 이동" #: tfrmviewer.actmovefile.hint msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT" msgid "Move File" msgstr "파일 이동" #: tfrmviewer.actpreview.caption #, fuzzy msgctxt "tfrmviewer.actpreview.caption" msgid "Preview" msgstr "미리보기" #: tfrmviewer.actreload.caption msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION" msgid "Reload" msgstr "다시 불러오기" #: tfrmviewer.actreload.hint msgid "Reload current file" msgstr "현재 파일 다시 불러오기" #: tfrmviewer.actrotate180.caption #, fuzzy #| msgid "Rotate 180" msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION" msgid "+ 180" msgstr "180도 회전" #: tfrmviewer.actrotate180.hint #, fuzzy #| msgid "Rotate 180" msgctxt "TFRMVIEWER.ACTROTATE180.HINT" msgid "Rotate 180 degrees" msgstr "180도 회전" #: tfrmviewer.actrotate270.caption #, fuzzy #| msgid "Rotate 270" msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION" msgid "- 90" msgstr "270도 회전" #: tfrmviewer.actrotate270.hint #, fuzzy #| msgid "Rotate 270" msgctxt "TFRMVIEWER.ACTROTATE270.HINT" msgid "Rotate -90 degrees" msgstr "270도 회전" #: tfrmviewer.actrotate90.caption #, fuzzy #| msgid "Rotate 90" msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION" msgid "+ 90" msgstr "90도 회전" #: tfrmviewer.actrotate90.hint #, fuzzy #| msgid "Rotate 90" msgctxt "TFRMVIEWER.ACTROTATE90.HINT" msgid "Rotate +90 degrees" msgstr "90도 회전" #: tfrmviewer.actsave.caption #, fuzzy msgctxt "tfrmviewer.actsave.caption" msgid "Save" msgstr "저장" #: tfrmviewer.actsaveas.caption msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION" msgid "Save As..." msgstr "다른 이름으로 저장..." #: tfrmviewer.actsaveas.hint msgid "Save File As..." msgstr "파일로 저장..." #: tfrmviewer.actscreenshot.caption #, fuzzy msgctxt "tfrmviewer.actscreenshot.caption" msgid "Screenshot" msgstr "화면캡쳐" #: tfrmviewer.actscreenshotdelay3sec.caption msgid "Delay 3 sec" msgstr "" #: tfrmviewer.actscreenshotdelay5sec.caption msgid "Delay 5 sec" msgstr "" #: tfrmviewer.actselectall.caption #, fuzzy msgctxt "tfrmviewer.actselectall.caption" msgid "Select All" msgstr "전체 선택" #: tfrmviewer.actshowasbin.caption #, fuzzy msgctxt "tfrmviewer.actshowasbin.caption" msgid "Show as &Bin" msgstr "바이너리로 표시(&B)" #: tfrmviewer.actshowasbook.caption #, fuzzy msgctxt "tfrmviewer.actshowasbook.caption" msgid "Show as B&ook" msgstr "책으로 표시(&O)" #: tfrmviewer.actshowasdec.caption msgid "Show as &Dec" msgstr "" #: tfrmviewer.actshowashex.caption #, fuzzy msgctxt "tfrmviewer.actshowashex.caption" msgid "Show as &Hex" msgstr "헥사코드로 표시(&H)" #: tfrmviewer.actshowastext.caption #, fuzzy msgctxt "tfrmviewer.actshowastext.caption" msgid "Show as &Text" msgstr "텍스트로 표시(&T)" #: tfrmviewer.actshowaswraptext.caption #, fuzzy msgctxt "tfrmviewer.actshowaswraptext.caption" msgid "Show as &Wrap text" msgstr "텍스트 줄바꿈 표시(&W)" #: tfrmviewer.actshowgraphics.caption #, fuzzy msgctxt "tfrmviewer.actshowgraphics.caption" msgid "Graphics" msgstr "그래픽" #: tfrmviewer.actshowplugins.caption #, fuzzy msgctxt "tfrmviewer.actshowplugins.caption" msgid "Plugins" msgstr "플러그인" #: tfrmviewer.actstretchimage.caption msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION" msgid "Stretch" msgstr "늘이기" #: tfrmviewer.actstretchimage.hint msgid "Stretch Image" msgstr "이미지 늘이기" #: tfrmviewer.actstretchonlylarge.caption #, fuzzy msgctxt "tfrmviewer.actstretchonlylarge.caption" msgid "Stretch only large" msgstr "크게만 늘이기" #: tfrmviewer.actzoom.caption msgid "Zoom" msgstr "" #: tfrmviewer.actzoomin.caption #, fuzzy msgctxt "tfrmviewer.actzoomin.caption" msgid "Zoom In" msgstr "확대" #: tfrmviewer.actzoomout.caption #, fuzzy msgctxt "tfrmviewer.actzoomout.caption" msgid "Zoom Out" msgstr "축소" #: tfrmviewer.btncopyfile.hint msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT" msgid "Copy" msgstr "복사" #: tfrmviewer.btncopyfile1.hint msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT" msgid "Copy" msgstr "복사" #: tfrmviewer.btncuttuimage.hint msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT" msgid "Crop" msgstr "잘라내기" #: tfrmviewer.btndeletefile.hint msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT" msgid "Delete" msgstr "삭제" #: tfrmviewer.btndeletefile1.hint msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT" msgid "Delete" msgstr "삭제" #: tfrmviewer.btnfullscreen.hint msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT" msgid "Full Screen" msgstr "전체화면" #: tfrmviewer.btngifmove.caption msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION" msgid "||" msgstr "||" #: tfrmviewer.btngiftobmp.caption msgid "S" msgstr "S" #: tfrmviewer.btnhightlight.hint msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT" msgid "Highlight" msgstr "하이라이트" #: tfrmviewer.btnmovefile.hint msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT" msgid "Move" msgstr "이동" #: tfrmviewer.btnmovefile1.hint msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT" msgid "Move" msgstr "이동" #: tfrmviewer.btnnextgifframe.caption msgid "||>" msgstr "||>" #: tfrmviewer.btnpaint.hint msgctxt "TFRMVIEWER.BTNPAINT.HINT" msgid "Paint" msgstr "색칠" #: tfrmviewer.btnprevgifframe.caption msgid "<||" msgstr "<||" #: tfrmviewer.btnredeye.hint msgid "Red Eyes" msgstr "적목현상" #: tfrmviewer.btnresize.hint msgctxt "TFRMVIEWER.BTNRESIZE.HINT" msgid "Resize" msgstr "크기 변경" #: tfrmviewer.btnundo.hint msgctxt "TFRMVIEWER.BTNUNDO.HINT" msgid "Undo" msgstr "실행 취소" #: tfrmviewer.caption msgctxt "TFRMVIEWER.CAPTION" msgid "Viewer" msgstr "뷰어" #: tfrmviewer.cbslideshow.caption msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "슬라이드쇼" #: tfrmviewer.comboboxpaint.text msgid "Pen" msgstr "펜" #: tfrmviewer.comboboxwidth.text msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT" msgid "1" msgstr "1" #: tfrmviewer.gboxhightlight.caption msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION" msgid "Highlight" msgstr "하이라이트" #: tfrmviewer.gboxpaint.caption msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION" msgid "Paint" msgstr "색칠" #: tfrmviewer.gboxslideshow.caption msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "슬라이드쇼" #: tfrmviewer.gboxview.caption msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION" msgid "View" msgstr "보기" #: tfrmviewer.lblhightlight.caption msgid "0x0" msgstr "0x0" #: tfrmviewer.miabout.caption msgctxt "TFRMVIEWER.MIABOUT.CAPTION" msgid "About" msgstr "정보" #: tfrmviewer.midiv1.caption msgctxt "TFRMVIEWER.MIDIV1.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv2.caption msgctxt "TFRMVIEWER.MIDIV2.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv3.caption msgctxt "TFRMVIEWER.MIDIV3.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv4.caption msgctxt "TFRMVIEWER.MIDIV4.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv5.caption msgctxt "TFRMVIEWER.MIDIV5.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.miedit.caption msgctxt "TFRMVIEWER.MIEDIT.CAPTION" msgid "&Edit" msgstr "편집(&E)" #: tfrmviewer.miencoding.caption msgctxt "TFRMVIEWER.MIENCODING.CAPTION" msgid "En&coding" msgstr "인코딩(&C)" #: tfrmviewer.mifile.caption msgctxt "TFRMVIEWER.MIFILE.CAPTION" msgid "&File" msgstr "파일(&F)" #: tfrmviewer.miimage.caption msgid "&Image" msgstr "이미지(&I)" #: tfrmviewer.miprint.caption msgid "Print..." msgstr "인쇄..." #: tfrmviewer.mirotate.caption msgctxt "TFRMVIEWER.MIROTATE.CAPTION" msgid "Rotate" msgstr "회전" #: tfrmviewer.miscreenshot.caption msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION" msgid "Screenshot" msgstr "화면캡쳐" #: tfrmviewer.miseparator.caption msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.miview.caption msgctxt "TFRMVIEWER.MIVIEW.CAPTION" msgid "&View" msgstr "보기(&V)" #: tfrmviewer.pmiselectall.caption msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION" msgid "Select All" msgstr "전체 선택" #: tfrmviewoperations.btnstartpause.caption #, fuzzy msgctxt "tfrmviewoperations.btnstartpause.caption" msgid "&Start" msgstr "실행(&S)" #: tfrmviewoperations.btnstop.caption msgid "S&top" msgstr "" #: tfrmviewoperations.caption #, fuzzy msgctxt "tfrmviewoperations.caption" msgid "File operations" msgstr "파일 작업" #: tfrmviewoperations.cbalwaysontop.caption msgid "Always on top" msgstr "" #: tfrmviewoperations.lblusedragdrop.caption msgid "&Use \"drag && drop\" to move operations between queues" msgstr "" #: tfrmviewoperations.mnucanceloperation.caption #, fuzzy msgctxt "tfrmviewoperations.mnucanceloperation.caption" msgid "Cancel" msgstr "취소" #: tfrmviewoperations.mnucancelqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnucancelqueue.caption" msgid "Cancel" msgstr "취소" #: tfrmviewoperations.mnunewqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnunewqueue.caption" msgid "New queue" msgstr "새 작업대기열" #: tfrmviewoperations.mnuoperationshowdetached.caption msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption" msgid "Show in detached window" msgstr "" #: tfrmviewoperations.mnuputfirstinqueue.caption msgid "Put first in queue" msgstr "" #: tfrmviewoperations.mnuputlastinqueue.caption msgid "Put last in queue" msgstr "" #: tfrmviewoperations.mnuqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue.caption" msgid "Queue" msgstr "대기열" #: tfrmviewoperations.mnuqueue0.caption msgid "Out of queue" msgstr "" #: tfrmviewoperations.mnuqueue1.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue1.caption" msgid "Queue 1" msgstr "작업대기열 1" #: tfrmviewoperations.mnuqueue2.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue2.caption" msgid "Queue 2" msgstr "작업대기열 2" #: tfrmviewoperations.mnuqueue3.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue3.caption" msgid "Queue 3" msgstr "작업대기열 3" #: tfrmviewoperations.mnuqueue4.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue4.caption" msgid "Queue 4" msgstr "작업대기열 4" #: tfrmviewoperations.mnuqueue5.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue5.caption" msgid "Queue 5" msgstr "작업대기열 5" #: tfrmviewoperations.mnuqueueshowdetached.caption msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption" msgid "Show in detached window" msgstr "" #: tfrmviewoperations.tbpauseall.caption msgid "&Pause all" msgstr "" #: tmultiarchivecopyoperationoptionsui.lblfileexists.caption msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "파일이 있을 때" #: twcxarchivecopyoperationoptionsui.lblfileexists.caption msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "파일이 있을 때" #: twfxplugincopymoveoperationoptionsui.cbcopytime.caption #, fuzzy msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "날짜/시간 복사(&A)" #: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption msgid "Work in background (separate connection)" msgstr "백그라운드 실행(연결 분리)" #: twfxplugincopymoveoperationoptionsui.lblfileexists.caption msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "파일이 있을 때" #: uexifreader.rsdatetimeoriginal msgid "Date taken" msgstr "" #: uexifreader.rsimageheight #, fuzzy msgctxt "uexifreader.rsimageheight" msgid "Height" msgstr "높이" #: uexifreader.rsimagewidth #, fuzzy msgctxt "uexifreader.rsimagewidth" msgid "Width" msgstr "폭" #: uexifreader.rsmake msgid "Manufacturer" msgstr "" #: uexifreader.rsmodel msgid "Camera model" msgstr "" #: uexifreader.rsorientation msgid "Orientation" msgstr "" #: ulng.msgtrytolocatecrcfile msgid "" "This file cannot be found and could help to validate final combination of files:\n" "%s\n" "\n" "Could you make it available and press \"OK\" when ready,\n" "or press \"CANCEL\" to continue without it?\n" msgstr "" "이 파일은 찾을 수 없고 마지막 파일 최종 조합을 검증할 수 없습니다:\n" "%s\n" "\n" "파일이 준비되어 가능하게 되면 \"OK\"를 누르세요,\n" "또는 이 파일을 빼고 계속하려면 \"취소\" 를 누르세요.\n" #: ulng.rscancelfilter msgid "Cancel Quick Filter" msgstr "빠른 필터 취소" #: ulng.rscanceloperation msgid "Cancel Current Operation" msgstr "현재 작업 취소" #: ulng.rscaptionforaskingfilename msgid "Enter filename, with extension, for dropped text" msgstr "파일명, 확장자, 텍스트 입력" #: ulng.rscaptionfortextformattoimport msgid "Text format to import" msgstr "불러오기 텍스트 형태" #: ulng.rschecksumverifybroken msgid "Broken:" msgstr "파일 깨짐:" #: ulng.rschecksumverifygeneral msgid "General:" msgstr "일반:" #: ulng.rschecksumverifymissing msgid "Missing:" msgstr "파일 없음:" #: ulng.rschecksumverifyreaderror msgid "Read error:" msgstr "읽기 오류:" #: ulng.rschecksumverifysuccess msgid "Success:" msgstr "성공:" #: ulng.rschecksumverifytext msgid "Enter checksum and select algorithm:" msgstr "체크섬 입력과 알고리즘 선택:" #: ulng.rschecksumverifytitle msgid "Verify checksum" msgstr "체크섬 검증" #: ulng.rschecksumverifytotal msgid "Total:" msgstr "전체값:" #: ulng.rsclearfiltersornot msgid "Do you want to clear filters for this new search?" msgstr "" #: ulng.rsclipboardcontainsinvalidtoolbardata msgid "Clipboard doesn't contain any valid toolbar data." msgstr "클립보드에 도구상자 데이터가 없습니다." #: ulng.rscmdcategorylistinorder msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log" msgstr "전체;활성창;왼쪽창;오른쪽창;파일 작업;환경설정;네트워크;기타 설정;병렬포트;인쇄;마크;보안;클립보드;FTP;네비게이션;도움말;윈도우;명령줄;도구;보기;사용자;태ㅂ;정렬;로그" #: ulng.rscmdkindofsort msgid "Legacy sorted;A-Z sorted" msgstr "기존 분류:A-Z 정렬" #: ulng.rscolattr msgid "Attr" msgstr "속성" #: ulng.rscoldate msgctxt "ulng.rscoldate" msgid "Date" msgstr "날짜" #: ulng.rscolext msgid "Ext" msgstr "확장자" #: ulng.rscolname msgctxt "ulng.rscolname" msgid "Name" msgstr "파일명" #: ulng.rscolsize msgctxt "ulng.rscolsize" msgid "Size" msgstr "크기" #: ulng.rsconfcolalign msgid "Align" msgstr "정렬" #: ulng.rsconfcolcaption msgid "Caption" msgstr "캡션" #: ulng.rsconfcoldelete msgctxt "ulng.rsconfcoldelete" msgid "Delete" msgstr "삭제" #: ulng.rsconfcolfieldcont msgid "Field contents" msgstr "필드 내용" #: ulng.rsconfcolmove msgctxt "ulng.rsconfcolmove" msgid "Move" msgstr "이동" #: ulng.rsconfcolwidth msgctxt "ulng.rsconfcolwidth" msgid "Width" msgstr "폭" #: ulng.rsconfcustheader msgid "Customize column" msgstr "단 사용자 설정" #: ulng.rsconfigurationfileassociation msgid "Configure file association" msgstr "파일 연결 환경설정" #: ulng.rsconfirmexecution msgid "Confirming command line and parameters" msgstr "명령줄과 매개변수 확인" #: ulng.rscopynametemplate msgid "Copy (%d) %s" msgstr "복사 (%d) %s" #: ulng.rsdefaultimporteddctoolbarhint msgid "Imported DC toolbar" msgstr "불러온 DC 도구상자" #: ulng.rsdefaultimportedtctoolbarhint msgid "Imported TC toolbar" msgstr "불러온 TC도구상자" #: ulng.rsdefaultsuffixdroppedtext msgid "_DroppedText" msgstr "_드롭된텍스트" #: ulng.rsdefaultsuffixdroppedtexthtmlfilename msgid "_DroppedHTMLtext" msgstr "_드롭된HTML텍스트" #: ulng.rsdefaultsuffixdroppedtextrichtextfilename msgid "_DroppedRichtext" msgstr "_드롭된 리치텍스트" #: ulng.rsdefaultsuffixdroppedtextsimplefilename msgid "_DroppedSimpleText" msgstr "_드롭된심플텍스트" #: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename msgid "_DroppedUnicodeUTF16text" msgstr "_드롭된유니코드UTF16텍스트" #: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename msgid "_DroppedUnicodeUTF8text" msgstr "_드롭된유니코드UTF8텍스트" #: ulng.rsdiffadds msgid " Adds: " msgstr " 추가: " #: ulng.rsdiffdeletes msgid " Deletes: " msgstr " 삭제: " #: ulng.rsdifffilesidentical msgid "The two files are identical!" msgstr "두 파일은 동일함!" #: ulng.rsdiffmatches msgid " Matches: " msgstr " 일치: " #: ulng.rsdiffmodifies msgid " Modifies: " msgstr " 수정: " #: ulng.rsdlgbuttonabort msgid "Ab&ort" msgstr "중단(&O)" #: ulng.rsdlgbuttonall msgctxt "ulng.rsdlgbuttonall" msgid "A&ll" msgstr "전체(&L)" #: ulng.rsdlgbuttonappend msgid "A&ppend" msgstr "덧붙이기(&P)" #: ulng.rsdlgbuttonautorenamesource msgid "A&uto-rename source files" msgstr "자동-이름변경 소스 파일(&U)" #: ulng.rsdlgbuttoncancel msgctxt "ulng.rsdlgbuttoncancel" msgid "&Cancel" msgstr "취소(&C)" #: ulng.rsdlgbuttoncompare msgid "Compare &by content" msgstr "" #: ulng.rsdlgbuttoncontinue msgid "&Continue" msgstr "계속(&C)" #: ulng.rsdlgbuttoncopyinto msgid "&Merge" msgstr "여기로 복사(&M)" #: ulng.rsdlgbuttoncopyintoall msgid "Mer&ge All" msgstr "모두 여기로 복사(&G)" #: ulng.rsdlgbuttonexitprogram msgid "E&xit program" msgstr "프로그램 종료(&X)" #: ulng.rsdlgbuttonignore msgid "Ig&nore" msgstr "" #: ulng.rsdlgbuttonignoreall msgid "I&gnore All" msgstr "모두 무시(&G)" #: ulng.rsdlgbuttonno msgid "&No" msgstr "아니요(&N)" #: ulng.rsdlgbuttonnone msgid "Non&e" msgstr "없음(&E)" #: ulng.rsdlgbuttonok msgctxt "ulng.rsdlgbuttonok" msgid "&OK" msgstr "확인(&O)" #: ulng.rsdlgbuttonother msgid "Ot&her" msgstr "다른 옵션(&H)" #: ulng.rsdlgbuttonoverwrite msgid "&Overwrite" msgstr "덮어쓰기(&O)" #: ulng.rsdlgbuttonoverwriteall msgid "Overwrite &All" msgstr "모두 덮어쓰기(&A)" #: ulng.rsdlgbuttonoverwritelarger msgid "Overwrite All &Larger" msgstr "큰 파일로 모두 덮어쓰기(&L)" #: ulng.rsdlgbuttonoverwriteolder msgid "Overwrite All Ol&der" msgstr "오래된 파일 덮어쓰기(&D)" #: ulng.rsdlgbuttonoverwritesmaller msgid "Overwrite All S&maller" msgstr "작은 파일로 모두 덮어쓰기(&M)" #: ulng.rsdlgbuttonrename msgctxt "ulng.rsdlgbuttonrename" msgid "R&ename" msgstr "이름 바꾸기(&E)" #: ulng.rsdlgbuttonresume msgid "&Resume" msgstr "재실행(&R)" #: ulng.rsdlgbuttonretry msgid "Re&try" msgstr "재시도(&T)" #: ulng.rsdlgbuttonretryadmin msgid "As Ad&ministrator" msgstr "" #: ulng.rsdlgbuttonskip msgid "&Skip" msgstr "건너뛰기(&S)" #: ulng.rsdlgbuttonskipall msgid "S&kip All" msgstr "모두 건너뛰기(&K)" #: ulng.rsdlgbuttonyes msgid "&Yes" msgstr "예(&Y)" #: ulng.rsdlgcp msgctxt "ulng.rsdlgcp" msgid "Copy file(s)" msgstr "파일 복사" #: ulng.rsdlgmv msgid "Move file(s)" msgstr "파일 이동" #: ulng.rsdlgoppause msgctxt "ulng.rsdlgoppause" msgid "Pau&se" msgstr "멈춤(&S)" #: ulng.rsdlgopstart msgctxt "ulng.rsdlgopstart" msgid "&Start" msgstr "실행(&S)" #: ulng.rsdlgqueue msgctxt "ulng.rsdlgqueue" msgid "Queue" msgstr "대기열" #: ulng.rsdlgspeed msgid "Speed %s/s" msgstr "속도 %s/초" #: ulng.rsdlgspeedtime msgid "Speed %s/s, time remaining %s" msgstr "속도 %s/초, 남은 시간 %s" #: ulng.rsdraganddroptextformat msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format" msgstr "" #: ulng.rsdrivenolabel msgid "" msgstr "<드라이브명 없음>" #: ulng.rsdrivenomedia msgid "" msgstr "<미디어파일 없음>" #: ulng.rseditabouttext msgid "Internal Editor of Double Commander." msgstr "더블커맨더 내부 편집기" #: ulng.rseditgotolinequery msgid "Goto line:" msgstr "줄로 가기:" #: ulng.rseditgotolinetitle msgctxt "ulng.rseditgotolinetitle" msgid "Goto Line" msgstr "줄로 가기" #: ulng.rseditnewfile msgid "new.txt" msgstr "새 텍스트 문서.txt" #: ulng.rseditnewfilename msgid "Filename:" msgstr "파일명:" #: ulng.rseditnewopen msgid "Open file" msgstr "파일 열기" #: ulng.rseditsearchback msgid "&Backward" msgstr "뒤로(&B)" #: ulng.rseditsearchcaption msgctxt "ulng.rseditsearchcaption" msgid "Search" msgstr "검색" #: ulng.rseditsearchfrw msgid "&Forward" msgstr "앞으로(&F)" #: ulng.rseditsearchreplace msgctxt "ulng.rseditsearchreplace" msgid "Replace" msgstr "바꾸기" #: ulng.rseditwithexternaleditor msgid "with external editor" msgstr "외부 편집기 사용" #: ulng.rseditwithinternaleditor msgid "with internal editor" msgstr "내부 편집기 사용" #: ulng.rsexecuteviashell msgctxt "ulng.rsexecuteviashell" msgid "Execute via shell" msgstr "쉘 명령어로 실행" #: ulng.rsexecuteviaterminalclose msgctxt "ulng.rsexecuteviaterminalclose" msgid "Execute via terminal and close" msgstr "명령프롬프트창에서 실행 후 닫기" #: ulng.rsexecuteviaterminalstayopen msgctxt "ulng.rsexecuteviaterminalstayopen" msgid "Execute via terminal and stay open" msgstr "명령프롬프트창에서 실행 후 계속 열린 상태로 두기" #: ulng.rsfavtabspanelsideselection msgid "Left;Right;Active;Inactive;Both;None" msgstr "왼쪽;오른쪽;활성;비활성;양쪽;없음" #: ulng.rsfavtabssavedirhistory msgid "No;Yes" msgstr "아니요;예" #: ulng.rsfilenameexportedtcbarprefix msgid "Exported_from_DC" msgstr "DC에서 내보내기된" #: ulng.rsfileopdirectoryexistsoptions #, fuzzy #| msgid "Ask;Overwrite;Copy into;Skip" msgid "Ask;Merge;Skip" msgstr "묻기;덮어쓰기;복사해 넣기;건너뛰기" #: ulng.rsfileopfileexistsoptions msgid "Ask;Overwrite;Overwrite Older;Skip" msgstr "묻기;덮어쓰기;오래된 파일 덮어쓰기;건너뛰기" #: ulng.rsfileopsetpropertyerroroptions msgctxt "ulng.rsfileopsetpropertyerroroptions" msgid "Ask;Don't set anymore;Ignore errors" msgstr "묻기;더 이상 설정 않기;오류 무시" #: ulng.rsfilterstatus msgid "FILTER" msgstr "필터" #: ulng.rsfinddefinetemplate msgid "Define template" msgstr "템플릿 정의" #: ulng.rsfinddepth msgid "%s level(s)" msgstr "%s 레벨" #: ulng.rsfinddepthall msgid "all (unlimited depth)" msgstr "모두 (무제한 깊이)" #: ulng.rsfinddepthcurdir msgid "current dir only" msgstr "현재 폴더만" #: ulng.rsfinddirnoex msgid "Directory %s does not exist!" msgstr "폴더 %s 없음!" #: ulng.rsfindfound msgctxt "ulng.rsfindfound" msgid "Found: %d" msgstr "찾음: %d" #: ulng.rsfindsavetemplatecaption msgid "Save search template" msgstr "검색 템플릿 저장" #: ulng.rsfindsavetemplatetitle msgid "Template name:" msgstr "템플릿명:" #: ulng.rsfindscanned msgctxt "ulng.rsfindscanned" msgid "Scanned: %d" msgstr "파일 찾기: %d" #: ulng.rsfindscanning msgid "Scanning" msgstr "파일 찾는중" #: ulng.rsfindsearchfiles msgctxt "ulng.rsfindsearchfiles" msgid "Find files" msgstr "파일 찾기" #: ulng.rsfindtimeofscan msgid "Time of scan: " msgstr "" #: ulng.rsfindwherebeg msgid "Begin at" msgstr "시작점" #: ulng.rsfreemsg msgid "Free %s from %s bytes" msgstr "%s 에 %s bytes 사용 가능" #: ulng.rsfreemsgshort msgid "%s bytes free" msgstr "%s 바이트 사용 가능" #: ulng.rsfuncatime msgid "Access date/time" msgstr "실행한 날짜/시간" #: ulng.rsfuncattr msgctxt "ulng.rsfuncattr" msgid "Attributes" msgstr "속성" #: ulng.rsfunccomment msgctxt "ulng.rsfunccomment" msgid "Comment" msgstr "주석" #: ulng.rsfunccompressedsize msgid "Compressed size" msgstr "압축된 크기" #: ulng.rsfuncctime msgid "Creation date/time" msgstr "날짜/시간 생성" #: ulng.rsfuncext msgid "Extension" msgstr "확장자" #: ulng.rsfuncgroup msgctxt "ulng.rsfuncgroup" msgid "Group" msgstr "그룹" #: ulng.rsfunchtime msgid "Change date/time" msgstr "날짜/시간 변경" #: ulng.rsfunclinkto msgid "Link to" msgstr "링크" #: ulng.rsfuncmtime msgid "Modification date/time" msgstr "수정한 날짜/시간" #: ulng.rsfuncname msgctxt "ulng.rsfuncname" msgid "Name" msgstr "파일명" #: ulng.rsfuncnamenoext msgid "Name without extension" msgstr "확장자 없이 파일명만" #: ulng.rsfuncowner msgctxt "ulng.rsfuncowner" msgid "Owner" msgstr "소유자" #: ulng.rsfuncpath msgctxt "ulng.rsfuncpath" msgid "Path" msgstr "경로" #: ulng.rsfuncsize msgctxt "ulng.rsfuncsize" msgid "Size" msgstr "크기" #: ulng.rsfunctype msgid "Type" msgstr "형태" #: ulng.rsharderrcreate msgid "Error creating hardlink." msgstr "생성된 하드링크 오류." #: ulng.rshotdirforcesortingorderchoices msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9" msgstr "none;파일명, a-z;파일명, z-a;확장자, a-z;확장자, z-a;크기 9-0;크기 0-9;날짜 9-0;날짜 0-9" #: ulng.rshotdirwarningabortrestorebackup msgid "" "Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n" "\n" "Are you sure you want to proceed?\n" msgstr "" "경고! a.hotlist 백업 파일, 불러오기한.\n" "으로 대체되어 삭제됩니다.\n" "계속 하기를 원합니까?\n" #: ulng.rshotkeycategorycopymovedialog msgid "Copy/Move Dialog" msgstr "복사/이동 대화상자" #: ulng.rshotkeycategorydiffer msgctxt "ulng.rshotkeycategorydiffer" msgid "Differ" msgstr "파일 비교" #: ulng.rshotkeycategoryeditcommentdialog msgid "Edit Comment Dialog" msgstr "주석 대화상자 편집" #: ulng.rshotkeycategoryeditor #, fuzzy msgctxt "ulng.rshotkeycategoryeditor" msgid "Editor" msgstr "편집기" #: ulng.rshotkeycategoryfindfiles #, fuzzy msgctxt "ulng.rshotkeycategoryfindfiles" msgid "Find files" msgstr "파일 찾기" #: ulng.rshotkeycategorymain msgid "Main" msgstr "주요정보" #: ulng.rshotkeycategorysyncdirs msgid "Synchronize Directories" msgstr "" #: ulng.rshotkeycategoryviewer msgctxt "ulng.rshotkeycategoryviewer" msgid "Viewer" msgstr "뷰어" #: ulng.rshotkeyfilealreadyexists msgid "" "A setup with that name already exists.\n" "Do you want to overwrite it?\n" msgstr "" #: ulng.rshotkeyfileconfirmdefault msgid "Are you sure you want to restore default?" msgstr "" #: ulng.rshotkeyfileconfirmerasure msgid "Are you sure you want to erase setup \"%s\"?" msgstr "" #: ulng.rshotkeyfilecopyof msgid "Copy of %s" msgstr "" #: ulng.rshotkeyfileinputnewname msgid "Input your new name" msgstr "" #: ulng.rshotkeyfilemustkeepone msgid "You must keep at least one shortcut file." msgstr "" #: ulng.rshotkeyfilenewname msgid "New name" msgstr "" #: ulng.rshotkeyfilesavemodified msgid "" "\"%s\" setup has been modified.\n" "Do you want to save it now?\n" msgstr "" #: ulng.rshotkeynoscenter msgid "No shortcut with \"ENTER\"" msgstr "" #: ulng.rshotkeysortorder msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)" msgstr "" #: ulng.rsimporttoolbarproblem msgid "Cannot find reference to default bar file" msgstr "기본 도구바 파일 참조를 찾을수 없음" #: ulng.rslistoffindfileswindows msgid "List of \"Find files\" windows" msgstr "" #: ulng.rsmarkminus msgid "Unselect mask" msgstr "비선택 마스크" #: ulng.rsmarkplus msgid "Select mask" msgstr "선택 마스크" #: ulng.rsmaskinput msgid "Input mask:" msgstr "삽입 마스크:" #: ulng.rsmenuconfigurecolumnsalreadyexists msgid "A columns view with that name already exists." msgstr "파일속성열보기 이름 이미 존재함." #: ulng.rsmenuconfigurecolumnssavetochange msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one" msgstr "현재 편집 파일속성열 보기, 저장,복사, 또는 삭제 변경" #: ulng.rsmenuconfigurecustomcolumns msgid "Configure custom columns" msgstr "사용자 파일속성열 환경설정" #: ulng.rsmenuconfigureentercustomcolumnname msgid "Enter new custom columns name" msgstr "새 사용자 파일속성열 이름 입력" #: ulng.rsmnuactions msgctxt "ulng.rsmnuactions" msgid "Actions" msgstr "액션" #: ulng.rsmnucontentdefault msgid "" msgstr "" #: ulng.rsmnucontentoctal msgid "Octal" msgstr "" #: ulng.rsmnucopynetnamestoclip msgid "Copy names with UNC path" msgstr "" #: ulng.rsmnudisconnectnetworkdrive msgid "Disconnect Network Drive..." msgstr "네트워크 드라이브 연결 끊기..." #: ulng.rsmnuedit msgctxt "ulng.rsmnuedit" msgid "Edit" msgstr "편집" #: ulng.rsmnueject msgid "Eject" msgstr "꺼내기" #: ulng.rsmnuextracthere msgid "Extract here..." msgstr "여기에 압축풀기..." #: ulng.rsmnumapnetworkdrive msgid "Map Network Drive..." msgstr "네트워크 드라이브 연결..." #: ulng.rsmnumount msgid "Mount" msgstr "마운트" #: ulng.rsmnunew msgctxt "ulng.rsmnunew" msgid "New" msgstr "새 파일" #: ulng.rsmnunomedia msgid "No media available" msgstr "미디어 없음" #: ulng.rsmnuopen msgctxt "ulng.rsmnuopen" msgid "Open" msgstr "열기" #: ulng.rsmnuopenwith msgid "Open with" msgstr "열기" #: ulng.rsmnuopenwithother msgctxt "ulng.rsmnuopenwithother" msgid "Other..." msgstr "다른 옵션..." #: ulng.rsmnupackhere msgid "Pack here..." msgstr "여기에 압축..." #: ulng.rsmnusortby msgid "Sort by" msgstr "정렬하기" #: ulng.rsmnuumount msgid "Unmount" msgstr "마운트 해제" #: ulng.rsmnuview msgctxt "ulng.rsmnuview" msgid "View" msgstr "보기" #: ulng.rsmsgaccount msgid "Account:" msgstr "계정:" #: ulng.rsmsgalldcintcmds msgid "All Double Commander internal commands" msgstr "" #: ulng.rsmsgarchivercustomparams msgid "Additional parameters for archiver command-line:" msgstr "압축기 명령줄의 부가 매개변수:" #: ulng.rsmsgaskquoteornot msgid "Do you want to enclose between quotes?" msgstr "" #: ulng.rsmsgbadcrc32 msgid "" "Bad CRC32 for resulting file:\n" "\"%s\"\n" "\n" "Do you want to keep the resulting corrupted file anyway?\n" msgstr "" "CRC32 결과 파일 상태 나쁨:\n" "\"%s\"\n" "\n" "훼손된 파일을 그대로 유지하겠습니까? \n" #: ulng.rsmsgcannotcopymoveitself msgid "You can not copy/move a file \"%s\" to itself!" msgstr "\"%s\"파일 자체를 복사/이동할 수 없습니다." #: ulng.rsmsgcannotdeletedirectory #, fuzzy,badformat msgid "Cannot delete directory %s" msgstr "폴더(디렉토리)삭제 할 수 없음" #: ulng.rsmsgcannotoverwritedirectory msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\"" msgstr "\"%s\" 디렉토리를 디렉토리가 아닌 \"%s\"로 덮어쓸 수 없음" #: ulng.rsmsgchdirfailed msgid "ChDir to [%s] failed!" msgstr "[%s] 디렉토리 변경 실패!" #: ulng.rsmsgcloseallinactivetabs msgid "Remove all inactive tabs?" msgstr "비활성 탭 모두 제거?" #: ulng.rsmsgcloselockedtab msgid "This tab (%s) is locked! Close anyway?" msgstr "이 탭(%s) 잠겼음! 어쨌든 닫을까요?" #: ulng.rsmsgcofirmuserparam msgid "Confirmation of parameter" msgstr "" #: ulng.rsmsgconfirmquit msgid "Are you sure you want to quit?" msgstr "정말로 끝내기를 원하시나요?" #: ulng.rsmsgcopybackward msgid "The file %s has changed. Do you want to copy it backward?" msgstr "파일 %s가 변경됨. 뒤로(backward) 복사를 원하시나요?" #: ulng.rsmsgcouldnotcopybackward msgid "Could not copy backward - do you want to keep the changed file?" msgstr "반대로 복사할 수 없음 - 변경된 파일을 유지하겠습니까?" #: ulng.rsmsgcpfldr msgid "Copy %d selected files/directories?" msgstr "선택된 %d개의 파일/폴더를 복사할까요?" #: ulng.rsmsgcpsel msgid "Copy selected \"%s\"?" msgstr "선택된\"%s\" 복사할까요?" #: ulng.rsmsgcreateanewfiletype msgid "< Create a new file type \"%s files\" >" msgstr "<새 파일 형태 생성 \"%s files\" >" #: ulng.rsmsgdctoolbarwheretosave msgid "Enter location and filename where to save a DC Toolbar file" msgstr "DC 도구상자 파일을 저장할 위치와 파일명을 입력" #: ulng.rsmsgdefaultcustomactionname msgid "Custom action" msgstr "사용자 액션" #: ulng.rsmsgdeletepartiallycopied msgid "Delete the partially copied file ?" msgstr "복사된 파일을 부분적으로 삭제할까요?" #: ulng.rsmsgdelfldr msgid "Delete %d selected files/directories?" msgstr "선택된 %d개의 파일/폴더를 삭제할까요?" #: ulng.rsmsgdelfldrt msgid "Delete %d selected files/directories into trash can?" msgstr "선택된 %d개의 파일을 휴지통으로 삭제할까요?" #: ulng.rsmsgdelsel msgid "Delete selected \"%s\"?" msgstr "선택된 \"%s\" 삭제?" #: ulng.rsmsgdelselt msgid "Delete selected \"%s\" into trash can?" msgstr "선택된 \"%s\" 휴지통으로 삭제할까요?" #: ulng.rsmsgdeltotrashforce msgid "Can not delete \"%s\" to trash! Delete directly?" msgstr "\"%s\"를 휴지통으로 삭제할 수 없습니다! 바로 삭제할까요?" #: ulng.rsmsgdisknotavail msgid "Disk is not available" msgstr "디스크를 사용할 수 없습니다" #: ulng.rsmsgentercustomaction msgid "Enter custom action name:" msgstr "사용자 액션명 입력:" #: ulng.rsmsgenterfileext msgid "Enter file extension:" msgstr "파일 확장자 입력:" #: ulng.rsmsgentername msgid "Enter name:" msgstr "파일명 입력:" #: ulng.rsmsgenternewfiletypename msgid "Enter name of new file type to create for extension \"%s\"" msgstr "\"%s\" 확장자 생성을 위해 새 파일 형태의 이름을 입력" #: ulng.rsmsgerrbadarchive msgid "CRC error in archive data" msgstr "압축 데이터에 CRC 오류 발생" #: ulng.rsmsgerrbaddata msgid "Data is bad" msgstr "데이터에 문제가 있습니다." #: ulng.rsmsgerrcannotconnect msgid "Can not connect to server: \"%s\"" msgstr "서버에 연결할 수 없습니다: \"%s\"" #: ulng.rsmsgerrcannotcopyfile msgid "Cannot copy file %s to %s" msgstr "%s 에서 %s로 복사할 수 없음" #: ulng.rsmsgerrcreatefiledirectoryexists msgid "There already exists a directory named \"%s\"." msgstr "\"%s\" 이름의 폴더가 있습니다." #: ulng.rsmsgerrdatenotsupported msgid "Date %s is not supported" msgstr "%s 날짜 지원 안됨" #: ulng.rsmsgerrdirexists msgid "Directory %s exists!" msgstr "%s 폴더가 이미 존재함!" #: ulng.rsmsgerreaborted msgid "Function aborted by user" msgstr "사용자에게 중지된 기능" #: ulng.rsmsgerreclose msgid "Error closing file" msgstr "파일 닫기 오류" #: ulng.rsmsgerrecreate msgid "Cannot create file" msgstr "파일 생성할 수 없음" #: ulng.rsmsgerrendarchive msgid "No more files in archive" msgstr "압축파일에 파일 없음" #: ulng.rsmsgerreopen msgid "Cannot open existing file" msgstr "존재하는 파일 열 수 없음" #: ulng.rsmsgerreread msgid "Error reading from file" msgstr "파일로부터 읽기 오류" #: ulng.rsmsgerrewrite msgid "Error writing to file" msgstr "파일에 쓰기 오류" #: ulng.rsmsgerrforcedir #, fuzzy,badformat msgid "Can not create directory %s!" msgstr "폴더(디렉토리)를 생성할 수 없음!" #: ulng.rsmsgerrinvalidlink msgid "Invalid link" msgstr "불분명한 링크" #: ulng.rsmsgerrnofiles msgid "No files found" msgstr "파일 없음" #: ulng.rsmsgerrnomemory msgid "Not enough memory" msgstr "메모리 부족" #: ulng.rsmsgerrnotsupported msgid "Function not supported!" msgstr "기능이 지원되지 않음!" #: ulng.rsmsgerrorincontextmenucommand msgid "Error in context menu command" msgstr "내용 메뉴 명령 오류" #: ulng.rsmsgerrorloadingconfiguration msgid "Error when loading configuration" msgstr "환경설정 파일 불러오기 오류" #: ulng.rsmsgerrregexpsyntax msgid "Syntax error in regular expression!" msgstr "일반 구문표현 오류!" #: ulng.rsmsgerrrename msgid "Cannot rename file %s to %s" msgstr "%s에서 %s로 파일명을 변경할 수 없음" #: ulng.rsmsgerrsaveassociation msgid "Can not save association!" msgstr "연결을 저장할 수 없음!" #: ulng.rsmsgerrsavefile msgid "Cannot save file" msgstr "파일을 저장할 수 없음" #: ulng.rsmsgerrsetattribute msgid "Can not set attributes for \"%s\"" msgstr "\"%s\" 속성을 설정할 수 없음" #: ulng.rsmsgerrsetdatetime msgid "Can not set date/time for \"%s\"" msgstr "\"%s\" 날짜/시간 설정할 수 없음" #: ulng.rsmsgerrsetownership msgid "Can not set owner/group for \"%s\"" msgstr "\"%s\" 소유자/그룹을 설정할 수 없음" #: ulng.rsmsgerrsetpermissions msgid "Can not set permissions for \"%s\"" msgstr "\"%s\" 퍼미션을 지정할 수 없음" #: ulng.rsmsgerrsmallbuf msgid "Buffer too small" msgstr "버퍼 너무 작음" #: ulng.rsmsgerrtoomanyfiles msgid "Too many files to pack" msgstr "압축할 파일 많음" #: ulng.rsmsgerrunknownformat msgid "Archive format unknown" msgstr "압축 포맷 알 수 없음" #: ulng.rsmsgfavoritetabsdeleteallentries msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)" msgstr "즐겨찾기탭 목록을 모두 삭제하시겠습니까? (\"되돌리기\" 실행되지 않음!)" #: ulng.rsmsgfavoritetabsdraghereentry msgid "Drag here other entries" msgstr "다른 목록을 여기에 드래그" #: ulng.rsmsgfavoritetabsentername msgid "Enter a name this Favorite Tabs entry" msgstr "이 즐겨찾기탭 목록에 이름 입력" #: ulng.rsmsgfavoritetabsenternametitle msgid "Saving a new Favorite Tabs entry" msgstr "새로운 즐겨찾기탭 목록 저장" #: ulng.rsmsgfavoritetabsexportedsuccessfully msgid "Number of Favorite Tabs exported successfully: %d on %d" msgstr "즐겨찾기탭 성공적으로 내보내기 함: %d / %d " #: ulng.rsmsgfavoritetabsextramode msgid "Default extra setting for save dir history for new Favorite Tabs:" msgstr "새 즐겨찾기탭 폴더 히스토리 저장을 우한 추가 설정:" #: ulng.rsmsgfavoritetabsimportedsuccessfully msgid "Number of file(s) imported successfully: %d on %d" msgstr "성공적으로 파일 불러오기됨: %d / %d" #: ulng.rsmsgfavoritetabsimportsubmenuname msgid "Legacy tabs imported" msgstr "기존 탭 불러오기" #: ulng.rsmsgfavoritetabsimporttitle msgid "Select .tab file(s) to import (could be more than one at the time!)" msgstr "불러오기할 .tab 파일 선택(여러개 선택 가능!)" #: ulng.rsmsgfavoritetabsmodifiednoimport msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?" msgstr "마지막 탭 설정 저장이 아직 완료되지 않음. 먼저 저장하시겠습니까?" #: ulng.rsmsgfavoritetabssimplemode msgctxt "ulng.rsmsgfavoritetabssimplemode" msgid "Keep saving dir history with Favorite Tabs:" msgstr "즐겨찾기탭 저장 히스토리 유지:" #: ulng.rsmsgfavoritetabssubmenuname msgctxt "ulng.rsmsgfavoritetabssubmenuname" msgid "Submenu name" msgstr "하위메뉴명" #: ulng.rsmsgfavoritetabsthiswillloadfavtabs msgid "This will load the Favorite Tabs: \"%s\"" msgstr "즐겨찾기탭 로드됨: \"%s\"" #: ulng.rsmsgfavortietabssaveoverexisting msgid "Save current tabs over existing Favorite Tabs entry" msgstr "현재탭을 즐겨찾기탭에 저장" #: ulng.rsmsgfilechangedsave msgid "File %s changed, save?" msgstr "파일 %s 변경됨, 저장할까요?" #: ulng.rsmsgfileexistsfileinfo msgid "%s bytes, %s" msgstr "%s 바이트, %s" #: ulng.rsmsgfileexistsoverwrite msgid "Overwrite:" msgstr "덮어쓰기:" #: ulng.rsmsgfileexistsrwrt msgid "File %s exists, overwrite?" msgstr "%s 파일이 존재함, 덮어쓸까요?" #: ulng.rsmsgfileexistswithfile msgid "With file:" msgstr "이 파일을:" #: ulng.rsmsgfilenotfound msgid "File \"%s\" not found." msgstr "파일 \"%s\" 찾을 수 없음." #: ulng.rsmsgfileoperationsactive msgid "File operations active" msgstr "파일 작업 중" #: ulng.rsmsgfileoperationsactivelong msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss." msgstr "파일 작업 완료되지 않음. 더블커맨더를 닫으면 자료 손실이 발생할 수도 있음." #: ulng.rsmsgfilepathovermaxpath msgid "" "The target name length (%d) is more than %d characters!\n" "%s\n" "Most programs will not be able to access a file/directory with such a long name!\n" msgstr "" #: ulng.rsmsgfilereadonly #, fuzzy #| msgid "File %s is marked as read-only. Delete it?" msgid "File %s is marked as read-only/hidden/system. Delete it?" msgstr "선택된 %s 파일은 읽기 속성입니다. 삭제할까요?" #: ulng.rsmsgfilereloadwarning msgid "Are you sure you want to reload the current file and lose the changes?" msgstr "" #: ulng.rsmsgfilesizetoobig msgid "The file size of \"%s\" is too big for destination file system!" msgstr "\"%s\" 파일 크기가 복사될 파일시스템에는 너무 큽니다!" #: ulng.rsmsgfolderexistsrwrt #, fuzzy #| msgid "Folder %s exists, overwrite?" msgid "Folder %s exists, merge?" msgstr "%s 폴더가 있습니다, 덮어쓸까요?" #: ulng.rsmsgfollowsymlink msgid "Follow symlink \"%s\"?" msgstr "\"%s\"심링크를 따라갈까요?" #: ulng.rsmsgfortextformattoimport msgid "Select the text format to import" msgstr "가져오기하려는 다음 텍스트 형태 선택" #: ulng.rsmsghotdiraddselecteddirectories msgid "Add %d selected dirs" msgstr "%d 선택된 폴더(디렉토리)추가" #: ulng.rsmsghotdiraddselecteddirectory msgid "Add selected dir: " msgstr "선택된 폴더(디렉토리)추가: " #: ulng.rsmsghotdiraddthisdirectory msgid "Add current dir: " msgstr "현재 디렉토리(폴더)추가: " #: ulng.rsmsghotdircommandname msgid "Do command" msgstr "명령어 실행" #: ulng.rsmsghotdircommandsample msgid "cm_somthing" msgstr "cm_somthing" #: ulng.rsmsghotdirconfighotlist msgctxt "ulng.rsmsghotdirconfighotlist" msgid "Configuration of Directory Hotlist" msgstr "폴더 바로 가기 환경설정" #: ulng.rsmsghotdirdeleteallentries msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)" msgstr "폴더 바로 가기 설정을 모두 삭제할까요? (\"되돌리기\" 실행 안됨!)" #: ulng.rsmsghotdirdemocommand msgid "This will execute the following command:" msgstr "다음 명령어가 실행됨:" #: ulng.rsmsghotdirdemoname msgid "This is hot dir named " msgstr "이것은 바로 가기 이름임" #: ulng.rsmsghotdirdemopath msgid "This will change active frame to the following path:" msgstr "이것은 실행 경로의 활성 프레임을 변경함:" #: ulng.rsmsghotdirdemotarget msgid "And inactive frame would change to the following path:" msgstr "그리고 비활성 프레임은 실행경로를 변경함:" #: ulng.rsmsghotdirerrorbackuping msgid "Error backuping entries..." msgstr "목록 백업 오류..." #: ulng.rsmsghotdirerrorexporting msgid "Error exporting entries..." msgstr "목록 내보내기 오류..." #: ulng.rsmsghotdirexportall msgid "Export all!" msgstr "전부 내보내기!" #: ulng.rsmsghotdirexporthotlist msgid "Export Directory Hotlist - Select the entries you want to export" msgstr "폴더 바로 가기 내보내기 - 내보내기하려는 목록 선택" #: ulng.rsmsghotdirexportsel msgid "Export selected" msgstr "선택 내보내기" #: ulng.rsmsghotdirimportall msgctxt "ulng.rsmsghotdirimportall" msgid "Import all!" msgstr "모두 불러오기!" #: ulng.rsmsghotdirimporthotlist msgid "Import Directory Hotlist - Select the entries you want to import" msgstr "폴더 바로 가기 가져오기 - 가져오려는 목록 선택" #: ulng.rsmsghotdirimportsel msgctxt "ulng.rsmsghotdirimportsel" msgid "Import selected" msgstr "선택 불러오기" #: ulng.rsmsghotdirjustpath #, fuzzy #| msgid "Path" msgctxt "ulng.rsmsghotdirjustpath" msgid "&Path:" msgstr "경로" #: ulng.rsmsghotdirlocatehotlistfile msgid "Locate \".hotlist\" file to import" msgstr "가져오기 \".hotlist\" 파일 위치" #: ulng.rsmsghotdirname msgid "Hotdir name" msgstr "바로 가기 폴더명" #: ulng.rsmsghotdirnbnewentries msgid "Number of new entries: %d" msgstr "새 목록 갯수: %d" #: ulng.rsmsghotdirnothingtoexport msgid "Nothing selected to export!" msgstr "내보내기 선택되지 않음!" #: ulng.rsmsghotdirpath msgid "Hotdir path" msgstr "바로 가기 경로" #: ulng.rsmsghotdirreaddselecteddirectory msgid "Re-Add selected dir: " msgstr "선택 폴더 다시 추가: " #: ulng.rsmsghotdirreaddthisdirectory msgid "Re-Add current dir: " msgstr "현재 폴더 추가: " #: ulng.rsmsghotdirrestorewhat msgid "Enter location and filename of Directory Hotlist to restore" msgstr "복구하려는 폴더 바로 가기 위치와 파일명 입력" #: ulng.rsmsghotdirsimplecommand msgctxt "ulng.rsmsghotdirsimplecommand" msgid "Command:" msgstr "명령어:" #: ulng.rsmsghotdirsimpleendofmenu msgctxt "ulng.rsmsghotdirsimpleendofmenu" msgid "(end of sub menu)" msgstr "(하위메뉴 끝)" #: ulng.rsmsghotdirsimplemenu #, fuzzy #| msgid "Menu name:" msgctxt "ulng.rsmsghotdirsimplemenu" msgid "Menu &name:" msgstr "메뉴명:" #: ulng.rsmsghotdirsimplename #, fuzzy #| msgid "Name:" msgctxt "ulng.rsmsghotdirsimplename" msgid "&Name:" msgstr "파일명:" #: ulng.rsmsghotdirsimpleseparator msgctxt "ulng.rsmsghotdirsimpleseparator" msgid "(separator)" msgstr "(구분자)" #: ulng.rsmsghotdirsubmenuname msgctxt "ulng.rsmsghotdirsubmenuname" msgid "Submenu name" msgstr "하위메뉴명" #: ulng.rsmsghotdirtarget msgid "Hotdir target" msgstr "바로 가기 대상" #: ulng.rsmsghotdirtiporderpath msgid "Determine if you want the active frame to be sorted in a specified order after changing directory" msgstr "폴더(디렉토리)변경 후 지정한 방식 활성 프레임 정렬 지정" #: ulng.rsmsghotdirtipordertarget msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory" msgstr "폴더(디렉토리)변경 후 지정한 방식 비활성 프레임 정렬 지정" #: ulng.rsmsghotdirtipspecialdirbut msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc." msgstr "적절한 상대경로, 절대경로, 윈도 특정 폴더를 선택 기능" #: ulng.rsmsghotdirtotalbackuped msgid "" "Total entries saved: %d\n" "\n" "Backup filename: %s\n" msgstr "" "전체 목록 저장: %d\n" "\n" "백업 파일명: %s\n" #: ulng.rsmsghotdirtotalexported msgid "Total entries exported: " msgstr "전체 목록 내보내기됨: " #: ulng.rsmsghotdirwhattodelete msgid "" "Do you want to delete all elements inside the sub-menu [%s]?\n" "Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n" msgstr "" "하위메뉴의 모든 요소를 삭제하시겠습니까? [%s]?\n" "'아니오'를 선택하면 메뉴 구분문자만 삭제하고 하위메뉴 요소는 보관됩니다.\n" #: ulng.rsmsghotdirwheretosave msgid "Enter location and filename where to save a Directory Hotlist file" msgstr "폴더(디렉토리) 바로 가기 파일을 저장할 장소와 파일명을 입력" #: ulng.rsmsgincorrectfilelength msgid "Incorrect resulting filelength for file : \"%s\"" msgstr "잘못된 파일명 길이 결과: \"%s\"" #: ulng.rsmsginsertnextdisk msgid "" "Please insert next disk or something similar.\n" "\n" "It is to allow writing this file:\n" "\"%s\"\n" "\n" "Number of bytes still to write: %d\n" msgstr "" "다음 디스크를 삽입하세요.\n" "\n" "쓰기가 허용되어 있습니다.:\n" "\"%s\"\n" "\n" "바이트 쓰는 중: %d\n" #: ulng.rsmsginvalidcommandline msgid "Error in command line" msgstr "명령 프롬프트 오류" #: ulng.rsmsginvalidfilename msgid "Invalid filename" msgstr "잘못된 파일명" #: ulng.rsmsginvalidformatofconfigurationfile msgid "Invalid format of configuration file" msgstr "불분명한 환경설정 파일 형태" #: ulng.rsmsginvalidhexnumber msgid "Invalid hexadecimal number: \"%s\"" msgstr "" #: ulng.rsmsginvalidpath msgid "Invalid path" msgstr "잘못된 경로" #: ulng.rsmsginvalidpathlong msgid "Path %s contains forbidden characters." msgstr "%s 경로에 금지된 문자열이 포함됨." #: ulng.rsmsginvalidplugin msgid "This is not a valid plugin!" msgstr "유효한 플러그인 아님!" #: ulng.rsmsginvalidpluginarchitecture #, fuzzy,badformat msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!" msgstr "이것은 더블커맨더 %를 위한 플러그인입니다!" #: ulng.rsmsginvalidquoting msgid "Invalid quoting" msgstr "인용 오류" #: ulng.rsmsginvalidselection msgid "Invalid selection." msgstr "잘못된 선택." #: ulng.rsmsgloadingfilelist msgid "Loading file list..." msgstr "파일 목록 불러오기..." #: ulng.rsmsglocatetcconfiguation msgid "Locate TC configuration file (wincmd.ini)" msgstr "TC 환경설정 파일(wincmd.ini) 위치" #: ulng.rsmsglocatetcexecutable msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)" msgstr "TC 실행파일 위치(totalcmd.exe or totalcmd64.exe)" #: ulng.rsmsglogcopy msgid "Copy file %s" msgstr "%s 파일 복사" #: ulng.rsmsglogdelete msgid "Delete file %s" msgstr "%s 파일 삭제" #: ulng.rsmsglogerror msgid "Error: " msgstr "오류: " #: ulng.rsmsglogextcmdlaunch msgid "Launch external" msgstr "외부 프로그램 실행" #: ulng.rsmsglogextcmdresult msgid "Result external" msgstr "외부 결과" #: ulng.rsmsglogextract msgid "Extract file %s" msgstr "%s 파일 압축 풀기" #: ulng.rsmsgloginfo msgid "Info: " msgstr "정보: " #: ulng.rsmsgloglink msgid "Create link %s" msgstr "%s 링크 생성" #: ulng.rsmsglogmkdir msgid "Create directory %s" msgstr "%s 폴더 생성" #: ulng.rsmsglogmove msgid "Move file %s" msgstr "%s 파일 이동" #: ulng.rsmsglogpack msgid "Pack to file %s" msgstr "%s 파일로 압축" #: ulng.rsmsglogrmdir msgid "Remove directory %s" msgstr "%s 디렉토리 제거" #: ulng.rsmsglogsuccess msgid "Done: " msgstr "완료: " #: ulng.rsmsglogsymlink msgid "Create symlink %s" msgstr "%s 심링크 생성" #: ulng.rsmsglogtest msgid "Test file integrity %s" msgstr "%s 파일 무결성 테스트" #: ulng.rsmsglogwipe msgid "Wipe file %s" msgstr "%s 파일 삭제" #: ulng.rsmsglogwipedir msgid "Wipe directory %s" msgstr "%s 폴더 완전 삭제" #: ulng.rsmsgmasterpassword msgid "Master Password" msgstr "마스터 비밀번호" #: ulng.rsmsgmasterpasswordenter msgid "Please enter the master password:" msgstr "마스터 비밀번호를 입력하세요:" #: ulng.rsmsgnewfile msgid "New file" msgstr "새 파일" #: ulng.rsmsgnextvolunpack msgid "Next volume will be unpacked" msgstr "다음 파일이 압축해제될것입니다." #: ulng.rsmsgnofiles msgid "No files" msgstr "파일 없음" #: ulng.rsmsgnofilesselected msgid "No files selected." msgstr "파일 선택 안됨." #: ulng.rsmsgnofreespacecont msgid "No enough free space on target drive, Continue?" msgstr "드라이브에 공간이 부족합니다. 계속할까요?" #: ulng.rsmsgnofreespaceretry msgid "No enough free space on target drive, Retry?" msgstr "드라이브에 공간이 부족합니다. 다시 시도할까요?" #: ulng.rsmsgnotdelete msgid "Can not delete file %s" msgstr "%s 파일을 삭제할 수 없습니다." #: ulng.rsmsgnotimplemented msgid "Not implemented." msgstr "구현되지 않음." #: ulng.rsmsgobjectnotexists msgid "Object does not exist!" msgstr "" #: ulng.rsmsgpanelpreview msgctxt "ulng.rsmsgpanelpreview" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "아래는 미리보기임. 커서를 움직이거 파일을 선택하여 실제 설정을 확인할 수 있습니다." #: ulng.rsmsgpassword msgid "Password:" msgstr "비밀번호:" #: ulng.rsmsgpassworddiff msgid "Passwords are different!" msgstr "비밀번호가 다릅니다!" #: ulng.rsmsgpasswordenter msgid "Please enter the password:" msgstr "비밀번호를 입력하세요:" #: ulng.rsmsgpasswordfirewall msgid "Password (Firewall):" msgstr "비밀번호 (방화벽):" #: ulng.rsmsgpasswordverify msgid "Please re-enter the password for verification:" msgstr "확인을 위해 비밀번호를 다시 입력하세요:" #: ulng.rsmsgpopuphotdelete msgid "&Delete %s" msgstr "%s 삭제(&D)" #: ulng.rsmsgpresetalreadyexists msgid "Preset \"%s\" already exists. Overwrite?" msgstr "\"%s\" 프리셋이 존재함. 덮어쓸까요?" #: ulng.rsmsgproblemexecutingcommand msgid "Problem executing command (%s)" msgstr "(%s) 명령어 실행 문제 있음" #: ulng.rsmsgpromptaskingfilename msgid "Filename for dropped text:" msgstr "드롭 텍스트 파일명:" #: ulng.rsmsgprovidethisfile msgid "Please, make this file available. Retry?" msgstr "이 파일을 사용할 수 있게 하세요. 다시 시도할까요?" #: ulng.rsmsgrenamefavtabs msgid "Enter new friendly name for this Favorite Tabs" msgstr "이 즐겨찾기탭에 새로운 이름을 입력하세요." #: ulng.rsmsgrenamefavtabsmenu msgid "Enter new name for this menu" msgstr "이 메뉴 새 이름 입력" #: ulng.rsmsgrenfldr msgid "Rename/move %d selected files/directories?" msgstr "%d개 선택된 파일과 폴더를 이름 바꾸기/이동할까요?" #: ulng.rsmsgrensel msgid "Rename/move selected \"%s\"?" msgstr "선택된 \"%s\" 이름 바꾸기/이동할까요?" #: ulng.rsmsgrestartforapplychanges msgid "Please, restart Double Commander in order to apply changes" msgstr "변경된 설정을 적용하려면 더블커맨더를 재실행하세요." #: ulng.rsmsgsekectfiletype msgid "Select to which file type to add extension \"%s\"" msgstr "추가하려는 \"%s\" 파일확장자를 선택하세요." #: ulng.rsmsgselectedinfo msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d" msgstr "선택됨[용량:%s/%s, 파일: %d/%d, 폴더: %d/%d]" #: ulng.rsmsgselectexecutablefile msgid "Select executable file for" msgstr "실행할 파일 선택" #: ulng.rsmsgselectonlychecksumfiles msgid "Please select only checksum files!" msgstr "체크섬 파일만 선택하세요!" #: ulng.rsmsgsellocnextvol msgid "Please select location of next volume" msgstr "다음 볼륨의 위치를 선택하세요." #: ulng.rsmsgsetvolumelabel msgid "Set volume label" msgstr "볼륨 라벨 지정" #: ulng.rsmsgspecialdir msgid "Special Dirs" msgstr "특별 디렉토리" #: ulng.rsmsgspecialdiraddacti msgid "Add path from active frame" msgstr "활성 프레임에 경로 추가" #: ulng.rsmsgspecialdiraddnonacti msgid "Add path from inactive frame" msgstr "비활성 프레임에 경로 추가" #: ulng.rsmsgspecialdirbrowssel msgid "Browse and use selected path" msgstr "선택된 경로 탐색 및 사용" #: ulng.rsmsgspecialdirenvvar msgid "Use environment variable..." msgstr "환경 변수 사용..." #: ulng.rsmsgspecialdirgotodc msgid "Go to Double Commander special path..." msgstr "더블커맨더 특별 경로로 가기..." #: ulng.rsmsgspecialdirgotoenvvar msgid "Go to environment variable..." msgstr "환경 변수로 가기..." #: ulng.rsmsgspecialdirgotoother msgid "Go to other Windows special folder..." msgstr "다른 윈도 특별 폴더로 가기..." #: ulng.rsmsgspecialdirgototc msgid "Go to Windows special folder (TC)..." msgstr "윈도 특별 폴더(TC)로 가기..." #: ulng.rsmsgspecialdirmakereltohotdir msgid "Make relative to hotdir path" msgstr "상대경로 바로 가기 경로 만들기" #: ulng.rsmsgspecialdirmkabso msgid "Make path absolute" msgstr "절대경로 만들기" #: ulng.rsmsgspecialdirmkdcrel msgid "Make relative to Double Commander special path..." msgstr "더블커맨더 특별경로 상대경로 만들기..." #: ulng.rsmsgspecialdirmkenvrel msgid "Make relative to environment variable..." msgstr "환경변수에 대한 상대값 만들기..." #: ulng.rsmsgspecialdirmktctel msgid "Make relative to Windows special folder (TC)..." msgstr "윈도 특별 폴더(TC) 상대경로 만들기..." #: ulng.rsmsgspecialdirmkwnrel msgid "Make relative to other Windows special folder..." msgstr "다른 윈도 특별 폴더에 상대경로 만들기..." #: ulng.rsmsgspecialdirusedc msgid "Use Double Commander special path..." msgstr "더블커맨더 특별 경로 사용..." #: ulng.rsmsgspecialdirusehotdir msgid "Use hotdir path" msgstr "바로 가기 경로 사용" #: ulng.rsmsgspecialdiruseother msgid "Use other Windows special folder..." msgstr "다른 윈도 특별 폴더 사용..." #: ulng.rsmsgspecialdirusetc msgid "Use Windows special folder (TC)..." msgstr "윈도 특별 폴더(TC) 사용..." #: ulng.rsmsgtabforopeninginnewtab msgid "This tab (%s) is locked! Open directory in another tab?" msgstr "이 탭(%s)은 잠겼음! 다른 탭에 폴더(디렉토리)를 열까요?" #: ulng.rsmsgtabrenamecaption msgid "Rename tab" msgstr "탭 이름 바꾸기" #: ulng.rsmsgtabrenameprompt msgid "New tab name:" msgstr "새 탭 이름:" #: ulng.rsmsgtargetdir msgid "Target path:" msgstr "지정할 경로:" #: ulng.rsmsgtcconfignotfound msgid "" "Error! Cannot find the TC configuration file:\n" "%s\n" msgstr "" "오류! TC(토탈커맨더) 환경설정 파일을 찾을 수 없음:\n" "%s\n" #: ulng.rsmsgtcexecutablenotfound msgid "" "Error! Cannot find the TC configuration executable:\n" "%s\n" msgstr "" "오류! TC(토탈커맨더) 환경설정 파일을 찾을 수 없음:\n" "%s\n" #: ulng.rsmsgtcisrunning msgid "" "Error! TC is still running but it should be closed for this operation.\n" "Close it and press OK or press CANCEL to abort.\n" msgstr "" "오류! TC(토탈커맨더) 실행중이서 작업을 실행할 수 없습니다.\n" "실행 최소를 위해 작업을 종료한 후 '확인' 또는 '취소' 버튼을 누르세요.\n" #: ulng.rsmsgtctoolbarnotfound msgid "" "Error! Cannot find the desired wanted TC toolbar output folder:\n" "%s\n" msgstr "" "오류! TC(토탈커맨더) 내보내기 폴더를 찾을 수 없습니다.:\n" "%s\n" #: ulng.rsmsgtctoolbarwheretosave msgid "Enter location and filename where to save a TC Toolbar file" msgstr "TC 툴바 파일을 저장할 파일명과 위치를 입력하세요." #: ulng.rsmsgthisisnowinclipboard msgid "\"%s\" is now in the clipboard" msgstr "\"%s\"이 클립보드에 있음" #: ulng.rsmsgtitleextnotinfiletype msgid "Extension of selected file is not in any recognized file types" msgstr "선택된 파일의 확장자를 인식할 수 없음" #: ulng.rsmsgtoolbarlocatedctoolbarfile msgid "Locate \".toolbar\" file to import" msgstr "\".toolbar\"파일 불러오기 위치" #: ulng.rsmsgtoolbarlocatetctoolbarfile msgid "Locate \".BAR\" file to import" msgstr "\".BAR\" 파일 불러오기 위치" #: ulng.rsmsgtoolbarrestorewhat msgid "Enter location and filename of Toolbar to restore" msgstr "복구를 위한 툴바 파일명 위치 입력" #: ulng.rsmsgtoolbarsaved msgid "" "Saved!\n" "Toolbar filename: %s\n" msgstr "" "저장 완료!\n" "툴바 파일명: %s\n" #: ulng.rsmsgtoomanyfilesselected msgid "Too many files selected." msgstr "너무 많은 파일 선택." #: ulng.rsmsgundeterminednumberoffile msgid "Undetermined" msgstr "손상됨" #: ulng.rsmsgunexpectedusagetreeviewmenu msgid "ERROR: Unexpected Tree View Menu usage!" msgstr "" #: ulng.rsmsgurl msgid "URL:" msgstr "URL:" #: ulng.rsmsguserdidnotsetextension msgid "" msgstr "<확장자 없음: NO EXT>" #: ulng.rsmsguserdidnotsetname msgid "" msgstr "<파일명 없음: No NAME>" #: ulng.rsmsgusername msgid "User name:" msgstr "사용자 명:" #: ulng.rsmsgusernamefirewall msgid "User name (Firewall):" msgstr "사용자명(방화벽):" #: ulng.rsmsgverify msgid "VERIFICATION:" msgstr "" #: ulng.rsmsgverifywrong msgid "The target file is corrupted, checksum mismatch!" msgstr "" #: ulng.rsmsgvolumelabel msgid "Volume label:" msgstr "볼률 레이블:" #: ulng.rsmsgvolumesizeenter msgid "Please enter the volume size:" msgstr "볼륨 크기를 입력하세요:" #: ulng.rsmsgwipefldr msgid "Wipe %d selected files/directories?" msgstr "%d 선택된 파일/폴더를 완전삭제(휴지통X)할까요?" #: ulng.rsmsgwipesel msgid "Wipe selected \"%s\"?" msgstr "선택된 \"%s\" 완전 삭제(휴지통X)할까요?" #: ulng.rsmsgwithactionwith msgid "with" msgstr "함께" #: ulng.rsmsgwrongpasswordtryagain msgid "" "Wrong password!\n" "Please try again!\n" msgstr "" #: ulng.rsmulrenautorename msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?" msgstr "" #: ulng.rsmulrenfilenamestylelist msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;" msgstr "변화없음;대문자;소문자;첫번째 문자 대문자;모든 단어의 첫번째는 대문자;" #: ulng.rsmulrenwarningduplicate msgid "Warning, duplicate names!" msgstr "" #: ulng.rsmulrenwronglinesnumber msgid "File contains wrong number of lines: %d, should be %d!" msgstr "" #: ulng.rsnewsearchclearfilteroptions msgid "Keep;Clear;Prompt" msgstr "" #: ulng.rsnoequivalentinternalcommand msgid "No internal equivalent command" msgstr "" #: ulng.rsnofindfileswindowyet msgid "Sorry, no \"Find files\" window yet..." msgstr "" #: ulng.rsnootherfindfileswindowtoclose msgid "Sorry, no other \"Find files\" window to close and free from memory..." msgstr "" #: ulng.rsopenwithdevelopment msgid "Development" msgstr "" #: ulng.rsopenwitheducation msgid "Education" msgstr "" #: ulng.rsopenwithgames msgid "Games" msgstr "" #: ulng.rsopenwithgraphics #, fuzzy msgctxt "ulng.rsopenwithgraphics" msgid "Graphics" msgstr "그래픽" #: ulng.rsopenwithmultimedia msgid "Multimedia" msgstr "" #: ulng.rsopenwithnetwork #, fuzzy msgctxt "ulng.rsopenwithnetwork" msgid "Network" msgstr "네트워크" #: ulng.rsopenwithoffice msgid "Office" msgstr "" #: ulng.rsopenwithother #, fuzzy msgctxt "ulng.rsopenwithother" msgid "Other" msgstr "다른 옵션" #: ulng.rsopenwithscience msgid "Science" msgstr "" #: ulng.rsopenwithsettings msgid "Settings" msgstr "" #: ulng.rsopenwithsystem #, fuzzy msgctxt "ulng.rsopenwithsystem" msgid "System" msgstr "시스템" #: ulng.rsopenwithutility msgid "Accessories" msgstr "" #: ulng.rsoperaborted msgid "Aborted" msgstr "취소됨" #: ulng.rsopercalculatingchecksum msgid "Calculating checksum" msgstr "체크섬 계산중" #: ulng.rsopercalculatingchecksumin msgid "Calculating checksum in \"%s\"" msgstr "\"%s\"에서 체크섬 계산중" #: ulng.rsopercalculatingchecksumof msgid "Calculating checksum of \"%s\"" msgstr "\"%s\"의 체크섬 계산중" #: ulng.rsopercalculatingstatictics msgctxt "ulng.rsopercalculatingstatictics" msgid "Calculating" msgstr "계산중" #: ulng.rsopercalculatingstatisticsin msgid "Calculating \"%s\"" msgstr "\"%s\" 계산중" #: ulng.rsopercombining msgid "Joining" msgstr "합치기중" #: ulng.rsopercombiningfromto msgid "Joining files in \"%s\" to \"%s\"" msgstr "\"%s\"에서 \"%s\"로 합치는중" #: ulng.rsopercopying msgid "Copying" msgstr "복사중" #: ulng.rsopercopyingfromto msgid "Copying from \"%s\" to \"%s\"" msgstr "\"%s\" 에서 \"%s\"로 파일 복사중" #: ulng.rsopercopyingsomethingto msgid "Copying \"%s\" to \"%s\"" msgstr "\"%s\"를 \"%s\"로 복사중" #: ulng.rsopercreatingdirectory msgid "Creating directory" msgstr "폴더(디렉토리) 생성중" #: ulng.rsopercreatingsomedirectory msgid "Creating directory \"%s\"" msgstr "\"%s\" 폴더(디렉토리) 생성중" #: ulng.rsoperdeleting msgctxt "ulng.rsoperdeleting" msgid "Deleting" msgstr "삭제중" #: ulng.rsoperdeletingin msgid "Deleting in \"%s\"" msgstr "\"%s\" 삭제중" #: ulng.rsoperdeletingsomething msgid "Deleting \"%s\"" msgstr "\"%s\" 삭제중" #: ulng.rsoperexecuting msgid "Executing" msgstr "실행중" #: ulng.rsoperexecutingsomething msgid "Executing \"%s\"" msgstr "\"%s\" 압축해제중" #: ulng.rsoperextracting msgid "Extracting" msgstr "압축해제중" #: ulng.rsoperextractingfromto msgid "Extracting from \"%s\" to \"%s\"" msgstr "\"%s\"에서 \"%s\"로 압축해제중" #: ulng.rsoperfinished msgid "Finished" msgstr "완료됨" #: ulng.rsoperlisting msgid "Listing" msgstr "목록생성중" #: ulng.rsoperlistingin msgid "Listing \"%s\"" msgstr "\"%s\" 목록 생성중" #: ulng.rsopermoving msgid "Moving" msgstr "이동중" #: ulng.rsopermovingfromto msgid "Moving from \"%s\" to \"%s\"" msgstr "\"%s\"에서 \"%s\"로 파일 이동중" #: ulng.rsopermovingsomethingto msgid "Moving \"%s\" to \"%s\"" msgstr "\"%s\"이 \"%s\"로 이동" #: ulng.rsopernotstarted msgid "Not started" msgstr "시작 안됨" #: ulng.rsoperpacking msgid "Packing" msgstr "압축중" #: ulng.rsoperpackingfromto msgid "Packing from \"%s\" to \"%s\"" msgstr "\"%s\"에서 \"%s\"로 압축중" #: ulng.rsoperpackingsomethingto msgid "Packing \"%s\" to \"%s\"" msgstr "\"%s\"이 \"%s\"로 압축중" #: ulng.rsoperpaused msgid "Paused" msgstr "중단됨" #: ulng.rsoperpausing msgid "Pausing" msgstr "중단중" #: ulng.rsoperrunning msgid "Running" msgstr "실행중" #: ulng.rsopersettingproperty msgid "Setting property" msgstr "속성 설정" #: ulng.rsopersettingpropertyin msgid "Setting property in \"%s\"" msgstr "\"%s\"에 속성 설정" #: ulng.rsopersettingpropertyof msgid "Setting property of \"%s\"" msgstr "\"%s\"의 속성 설정" #: ulng.rsopersplitting msgid "Splitting" msgstr "파일 분리중" #: ulng.rsopersplittingfromto msgid "Splitting \"%s\" to \"%s\"" msgstr "\"%s\"를 \"%s\"로 분할중" #: ulng.rsoperstarting msgid "Starting" msgstr "시작중" #: ulng.rsoperstopped msgid "Stopped" msgstr "정지됨" #: ulng.rsoperstopping msgid "Stopping" msgstr "정지중" #: ulng.rsopertesting msgid "Testing" msgstr "테스트중" #: ulng.rsopertestingin msgid "Testing in \"%s\"" msgstr "\"%s\"에 테스트중" #: ulng.rsopertestingsomething msgid "Testing \"%s\"" msgstr "\"%s\" 테스트중" #: ulng.rsoperverifyingchecksum msgid "Verifying checksum" msgstr "체크섬 확인중" #: ulng.rsoperverifyingchecksumin msgid "Verifying checksum in \"%s\"" msgstr "\"%s\"에서 체크섬 확인중" #: ulng.rsoperverifyingchecksumof msgid "Verifying checksum of \"%s\"" msgstr "\"%s\"의 체크섬 확인중" #: ulng.rsoperwaitingforconnection msgid "Waiting for access to file source" msgstr "파일 소스에 액세스하기위해 기다리는 중" #: ulng.rsoperwaitingforfeedback msgid "Waiting for user response" msgstr "사용자 응답을 기다리는 중" #: ulng.rsoperwiping msgid "Wiping" msgstr "완전 삭제중" #: ulng.rsoperwipingin msgid "Wiping in \"%s\"" msgstr "\"%s\"에 완전 삭제중" #: ulng.rsoperwipingsomething msgid "Wiping \"%s\"" msgstr "\"%s\" 완전삭제중" #: ulng.rsoperworking msgid "Working" msgstr "작업중" #: ulng.rsoptaddfrommainpanel #, fuzzy #| msgid "Add at beginning;Add at the end;Smart add" msgid "Add at &beginning;Add at the end;Smart add" msgstr "시작에 추가;마지막에 추가;스마트 추가" #: ulng.rsoptarchiveconfiguresavetochange msgid "To change current editing archive configuration, either APPLY or DELETE current editing one" msgstr "" #: ulng.rsoptarchiveradditonalcmd msgid "Mode dependent, additional command" msgstr "" #: ulng.rsoptarchiveraddonlynotempty msgid "Add if it is non-empty" msgstr "" #: ulng.rsoptarchiverarchivel msgid "Archive File (long name)" msgstr "" #: ulng.rsoptarchiverarchiver msgid "Select archiver executable" msgstr "" #: ulng.rsoptarchiverarchives msgid "Archive file (short name)" msgstr "" #: ulng.rsoptarchiverchangeencoding msgid "Change Archiver Listing Encoding" msgstr "" #: ulng.rsoptarchiverconfirmdelete msgid "Are you sure you want to delete: %s" msgstr "" #: ulng.rsoptarchiverdefaultexportfilename msgid "Exported Archiver Configuration" msgstr "" #: ulng.rsoptarchivererrorlevel msgid "errorlevel" msgstr "" #: ulng.rsoptarchiverexportcaption msgid "Export archiver configuration" msgstr "" #: ulng.rsoptarchiverexportdone msgid "Exportation of %d elements to file \"%s\" completed." msgstr "" #: ulng.rsoptarchiverexportprompt msgid "Select the one(s) you want to export" msgstr "" #: ulng.rsoptarchiverfilelistl msgid "Filelist (long names)" msgstr "" #: ulng.rsoptarchiverfilelists msgid "Filelist (short names)" msgstr "" #: ulng.rsoptarchiverimportcaption msgid "Import archiver configuration" msgstr "" #: ulng.rsoptarchiverimportdone msgid "Importation of %d elements from file \"%s\" completed." msgstr "" #: ulng.rsoptarchiverimportfile msgid "Select the file to import archiver configuration(s)" msgstr "" #: ulng.rsoptarchiverimportprompt msgid "Select the one(s) you want to import" msgstr "" #: ulng.rsoptarchiverjustname msgid "Use name only, without path" msgstr "" #: ulng.rsoptarchiverjustpath msgid "Use path only, without name" msgstr "" #: ulng.rsoptarchiverprograml msgid "Archive Program (long name)" msgstr "" #: ulng.rsoptarchiverprograms msgid "Archive Program (short name)" msgstr "" #: ulng.rsoptarchiverquoteall msgid "Quote all names" msgstr "" #: ulng.rsoptarchiverquotewithspace msgid "Quote names with spaces" msgstr "" #: ulng.rsoptarchiversinglefprocess msgid "Single filename to process" msgstr "" #: ulng.rsoptarchivertargetsubdir msgid "Target subdirecory" msgstr "" #: ulng.rsoptarchiveruseansi msgid "Use ANSI encoding" msgstr "" #: ulng.rsoptarchiveruseutf8 msgid "Use UTF8 encoding" msgstr "" #: ulng.rsoptarchiverwheretosave msgid "Enter location and filename where to save archiver configuration" msgstr "" #: ulng.rsoptarchivetypename msgid "Archive type name:" msgstr "압축파일 종류명:" #: ulng.rsoptassocpluginwith msgid "Associate plugin \"%s\" with:" msgstr "\"%s\"와 연결된 플러그인:" #: ulng.rsoptautosizecolumn msgid "First;Last;" msgstr "처음;마지막;" #: ulng.rsoptconfigsortorder msgid "Classic, legacy order;Alphabetic order (but language still first)" msgstr "종류별, 일반적인 순서; 알파뱃 순서 (이름순 우선)" #: ulng.rsoptdifferframeposition msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right" msgstr "활성프레임 왼쪽, 비활성 프레임 오른쪽(상속); 왼쪽 프레임창은 왼쪽, 오른쪽 프레임창은 오른쪽" #: ulng.rsoptdisable msgid "Disable" msgstr "불가" #: ulng.rsoptenable msgctxt "ulng.rsoptenable" msgid "Enable" msgstr "가능" #: ulng.rsoptenterext msgid "Enter extension" msgstr "확장자 입력" #: ulng.rsoptfavoritetabswheretoaddinlist msgid "Add at beginning;Add at the end;Alphabetical sort" msgstr "시작에 추가; 마지막에 추가; 알파벳순 정렬" #: ulng.rsoptfileoperationsprogresskind msgid "separate window;minimized separate window;operations panel" msgstr "윈도 분리; 분리된 윈도 최소화; 작업수행창" #: ulng.rsoptfilesizeformat msgid "float;B;K;M;G" msgstr "float;B;K;M;G" #: ulng.rsopthotkeysadddeleteshortcutlong msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting." msgstr "cm_Delete를 위한 %s 단축키가 등록될 것이며 이것은 이 설정을 역으로 되돌리는데 사용될 수 있음" #: ulng.rsopthotkeysaddhotkey msgid "Add hotkey for %s" msgstr "%s 바로 가기 키 추가" #: ulng.rsopthotkeysaddshortcutbutton msgid "Add shortcut" msgstr "단축키 추가" #: ulng.rsopthotkeyscannotsetshortcut msgid "Cannot set shortcut" msgstr "단축키 설정할 수 없음" #: ulng.rsopthotkeyschangeshortcut msgid "Change shortcut" msgstr "단축키 변경" #: ulng.rsopthotkeyscommand msgctxt "ulng.rsopthotkeyscommand" msgid "Command" msgstr "명령어" #: ulng.rsopthotkeysdeletetrashcanoverrides msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides" msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?" msgstr "cm_Delete를 위한 %s 단축키 매겨변수가 이 설정에는 무효합니다. 전역변수로 이 매개변수를 수정할까요?" #: ulng.rsopthotkeysdeletetrashcanparameterexists msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists" msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?" msgstr " cm_Delete를 위해 %s 단축키가는 %s 단축키와 일치하기 위한 매개변수가 필요합니다. 변경할까요?" #: ulng.rsopthotkeysdescription msgctxt "ulng.rsopthotkeysdescription" msgid "Description" msgstr "설명" #: ulng.rsopthotkeysedithotkey msgid "Edit hotkey for %s" msgstr "%s를 위해 바로 가기 편집" #: ulng.rsopthotkeysfixparameter msgid "Fix parameter" msgstr "매개변수 수정" #: ulng.rsopthotkeyshotkey msgctxt "ulng.rsopthotkeyshotkey" msgid "Hotkey" msgstr "바로 가기" #: ulng.rsopthotkeyshotkeys msgctxt "ulng.rsopthotkeyshotkeys" msgid "Hotkeys" msgstr "바로 가기" #: ulng.rsopthotkeysnohotkey msgid "" msgstr "<없음>" #: ulng.rsopthotkeysparameters msgctxt "ulng.rsopthotkeysparameters" msgid "Parameters" msgstr "매개변수" #: ulng.rsopthotkeyssetdeleteshortcut msgid "Set shortcut to delete file" msgstr "파일 삭제 바로 가기 설정" #: ulng.rsopthotkeysshortcutfordeletealreadyassigned msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?" msgstr "%s 단축키가 작동하기 위해서는 %s 단축키다 cm_Delete에 할당되어 있어야만 하지만 이미 %s에 할당되어 있음. 변경하시겠습니까?" #: ulng.rsopthotkeysshortcutfordeleteissequence msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work." msgstr "cm_Delete %s 단축키는 연속된 단축키로 Shift키를 바로 가기로 할당할 수 없음. 이 설정은 작동하지 않을 것임." #: ulng.rsopthotkeysshortcutused msgid "Shortcut in use" msgstr "단축키 사용중" #: ulng.rsopthotkeysshortcutusedtext1 msgid "Shortcut %s is already used." msgstr "%s 단축키 이미 사용중" #: ulng.rsopthotkeysshortcutusedtext2 msgid "Change it to %s?" msgstr "%s를 변경할까요?" #: ulng.rsopthotkeysusedby msgid "used for %s in %s" msgstr "%s가 %s에 사용됨" #: ulng.rsopthotkeysusedwithdifferentparams msgid "used for this command but with different parameters" msgstr "이 명령에 사용되지만 다른 매개변수" #: ulng.rsoptionseditorarchivers msgctxt "ulng.rsoptionseditorarchivers" msgid "Archivers" msgstr "압축기" #: ulng.rsoptionseditorautorefresh msgctxt "ulng.rsoptionseditorautorefresh" msgid "Auto refresh" msgstr "자동 갱신" #: ulng.rsoptionseditorbehavior msgctxt "ulng.rsoptionseditorbehavior" msgid "Behaviors" msgstr "프로그램 실행" #: ulng.rsoptionseditorbriefview msgctxt "ulng.rsoptionseditorbriefview" msgid "Brief" msgstr "요약" #: ulng.rsoptionseditorcolors msgctxt "ulng.rsoptionseditorcolors" msgid "Colors" msgstr "색상" #: ulng.rsoptionseditorcolumnsview msgid "Columns" msgstr "파일속성열" #: ulng.rsoptionseditorconfiguration msgctxt "ulng.rsoptionseditorconfiguration" msgid "Configuration" msgstr "환경설정" #: ulng.rsoptionseditorcustomcolumns msgid "Custom columns" msgstr "사용자 파일속성열" #: ulng.rsoptionseditordirectoryhotlist msgctxt "ulng.rsoptionseditordirectoryhotlist" msgid "Directory Hotlist" msgstr "폴더 바로 가기" #: ulng.rsoptionseditordraganddrop msgid "Drag & drop" msgstr "드래그 & 드롭" #: ulng.rsoptionseditordriveslistbutton msgid "Drives list button" msgstr "드라이브 목록 버튼" #: ulng.rsoptionseditorfavoritetabs msgid "Favorite Tabs" msgstr "즐겨찾기탭" #: ulng.rsoptionseditorfileassicextra msgid "File associations extra" msgstr "파일 연결 기타 설정" #: ulng.rsoptionseditorfileassoc msgctxt "ulng.rsoptionseditorfileassoc" msgid "File associations" msgstr "파일 연결 프로그램" #: ulng.rsoptionseditorfilenewfiletypes #, fuzzy msgctxt "ulng.rsoptionseditorfilenewfiletypes" msgid "New" msgstr "새 파일" #: ulng.rsoptionseditorfileoperations msgctxt "ulng.rsoptionseditorfileoperations" msgid "File operations" msgstr "파일 작업" #: ulng.rsoptionseditorfilepanels msgctxt "ulng.rsoptionseditorfilepanels" msgid "File panels" msgstr "파일 패널" #: ulng.rsoptionseditorfilesearch #, fuzzy msgctxt "ulng.rsoptionseditorfilesearch" msgid "File search" msgstr "파일 검색" #: ulng.rsoptionseditorfilesviews msgid "Files views" msgstr "파일 보기" #: ulng.rsoptionseditorfiletypes msgctxt "ulng.rsoptionseditorfiletypes" msgid "File types" msgstr "파일 형태" #: ulng.rsoptionseditorfoldertabs msgctxt "ulng.rsoptionseditorfoldertabs" msgid "Folder tabs" msgstr "폴더탭" #: ulng.rsoptionseditorfoldertabsextra msgid "Folder tabs extra" msgstr "폴더탭 기타설정" #: ulng.rsoptionseditorfonts msgctxt "ulng.rsoptionseditorfonts" msgid "Fonts" msgstr "글꼴" #: ulng.rsoptionseditorhighlighters msgid "Highlighters" msgstr "글꼴 색상(하이라이터)" #: ulng.rsoptionseditorhotkeys msgctxt "ulng.rsoptionseditorhotkeys" msgid "Hot keys" msgstr "단축키" #: ulng.rsoptionseditoricons msgctxt "ulng.rsoptionseditoricons" msgid "Icons" msgstr "아이콘" #: ulng.rsoptionseditorignorelist msgctxt "ulng.rsoptionseditorignorelist" msgid "Ignore list" msgstr "제외 목록" #: ulng.rsoptionseditorkeyboard msgid "Keys" msgstr "키보드" #: ulng.rsoptionseditorlanguage msgctxt "ulng.rsoptionseditorlanguage" msgid "Language" msgstr "언어" #: ulng.rsoptionseditorlayout msgctxt "ulng.rsoptionseditorlayout" msgid "Layout" msgstr "화면구성" #: ulng.rsoptionseditorlog msgctxt "ulng.rsoptionseditorlog" msgid "Log" msgstr "로그" #: ulng.rsoptionseditormiscellaneous msgctxt "ulng.rsoptionseditormiscellaneous" msgid "Miscellaneous" msgstr "기타설정" #: ulng.rsoptionseditormouse msgid "Mouse" msgstr "마우스" #: ulng.rsoptionseditoroptionschanged msgid "" "Options have changed in \"%s\"\n" "\n" "Do you want to save modifications?\n" msgstr "" #: ulng.rsoptionseditorplugins msgctxt "ulng.rsoptionseditorplugins" msgid "Plugins" msgstr "플러그인" #: ulng.rsoptionseditorquicksearch msgctxt "ulng.rsoptionseditorquicksearch" msgid "Quick search/filter" msgstr "빠른 검색/필터" #: ulng.rsoptionseditorterminal msgctxt "ulng.rsoptionseditorterminal" msgid "Terminal" msgstr "명령 프롬프트" #: ulng.rsoptionseditortoolbar msgid "Toolbar" msgstr "도구상자" #: ulng.rsoptionseditortools msgctxt "ulng.rsoptionseditortools" msgid "Tools" msgstr "도구" #: ulng.rsoptionseditortooltips msgctxt "ulng.rsoptionseditortooltips" msgid "Tooltips" msgstr "풍선도움말" #: ulng.rsoptionseditortreeviewmenu msgctxt "ulng.rsoptionseditortreeviewmenu" msgid "Tree View Menu" msgstr "" #: ulng.rsoptionseditortreeviewmenucolors msgid "Tree View Menu Colors" msgstr "" #: ulng.rsoptletters msgid "None;Command Line;Quick Search;Quick Filter" msgstr "없음;명령 프롬프트;빠른 검색;빠른 필터" #: ulng.rsoptmouseselectionbutton msgid "Left button;Right button;" msgstr "왼쪽 마우스 버튼; 오른쪽 마우스 버튼;" #: ulng.rsoptnewfilesposition msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list" msgstr "최상위 필터 목록; 폴더 뒤에(폴더가 파일 앞에 정렬되었다면); 위치에 정렬; 파일 목록 마지막" #: ulng.rsoptpluginalreadyassigned msgid "Plugin %s is already assigned for the following extensions:" msgstr "%s 플러그인의 확장자가 이미 할당되어 있습니다.:" #: ulng.rsoptpluginsactive msgctxt "ulng.rsoptpluginsactive" msgid "Active" msgstr "활성" #: ulng.rsoptpluginsfilename msgctxt "ulng.rsoptpluginsfilename" msgid "File name" msgstr "파일명" #: ulng.rsoptpluginsname msgctxt "ulng.rsoptpluginsname" msgid "Name" msgstr "플러그인명" #: ulng.rsoptpluginsregisteredfor msgctxt "ulng.rsoptpluginsregisteredfor" msgid "Registered for" msgstr "등록" #: ulng.rsoptsearchcase msgid "&Sensitive;&Insensitive" msgstr "대소문자 구분(&S);대소문자 구분 안함(&I)" #: ulng.rsoptsearchitems msgid "&Files;Di&rectories;Files a&nd Directories" msgstr "파일(&F);폴더(&R);파일과 폴더(&N)" #: ulng.rsoptsearchopt msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session" msgstr "포커스되지 않으면 필터창 감추기(&H); 다음 세션을 위해 설정 저장 유지" #: ulng.rsoptsortcasesens msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)" msgstr "대소문자 구분 안함; 로케일(locale) 설정 (aAbBcC); 대문자 우선(ABCabc)" #: ulng.rsoptsortfoldermode msgid "sort by name and show first;sort like files and show first;sort like files" msgstr "이름 정렬하고 먼저 보여주기; 파일 정렬하고 먼저 보여주기; 파일로 정렬" #: ulng.rsoptsortmethod msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers" msgstr "알파벳순, 액센트 고려하기;자연 정렬; 알파벳 숫자순 정렬" #: ulng.rsopttabsposition msgid "Top;Bottom;" msgstr "최상위;최하위;" #: ulng.rsopttoolbarbuttontype msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u" msgstr "구분자(&E);내부 명령어(&R);외부 명령어(&X);메뉴(&U)" #: ulng.rsopttypeofduplicatedrename msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext" msgstr "DC 레거시(legacy) - 복사(x) 파일명.확장자; 윈도- 파일명(x).확장자; 그외 - 파일명(x).확장자" #: ulng.rsoptupdatedfilesposition msgid "don't change position;use the same setting as for new files;to sorted position" msgstr "파일위치 변경 금지; 새 파일에 동일한 설정 사용: 위치에 정렬" #: ulng.rspropscontains msgid "Files: %d, folders: %d" msgstr "파일: %d, 폴더:%d" #: ulng.rspropserrchmod msgid "Can not change access rights for \"%s\"" msgstr "\"%s\" 접근 권한을 변경할 수 없음" #: ulng.rspropserrchown msgid "Can not change owner for \"%s\"" msgstr "\"%s\" 소유자를 변경할 수 없음" #: ulng.rspropsfile msgctxt "ulng.rspropsfile" msgid "File" msgstr "파일" #: ulng.rspropsfolder msgctxt "ulng.rspropsfolder" msgid "Directory" msgstr "폴더(디렉토리)" #: ulng.rspropsnmdpipe msgid "Named pipe" msgstr "명명된 파이프(Named pipe)" #: ulng.rspropssocket msgid "Socket" msgstr "소켓" #: ulng.rspropsspblkdev msgid "Special block device" msgstr "특수 블록 장치" #: ulng.rspropsspchrdev msgid "Special character device" msgstr "특수 문자 장치" #: ulng.rspropssymlink msgid "Symbolic link" msgstr "바로 가기" #: ulng.rspropsunknowntype msgid "Unknown type" msgstr "알려지지 않은 형태" #: ulng.rssearchresult msgid "Search result" msgstr "검색 결과" #: ulng.rssearchstatus msgid "SEARCH" msgstr "검색" #: ulng.rssearchtemplateunnamed msgid "" msgstr "<이름없는 템플릿>" #: ulng.rssearchwithdsxplugininprogress msgid "" "A file search using DSX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" #: ulng.rssearchwithwdxplugininprogress msgid "" "A file search using WDX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" #: ulng.rsselectdir msgid "Select a directory" msgstr "폴더(디렉토리) 선택" #: ulng.rsselectyoufindfileswindow msgid "Select your window" msgstr "" #: ulng.rsshowhelpfor msgid "&Show help for %s" msgstr "%s 도움말 표시(&S)" #: ulng.rssimplewordall msgctxt "ulng.rssimplewordall" msgid "All" msgstr "전부" #: ulng.rssimplewordcategory msgctxt "ulng.rssimplewordcategory" msgid "Category" msgstr "범주" #: ulng.rssimplewordcolumnsingular msgid "Column" msgstr "파일속성열" #: ulng.rssimplewordcommand msgctxt "ulng.rssimplewordcommand" msgid "Command" msgstr "명령어" #: ulng.rssimplewordfilename msgid "Filename" msgstr "파일명" #: ulng.rssimplewordfiles msgid "files" msgstr "파일" #: ulng.rssimplewordletter msgid "Letter" msgstr "" #: ulng.rssimplewordparameter msgid "Param" msgstr "매개변수" #: ulng.rssimplewordresult msgid "Result" msgstr "결과" #: ulng.rssimplewordworkdir msgid "WorkDir" msgstr "작업폴더" #: ulng.rssizeunitbytes msgid "Bytes" msgstr "바이트" #: ulng.rssizeunitgbytes msgctxt "ulng.rssizeunitgbytes" msgid "Gigabytes" msgstr "기가바이트" #: ulng.rssizeunitkbytes msgctxt "ulng.rssizeunitkbytes" msgid "Kilobytes" msgstr "킬로바이트" #: ulng.rssizeunitmbytes msgctxt "ulng.rssizeunitmbytes" msgid "Megabytes" msgstr "메가바이트" #: ulng.rssizeunittbytes msgid "Terabytes" msgstr "테라바이트" #: ulng.rsspacemsg msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)" msgstr "파일: %d, 폴더: %d, 크기: %s (%s 바이트)" #: ulng.rsspliterrdirectory msgid "Unable to create target directory!" msgstr "폴더를 생성할 수 없음!" #: ulng.rsspliterrfilesize msgid "Incorrect file size format!" msgstr "잘못된 파일 크기 형태!" #: ulng.rsspliterrsplitfile msgid "Unable to split the file!" msgstr "파일을 분리할 수 없음!" #: ulng.rssplitmsgmanyparts msgid "The number of parts is more than 100! Continue?" msgstr "100개 이상으로 분리됩니다. 계속할까요?" #: ulng.rssplitpredefinedsizes msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R" msgstr "" #: ulng.rssplitseldir msgid "Select directory:" msgstr "폴더 선택:" #: ulng.rsstraccents msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ" msgstr "" #: ulng.rsstraccentsstripped msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE" msgstr "" #: ulng.rsstrpreviewjustpreview msgid "Just preview" msgstr "" #: ulng.rsstrpreviewothers msgid "Others" msgstr "" #: ulng.rsstrpreviewsearchingletters msgid "OU" msgstr "" #: ulng.rsstrpreviewsidenote msgid "Side note" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched1 msgid "Flat" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched2 msgid "Limited" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched3 msgid "Simple" msgstr "" #: ulng.rsstrpreviewwordwithsearched1 msgid "Fabulous" msgstr "" #: ulng.rsstrpreviewwordwithsearched2 msgid "Marvelous" msgstr "" #: ulng.rsstrpreviewwordwithsearched3 msgid "Tremendous" msgstr "" #: ulng.rsstrtvmchoosedirhistory msgid "Choose your directory from Dir History" msgstr "" #: ulng.rsstrtvmchoosefavoritetabs msgid "Choose you Favorite Tabs:" msgstr "" #: ulng.rsstrtvmchoosefromcmdlinehistory msgid "Choose your command from Command Line History" msgstr "" #: ulng.rsstrtvmchoosefrommainmenu msgid "Choose your action from Main Menu" msgstr "" #: ulng.rsstrtvmchoosefromtoolbar msgid "Choose your action from Maintool bar" msgstr "" #: ulng.rsstrtvmchoosehotdirectory msgid "Choose your directory from Hot Directory:" msgstr "" #: ulng.rsstrtvmchooseviewhistory msgid "Choose your directory from File View History" msgstr "" #: ulng.rsstrtvmchooseyourfileordir msgid "Choose your file or your directory" msgstr "" #: ulng.rssymerrcreate msgid "Error creating symlink." msgstr "심링크 생성 오류." #: ulng.rssyndefaulttext msgctxt "ulng.rssyndefaulttext" msgid "Default text" msgstr "기본 텍스트" #: ulng.rssynlangplaintext msgctxt "ulng.rssynlangplaintext" msgid "Plain text" msgstr "일반 텍스트" #: ulng.rstabsactionondoubleclickchoices msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu" msgstr "아무것도 하지 않음;탭 닫기;즐겨찾기탭 액세소;탭 팝업 메뉴" #: ulng.rstimeunitday msgctxt "ulng.rstimeunitday" msgid "Day(s)" msgstr "일" #: ulng.rstimeunithour msgid "Hour(s)" msgstr "시(s)" #: ulng.rstimeunitminute msgid "Minute(s)" msgstr "분(s)" #: ulng.rstimeunitmonth msgid "Month(s)" msgstr "월(s)" #: ulng.rstimeunitsecond msgid "Second(s)" msgstr "초(s)" #: ulng.rstimeunitweek msgid "Week(s)" msgstr "주(s)" #: ulng.rstimeunityear msgid "Year(s)" msgstr "년" #: ulng.rstitlerenamefavtabs msgid "Rename Favorite Tabs" msgstr "즐겨찾기탭 이름 바꾸기" #: ulng.rstitlerenamefavtabsmenu msgid "Rename Favorite Tabs sub-menu" msgstr "즐겨찾기탭 하위 메뉴 이름 바꾸기" #: ulng.rstooldiffer msgctxt "ulng.rstooldiffer" msgid "Differ" msgstr "구분하기" #: ulng.rstooleditor msgctxt "ulng.rstooleditor" msgid "Editor" msgstr "편집기" #: ulng.rstoolerroropeningdiffer msgid "Error opening differ" msgstr "구분(differ)기능 열기 오류" #: ulng.rstoolerroropeningeditor msgid "Error opening editor" msgstr "편집기 열기 오류" #: ulng.rstoolerroropeningterminal msgid "Error opening terminal" msgstr "명령 프롬프트 열기 오류" #: ulng.rstoolerroropeningviewer msgid "Error opening viewer" msgstr "뷰어 열기 오류" #: ulng.rstoolterminal msgctxt "ulng.rstoolterminal" msgid "Terminal" msgstr "명령 프롬프트" #: ulng.rstoolviewer msgctxt "ulng.rstoolviewer" msgid "Viewer" msgstr "뷰어" #: ulng.rsunhandledexceptionmessage msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program." msgstr "이 오류를 설명과 함께 다음 파일을 버그 트랙커(Bug tracker)에 보고하세요:%s 계속하려면 %s를, 프로그램을 취소하려면 %s를 누르세요." #: ulng.rsvarbothpanelactivetoinactive msgid "Both panels, from active to inactive" msgstr "양쪽창, 활성화에서 비활성화로" #: ulng.rsvarbothpanellefttoright msgid "Both panels, from left to right" msgstr "양쪽창, 왼쪽에서 오른쪽으로" #: ulng.rsvarcurrentpath msgid "Path of panel" msgstr "패널(창) 경로" #: ulng.rsvarencloseelement msgid "Enclose each name in brackets or what you want" msgstr "각각의 당신이 원하는 이름에 괄호를 하세요." #: ulng.rsvarfilenamenoext msgid "Just filename, no extension" msgstr "파일명만, 확장자 제외" #: ulng.rsvarfullpath msgid "Complete filename (path+filename)" msgstr "완전한 파일명 (경로+파일명)" #: ulng.rsvarhelpwith msgid "Help with \"%\" variables" msgstr "\"%\"변수와 도움말" #: ulng.rsvarinputparam msgid "Will request request user to enter a parameter with a default suggested value" msgstr "요청된 사용자 기본 제시된 값으로 매개변수 입력이 요청됨" #: ulng.rsvarleftpanel msgid "Left panel" msgstr "왼쪽창" #: ulng.rsvarlistfilename msgid "Temporary filename of list of filenames" msgstr "파일명 목록의 임시 파일명" #: ulng.rsvarlistfullfilename msgid "Temporary filename of list of complete filenames (path+filename)" msgstr "전체 파일명(경로+파일명) 목록의 임시 파일명" #: ulng.rsvarlistinutf16 msgid "Filenames in list in UTF-16 with BOM" msgstr "" #: ulng.rsvarlistinutf16quoted msgid "Filenames in list in UTF-16 with BOM, inside double quotes" msgstr "" #: ulng.rsvarlistinutf8 msgid "Filenames in list in UTF-8" msgstr "" #: ulng.rsvarlistinutf8quoted msgid "Filenames in list in UTF-8, inside double quotes" msgstr "" #: ulng.rsvarlistrelativefilename msgid "Temporary filename of list of filenames with relative path" msgstr "상대경로 파일명 목록의 임시 파일명" #: ulng.rsvaronlyextension msgid "Only file extension" msgstr "파일 확장자만" #: ulng.rsvaronlyfilename msgid "Only filename" msgstr "파일명만" #: ulng.rsvarotherexamples msgid "Other example of what's possible" msgstr "가능한 다른 예" #: ulng.rsvarpath #, fuzzy #| msgid "Path, with ending delimiter" msgid "Path, without ending delimiter" msgstr "경로, 마지막에 종료 분리문자" #: ulng.rsvarpercentchangetopound msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign" msgstr "여기에서부터 마지막 라인까지, 퍼센트-변수 지시기(indicator)는 \"#\" 기록(sign)입니다." #: ulng.rsvarpercentsign msgid "Return the percent sign" msgstr "퍼센트 기록(sign) 돌아가기" #: ulng.rsvarpoundchangetopercent msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign" msgstr "여기에서부터 마지막 라인까지, 퍼센트-변수 지시기(indicator)는 \"#\" 기록(sign) 뒤(back) 입니다." #: ulng.rsvarprependelement msgid "Prepend each name with \"-a \" or what you want" msgstr "\"-a \" 또는 원하는 각각의 이름에 넣기" #: ulng.rsvarpromptuserforparam msgid "%[Prompt user for param;Default value proposed]" msgstr "%[매개변수를 위한 프롬프트 사용자;기본값 제안됨]" #: ulng.rsvarrelativepathandfilename msgid "Filename with relative path" msgstr "상대경로 포함 파일명" #: ulng.rsvarrightpanel msgid "Right panel" msgstr "오른쪽창" #: ulng.rsvarsecondelementrightpanel msgid "Full path of second selected file in right panel" msgstr "오른쪽창에 두번째 선택된 파일의 전체경로" #: ulng.rsvarshowcommandprior msgid "Show command prior execute" msgstr "이전 실행명령 표시" #: ulng.rsvarsimplemessage msgid "%[Simple message]" msgstr "%[단순 메시지]" #: ulng.rsvarsimpleshowmessage msgid "Will show a simple message" msgstr "단순 메시지 표시" #: ulng.rsvarsourcepanel msgid "Active panel (source)" msgstr "활성창(원본)" #: ulng.rsvartargetpanel msgid "Inactive panel (target)" msgstr "비활성창(대상)" #: ulng.rsvarwillbequoted msgid "Filenames will be quoted from here (default)" msgstr "파일명이 여기에서 인용됩니다.(기본값)" #: ulng.rsvarwilldointerminal msgid "Command will be done in terminal, remaining opened at the end" msgstr "명령어가 명령프롬프트에서 실행됩니다. 실행종료 후 창은 열려있습니다." #: ulng.rsvarwillhaveendingdelimiter msgid "Paths will have ending delimiter" msgstr "경로끝에는 구분문자가 표시됩니다." #: ulng.rsvarwillnotbequoted msgid "Filenames will not be quoted from here" msgstr "파일명은 여기에서 인용되지 않습니다." #: ulng.rsvarwillnotdointerminal msgid "Command will be done in terminal, closed at the end" msgstr "명령어가 명령프롬프트에서 실행됩니다. 실행종료 후 창은 닫힙니다." #: ulng.rsvarwillnothaveendingdelimiter msgid "Paths will not have ending delimiter (default)" msgstr "경로끝에는 구분문자가 표시되지 않습니다.(기본값)" #: ulng.rsvfsnetwork msgctxt "ulng.rsvfsnetwork" msgid "Network" msgstr "네트워크" #: ulng.rsviewabouttext msgid "Internal Viewer of Double Commander." msgstr "더블 커맨더 내장뷰어" #: ulng.rsviewbadquality msgid "Bad Quality" msgstr "저화질" #: ulng.rsviewencoding msgctxt "ulng.rsviewencoding" msgid "Encoding" msgstr "인코딩" #: ulng.rsviewimagetype msgid "Image Type" msgstr "이미지 형태" #: ulng.rsviewnewsize msgctxt "ulng.rsviewnewsize" msgid "New Size" msgstr "새 크기" #: ulng.rsviewnotfound msgid "%s not found!" msgstr "%s 찾지 못함!" #: ulng.rsviewwithexternalviewer msgid "with external viewer" msgstr "외장뷰어로" #: ulng.rsviewwithinternalviewer msgid "with internal viewer" msgstr "내장뷰어로" #: ulng.rsxreplacements msgid "Number of replacement: %d" msgstr "바꾸기한 갯수: %d 개" #: ulng.rszeroreplacement msgid "No replacement took place." msgstr "바꾸기 없음."