# Pedro Albuquerque , 2017. msgid "" msgstr "" "Project-Id-Version: Double Commander 0.5.5 alpha\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: 2008-01-17 23:08+0300\n" "PO-Revision-Date: 2017-12-11 07:55+0000\n" "Last-Translator: Pedro Albuquerque \n" "Language-Team: Português <>\n" "Language: pt\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=(n != 1);\n" "X-Generator: Gtranslator 2.91.6\n" "X-Native-Language: Português\n" #: fsyncdirsdlg.rscomparingpercent msgid "Comparing... %d%% (ESC to cancel)" msgstr "A comparar - %d%% (ESC para cancelar)" #: fsyncdirsdlg.rsdeleteright msgid "Right: Delete %d file(s)" msgstr "Direita: eliminar %d ficheiro(s)" #: fsyncdirsdlg.rsfilesfound msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)" msgstr "Encontrados: %d (iguais: %d, diferentes: %d, únicos esquerdos: %d, únicos direitos: %d)" #: fsyncdirsdlg.rslefttorightcopy msgid "Left to Right: Copy %d files, total size: %d bytes" msgstr "Esquerda->direita: copiar %d ficheiros, tamanho: %d bytes" #: fsyncdirsdlg.rsrighttoleftcopy msgid "Right to Left: Copy %d files, total size: %d bytes" msgstr "Direita->esquerda: copiar %d ficheiros, tamanho: %d bytes" #: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint msgid "Choose template..." msgstr "Escolher modelo..." #: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption msgid "C&heck free space" msgstr "&Verificar espaço livre" #: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption msgid "Cop&y attributes" msgstr "Cop&iar atributos" #: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption msgid "Copy o&wnership" msgstr "Copiar &propriedade" #: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption msgid "Copy &permissions" msgstr "Copiar &permissões" #: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "Copiar d&ata/hora" #: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption msgid "Correct lin&ks" msgstr "Corrigir li&gações" #: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION" msgid "Drop readonly fla&g" msgstr "Lar&gar atributo Só de leitura" #: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption msgid "E&xclude empty directories" msgstr "E&xcluir pastas vazias" #: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption msgid "Fo&llow links" msgstr "Seguir &ligações" #: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption msgid "&Reserve space" msgstr "&Reservar espaço" #: tfilesystemcopymoveoperationoptionsui.chkverify.caption msgid "&Verify" msgstr "&Verificar" #: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint msgid "What to do when cannot set file time, attributes, etc." msgstr "O que fazer quando não conseguir definir hora, atributos, etc. do ficheiro" #: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption msgid "Use file template" msgstr "Usar modelo de ficheiro" #: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption msgid "When dir&ectory exists" msgstr "Quando a pasta &existe" #: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When &file exists" msgstr "Quando o &ficheiro existe" #: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption msgid "When ca&nnot set property" msgstr "Quando &não conseguir definir propriedade" #: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption msgid "" msgstr "" #: tfrmabout.btnclose.caption msgctxt "TFRMABOUT.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Fe&char" #: tfrmabout.btncopytoclipboard.caption msgid "Copy to clipboard" msgstr "Copiar para área de transferência" #: tfrmabout.caption msgctxt "TFRMABOUT.CAPTION" msgid "About" msgstr "Sobre" #: tfrmabout.lblbuild.caption msgctxt "tfrmabout.lblbuild.caption" msgid "Build" msgstr "Versão" #: tfrmabout.lblfreepascalver.caption msgctxt "tfrmabout.lblfreepascalver.caption" msgid "Free Pascal" msgstr "Free Pascal" #: tfrmabout.lblhomepage.caption msgid "Home Page:" msgstr "Página web:" #: tfrmabout.lblhomepageaddress.caption msgid "http://doublecmd.sourceforge.net" msgstr "http://doublecmd.sourceforge.net" #: tfrmabout.lbllazarusver.caption msgctxt "tfrmabout.lbllazarusver.caption" msgid "Lazarus" msgstr "Lazarus" #: tfrmabout.lblrevision.caption msgctxt "TFRMABOUT.LBLREVISION.CAPTION" msgid "Revision" msgstr "Revisão" #: tfrmabout.lbltitle.caption msgctxt "TFRMABOUT.LBLTITLE.CAPTION" msgid "Double Commander" msgstr "Double Commander" #: tfrmabout.lblversion.caption msgctxt "tfrmabout.lblversion.caption" msgid "Version" msgstr "Versão" #: tfrmattributesedit.btncancel.caption msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmattributesedit.btnok.caption msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmattributesedit.btnreset.caption msgid "&Reset" msgstr "&Repor" #: tfrmattributesedit.caption msgid "Choose attributes" msgstr "Escolher atributos" #: tfrmattributesedit.cbarchive.caption msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION" msgid "&Archive" msgstr "&Arquivo" #: tfrmattributesedit.cbcompressed.caption msgid "Co&mpressed" msgstr "Co&mprimido" #: tfrmattributesedit.cbdirectory.caption msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION" msgid "&Directory" msgstr "&Pasta" #: tfrmattributesedit.cbencrypted.caption msgid "&Encrypted" msgstr "&Encriptado" #: tfrmattributesedit.cbhidden.caption msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION" msgid "&Hidden" msgstr "&Oculto" #: tfrmattributesedit.cbreadonly.caption msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION" msgid "Read o&nly" msgstr "Só de &leitura" #: tfrmattributesedit.cbsgid.caption msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmattributesedit.cbsparse.caption msgid "S&parse" msgstr "Es&parso" #: tfrmattributesedit.cbsticky.caption msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Pegajoso" #: tfrmattributesedit.cbsuid.caption msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmattributesedit.cbsymlink.caption msgid "&Symlink" msgstr "Ligação &simbólica" #: tfrmattributesedit.cbsystem.caption msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION" msgid "S&ystem" msgstr "S&istema" #: tfrmattributesedit.cbtemporary.caption msgid "&Temporary" msgstr "&Temporário" #: tfrmattributesedit.gbntfsattributes.caption msgid "NTFS attributes" msgstr "Atributos NTFS" #: tfrmattributesedit.gbwingeneral.caption msgid "General attributes" msgstr "Atributos gerais" #: tfrmattributesedit.lblattrbitsstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bits:" #: tfrmattributesedit.lblattrgroupstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Grupo" #: tfrmattributesedit.lblattrotherstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Outro" #: tfrmattributesedit.lblattrownerstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Dono" #: tfrmattributesedit.lblexec.caption msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION" msgid "Execute" msgstr "Executar" #: tfrmattributesedit.lblread.caption msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION" msgid "Read" msgstr "Ler" #: tfrmattributesedit.lbltextattrs.caption msgid "As te&xt:" msgstr "Como te&xto:" #: tfrmattributesedit.lblwrite.caption msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION" msgid "Write" msgstr "Escrever" #: tfrmbenchmark.caption msgid "Benchmark" msgstr "" #: tfrmbenchmark.lblbenchmarksize.caption msgid "Benchmark data size: %d MB" msgstr "" #: tfrmbenchmark.stgresult.columns[0].title.caption msgid "Hash" msgstr "" #: tfrmbenchmark.stgresult.columns[1].title.caption msgid "Time (ms)" msgstr "" #: tfrmbenchmark.stgresult.columns[2].title.caption msgid "Speed (MB/s)" msgstr "" #: tfrmchecksumcalc.caption msgctxt "TFRMCHECKSUMCALC.CAPTION" msgid "Calculate checksum..." msgstr "Calcular checksum..." #: tfrmchecksumcalc.cbopenafterjobiscomplete.caption msgid "Open checksum file after job is completed" msgstr "Abrir ficheiro checksum após terminar a tarefa" #: tfrmchecksumcalc.cbseparatefile.caption msgid "C&reate separate checksum file for each file" msgstr "C&riar ficheiro checksum separado para cada ficheiro" #: tfrmchecksumcalc.lblsaveto.caption msgid "&Save checksum file(s) to:" msgstr "Gravar ficheiro&s checksum em:" #: tfrmchecksumverify.btnclose.caption msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Fe&char" #: tfrmchecksumverify.caption msgctxt "TFRMCHECKSUMVERIFY.CAPTION" msgid "Verify checksum..." msgstr "Verificar checksum..." #: tfrmconnectionmanager.btnadd.caption msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION" msgid "A&dd" msgstr "A&dicionar" #: tfrmconnectionmanager.btncancel.caption msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmconnectionmanager.btnconnect.caption msgid "C&onnect" msgstr "L&igar" #: tfrmconnectionmanager.btndelete.caption msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION" msgid "&Delete" msgstr "&Eliminar" #: tfrmconnectionmanager.btnedit.caption msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION" msgid "&Edit" msgstr "&Editar" #: tfrmconnectionmanager.caption msgid "Connection manager" msgstr "Gestor de ligações" #: tfrmconnectionmanager.gbconnectto.caption msgid "Connect to:" msgstr "Ligar a:" #: tfrmcopydlg.btnaddtoqueue.caption msgid "A&dd To Queue" msgstr "A&dicionar à fila" #: tfrmcopydlg.btncancel.caption msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmcopydlg.btnoptions.caption msgid "O&ptions" msgstr "O&pções" #: tfrmcopydlg.btnsaveoptions.caption msgid "Sa&ve these options as default" msgstr "Gra&var estas opções como predefinição" #: tfrmcopydlg.caption msgctxt "TFRMCOPYDLG.CAPTION" msgid "Copy file(s)" msgstr "Copiar ficheiro(s)" #: tfrmcopydlg.mnunewqueue.caption msgctxt "tfrmcopydlg.mnunewqueue.caption" msgid "New queue" msgstr "Nova fila" #: tfrmcopydlg.mnuqueue1.caption msgctxt "tfrmcopydlg.mnuqueue1.caption" msgid "Queue 1" msgstr "Fila 1" #: tfrmcopydlg.mnuqueue2.caption msgctxt "tfrmcopydlg.mnuqueue2.caption" msgid "Queue 2" msgstr "Fila 2" #: tfrmcopydlg.mnuqueue3.caption msgctxt "tfrmcopydlg.mnuqueue3.caption" msgid "Queue 3" msgstr "Fila 3" #: tfrmcopydlg.mnuqueue4.caption msgctxt "tfrmcopydlg.mnuqueue4.caption" msgid "Queue 4" msgstr "Fila 4" #: tfrmcopydlg.mnuqueue5.caption msgctxt "tfrmcopydlg.mnuqueue5.caption" msgid "Queue 5" msgstr "Fila 5" #: tfrmdescredit.actsavedescription.caption msgid "Save Description" msgstr "Gravar descrição" #: tfrmdescredit.btncancel.caption msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmdescredit.btnok.caption msgctxt "TFRMDESCREDIT.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmdescredit.caption msgid "File/folder comment" msgstr "Comentário do ficheiro/pasta" #: tfrmdescredit.lbleditcommentfor.caption msgid "E&dit comment for:" msgstr "E&ditar comentário de:" #: tfrmdescredit.lblencoding.caption msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION" msgid "&Encoding:" msgstr "A co&dificar:" #: tfrmdescredit.lblfilename.caption msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION" msgid "???" msgstr "???" #: tfrmdiffer.actabout.caption msgctxt "TFRMDIFFER.ACTABOUT.CAPTION" msgid "About" msgstr "Sobre" #: tfrmdiffer.actautocompare.caption msgid "Auto Compare" msgstr "Comparar automaticamente" #: tfrmdiffer.actbinarycompare.caption msgid "Binary Mode" msgstr "Modo binário" #: tfrmdiffer.actcancelcompare.caption msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION" msgid "Cancel" msgstr "Cancelar" #: tfrmdiffer.actcancelcompare.hint msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT" msgid "Cancel" msgstr "Cancelar" #: tfrmdiffer.actcopylefttoright.caption msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION" msgid "Copy Block Right" msgstr "Copiar bloco à direita" #: tfrmdiffer.actcopylefttoright.hint msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT" msgid "Copy Block Right" msgstr "Copiar bloco à direita" #: tfrmdiffer.actcopyrighttoleft.caption msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION" msgid "Copy Block Left" msgstr "Copiar bloco à esquerda" #: tfrmdiffer.actcopyrighttoleft.hint msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT" msgid "Copy Block Left" msgstr "Copiar bloco à esquerda" #: tfrmdiffer.acteditcopy.caption msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "Copiar" #: tfrmdiffer.acteditcut.caption msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "Cortar" #: tfrmdiffer.acteditdelete.caption msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "Eliminar" #: tfrmdiffer.acteditpaste.caption msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "Colar" #: tfrmdiffer.acteditredo.caption msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "Refazer" #: tfrmdiffer.acteditselectall.caption msgid "Select &All" msgstr "Seleccion&ar tudo" #: tfrmdiffer.acteditundo.caption msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "Desfazer" #: tfrmdiffer.actexit.caption msgctxt "TFRMDIFFER.ACTEXIT.CAPTION" msgid "E&xit" msgstr "&Sair" #: tfrmdiffer.actfirstdifference.caption msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION" msgid "First Difference" msgstr "Primeira diferença" #: tfrmdiffer.actfirstdifference.hint msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT" msgid "First Difference" msgstr "Primeira diferença" #: tfrmdiffer.actignorecase.caption msgid "Ignore Case" msgstr "Ignorar maiúsculas" #: tfrmdiffer.actignorewhitespace.caption msgid "Ignore Blanks" msgstr "Ignorar espaços" #: tfrmdiffer.actkeepscrolling.caption msgid "Keep Scrolling" msgstr "Continuar rolamento" #: tfrmdiffer.actlastdifference.caption msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION" msgid "Last Difference" msgstr "Última diferença" #: tfrmdiffer.actlastdifference.hint msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT" msgid "Last Difference" msgstr "Última diferença" #: tfrmdiffer.actlinedifferences.caption msgid "Line Differences" msgstr "Diferenças de linha" #: tfrmdiffer.actnextdifference.caption msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION" msgid "Next Difference" msgstr "Diferença seguinte" #: tfrmdiffer.actnextdifference.hint msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT" msgid "Next Difference" msgstr "Diferença seguinte" #: tfrmdiffer.actopenleft.caption msgid "Open Left..." msgstr "Abrir esquerdo..." #: tfrmdiffer.actopenright.caption msgid "Open Right..." msgstr "Abrir direito..." #: tfrmdiffer.actpaintbackground.caption msgid "Paint Background" msgstr "Pintar fundo" #: tfrmdiffer.actprevdifference.caption msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION" msgid "Previous Difference" msgstr "Diferença anterior" #: tfrmdiffer.actprevdifference.hint msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT" msgid "Previous Difference" msgstr "Diferença anterior" #: tfrmdiffer.actreload.caption msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION" msgid "&Reload" msgstr "&Recarregar" #: tfrmdiffer.actreload.hint msgctxt "TFRMDIFFER.ACTRELOAD.HINT" msgid "Reload" msgstr "Recarregar" #: tfrmdiffer.actsave.caption msgctxt "TFRMDIFFER.ACTSAVE.CAPTION" msgid "Save" msgstr "Gravar" #: tfrmdiffer.actsave.hint msgctxt "TFRMDIFFER.ACTSAVE.HINT" msgid "Save" msgstr "Gravar" #: tfrmdiffer.actsaveas.caption msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION" msgid "Save as..." msgstr "Gravar como..." #: tfrmdiffer.actsaveas.hint msgctxt "TFRMDIFFER.ACTSAVEAS.HINT" msgid "Save as..." msgstr "Gravar como..." #: tfrmdiffer.actsaveleft.caption msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION" msgid "Save Left" msgstr "Gravar esquerdo" #: tfrmdiffer.actsaveleft.hint msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT" msgid "Save Left" msgstr "Gravar esquerdo" #: tfrmdiffer.actsaveleftas.caption msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION" msgid "Save Left As..." msgstr "Gravar esquerdo como..." #: tfrmdiffer.actsaveleftas.hint msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT" msgid "Save Left As..." msgstr "Gravar esquerdo como..." #: tfrmdiffer.actsaveright.caption msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION" msgid "Save Right" msgstr "Gravar direito" #: tfrmdiffer.actsaveright.hint msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT" msgid "Save Right" msgstr "Gravar direito" #: tfrmdiffer.actsaverightas.caption msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION" msgid "Save Right As..." msgstr "Gravar direito como..." #: tfrmdiffer.actsaverightas.hint msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT" msgid "Save Right As..." msgstr "Gravar direito como...." #: tfrmdiffer.actstartcompare.caption msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION" msgid "Compare" msgstr "Comparar" #: tfrmdiffer.actstartcompare.hint msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT" msgid "Compare" msgstr "Comparar" #: tfrmdiffer.btnleftencoding.hint msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT" msgid "Encoding" msgstr "Codificar" #: tfrmdiffer.btnrightencoding.hint msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT" msgid "Encoding" msgstr "Codificar" #: tfrmdiffer.caption msgctxt "TFRMDIFFER.CAPTION" msgid "Compare files" msgstr "Comparar ficheiros" #: tfrmdiffer.midivider1.caption msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider10.caption msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider2.caption msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider3.caption msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider4.caption msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider5.caption msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider6.caption msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider7.caption msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider8.caption msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider9.caption msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.miencodingleft.caption msgid "&Left" msgstr "&Esquerdo" #: tfrmdiffer.miencodingright.caption msgid "&Right" msgstr "Di&reito" #: tfrmdiffer.miseparator1.caption msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.miseparator2.caption msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.mnuactions.caption msgid "&Actions" msgstr "&Acções" #: tfrmdiffer.mnuedit.caption msgctxt "TFRMDIFFER.MNUEDIT.CAPTION" msgid "&Edit" msgstr "&Editar" #: tfrmdiffer.mnuencoding.caption msgctxt "TFRMDIFFER.MNUENCODING.CAPTION" msgid "En&coding" msgstr "&Codificar" #: tfrmdiffer.mnufile.caption msgctxt "TFRMDIFFER.MNUFILE.CAPTION" msgid "&File" msgstr "&Ficheiro" #: tfrmdiffer.mnuoptions.caption msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION" msgid "&Options" msgstr "&Opções" #: tfrmedithotkey.btnaddshortcut.hint msgid "Add new shortcut to sequence" msgstr "Adicionar novo atalho à sequência" #: tfrmedithotkey.btncancel.caption msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmedithotkey.btnok.caption msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmedithotkey.btnremoveshortcut.hint msgid "Remove last shortcut from sequence" msgstr "Remover último atalho da sequência" #: tfrmedithotkey.btnselectfromlist.hint msgid "Select shortcut from list of remaining free available keys" msgstr "Seleccione o atalho da lista de teclas ainda disponíveis" #: tfrmedithotkey.cghkcontrols.caption msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION" msgid "Only for these controls" msgstr "Só para estes controlos" #: tfrmedithotkey.lblparameters.caption msgid "&Parameters (each in a separate line):" msgstr "&Parâmetros (cada numa linha separada):" #: tfrmedithotkey.lblshortcuts.caption msgid "Shortcuts:" msgstr "Atalhos:" #: tfrmeditor.actabout.caption msgctxt "TFRMEDITOR.ACTABOUT.CAPTION" msgid "About" msgstr "Sobre" #: tfrmeditor.actabout.hint msgctxt "TFRMEDITOR.ACTABOUT.HINT" msgid "About" msgstr "Sobre" #: tfrmeditor.actconfhigh.caption msgid "&Configuration" msgstr "&Configuração" #: tfrmeditor.actconfhigh.hint msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT" msgid "Configuration" msgstr "Configuração" #: tfrmeditor.acteditcopy.caption msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "Copiar" #: tfrmeditor.acteditcopy.hint msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT" msgid "Copy" msgstr "Copiar" #: tfrmeditor.acteditcut.caption msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "Cortar" #: tfrmeditor.acteditcut.hint msgctxt "TFRMEDITOR.ACTEDITCUT.HINT" msgid "Cut" msgstr "Cortar" #: tfrmeditor.acteditdelete.caption msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "Eliminar" #: tfrmeditor.acteditdelete.hint msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT" msgid "Delete" msgstr "Eliminar" #: tfrmeditor.acteditfind.caption msgctxt "tfrmeditor.acteditfind.caption" msgid "&Find" msgstr "&Localizar" #: tfrmeditor.acteditfind.hint msgctxt "TFRMEDITOR.ACTEDITFIND.HINT" msgid "Find" msgstr "Localizar" #: tfrmeditor.acteditfindnext.caption msgctxt "tfrmeditor.acteditfindnext.caption" msgid "Find next" msgstr "Localizar seguinte" #: tfrmeditor.acteditfindnext.hint msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT" msgid "Find next" msgstr "Localizar seguinte" #: tfrmeditor.acteditfindprevious.caption msgctxt "tfrmeditor.acteditfindprevious.caption" msgid "Find previous" msgstr "Localizar anterior" #: tfrmeditor.acteditgotoline.caption msgid "Goto Line..." msgstr "Ir para linha..." #: tfrmeditor.acteditlineendcr.caption msgctxt "tfrmeditor.acteditlineendcr.caption" msgid "Mac (CR)" msgstr "Mac (CR)" #: tfrmeditor.acteditlineendcr.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT" msgid "Mac (CR)" msgstr "Mac (CR)" #: tfrmeditor.acteditlineendcrlf.caption msgctxt "tfrmeditor.acteditlineendcrlf.caption" msgid "Windows (CRLF)" msgstr "Windows (CRLF)" #: tfrmeditor.acteditlineendcrlf.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT" msgid "Windows (CRLF)" msgstr "Windows (CRLF)" #: tfrmeditor.acteditlineendlf.caption msgctxt "tfrmeditor.acteditlineendlf.caption" msgid "Unix (LF)" msgstr "Unix (LF)" #: tfrmeditor.acteditlineendlf.hint msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT" msgid "Unix (LF)" msgstr "Unix (LF)" #: tfrmeditor.acteditpaste.caption msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "Colar" #: tfrmeditor.acteditpaste.hint msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT" msgid "Paste" msgstr "Colar" #: tfrmeditor.acteditredo.caption msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "Refazer" #: tfrmeditor.acteditredo.hint msgctxt "TFRMEDITOR.ACTEDITREDO.HINT" msgid "Redo" msgstr "Refazer" #: tfrmeditor.acteditrplc.caption msgid "&Replace" msgstr "Substitui&r" #: tfrmeditor.acteditrplc.hint msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT" msgid "Replace" msgstr "Substituir" #: tfrmeditor.acteditselectall.caption msgid "Select&All" msgstr "Seleccion&ar tudo" #: tfrmeditor.acteditselectall.hint msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT" msgid "Select All" msgstr "Seleccionar tudo" #: tfrmeditor.acteditundo.caption msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "Desfazer" #: tfrmeditor.acteditundo.hint msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT" msgid "Undo" msgstr "Desfazer" #: tfrmeditor.actfileclose.caption msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION" msgid "&Close" msgstr "Fe&char" #: tfrmeditor.actfileclose.hint msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT" msgid "Close" msgstr "Fechar" #: tfrmeditor.actfileexit.caption msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION" msgid "E&xit" msgstr "&Sair" #: tfrmeditor.actfileexit.hint msgctxt "tfrmeditor.actfileexit.hint" msgid "Exit" msgstr "Sair" #: tfrmeditor.actfilenew.caption msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION" msgid "&New" msgstr "&Novo" #: tfrmeditor.actfilenew.hint msgctxt "TFRMEDITOR.ACTFILENEW.HINT" msgid "New" msgstr "Novo" #: tfrmeditor.actfileopen.caption msgid "&Open" msgstr "&Abrir" #: tfrmeditor.actfileopen.hint msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT" msgid "Open" msgstr "Abrir" #: tfrmeditor.actfilereload.caption #, fuzzy msgctxt "tfrmeditor.actfilereload.caption" msgid "Reload" msgstr "Recarregar" #: tfrmeditor.actfilesave.caption msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION" msgid "&Save" msgstr "&Gravar" #: tfrmeditor.actfilesave.hint msgctxt "TFRMEDITOR.ACTFILESAVE.HINT" msgid "Save" msgstr "Gravar" #: tfrmeditor.actfilesaveas.caption msgid "Save &As..." msgstr "Gr&avar como..." #: tfrmeditor.actfilesaveas.hint msgid "Save As" msgstr "Gravar como" #: tfrmeditor.actsaveall.caption msgid "Sa&ve All" msgstr "Gra&var tudo" #: tfrmeditor.actsaveall.hint msgid "Save All" msgstr "Gravar tudo" #: tfrmeditor.caption msgctxt "TFRMEDITOR.CAPTION" msgid "Editor" msgstr "Editor" #: tfrmeditor.help1.caption msgctxt "TFRMEDITOR.HELP1.CAPTION" msgid "&Help" msgstr "A&juda" #: tfrmeditor.miedit.caption msgctxt "TFRMEDITOR.MIEDIT.CAPTION" msgid "&Edit" msgstr "&Editar" #: tfrmeditor.miencoding.caption msgctxt "TFRMEDITOR.MIENCODING.CAPTION" msgid "En&coding" msgstr "&Codificar" #: tfrmeditor.miencodingin.caption msgid "Open as" msgstr "Abrir como" #: tfrmeditor.miencodingout.caption msgctxt "tfrmeditor.miencodingout.caption" msgid "Save as" msgstr "Gravar como" #: tfrmeditor.mifile.caption msgctxt "TFRMEDITOR.MIFILE.CAPTION" msgid "&File" msgstr "&Ficheiro" #: tfrmeditor.mihighlight.caption msgid "Syntax highlight" msgstr "Realçar sintaxe" #: tfrmeditor.milineendtype.caption msgid "End Of Line" msgstr "Fim de linha" #: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption" msgid "&Cancel" msgstr "&Cancelar" #: tfrmeditsearchreplace.buttonpanel.okbutton.caption msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption" msgid "&OK" msgstr "&Aceitar" #: tfrmeditsearchreplace.cbsearchcasesensitive.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION" msgid "C&ase sensitivity" msgstr "Sensível a m&aiúsculas" #: tfrmeditsearchreplace.cbsearchfromcursor.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION" msgid "S&earch from caret" msgstr "&Localizar do cursor" #: tfrmeditsearchreplace.cbsearchregexp.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION" msgid "&Regular expressions" msgstr "Expressões ®ulares" #: tfrmeditsearchreplace.cbsearchselectedonly.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION" msgid "Selected &text only" msgstr "Só &texto seleccionado" #: tfrmeditsearchreplace.cbsearchwholewords.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION" msgid "&Whole words only" msgstr "Só &palavras completas" #: tfrmeditsearchreplace.gbsearchoptions.caption msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION" msgid "Option" msgstr "Opção" #: tfrmeditsearchreplace.lblreplacewith.caption msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION" msgid "&Replace with:" msgstr "Substitui&r com" #: tfrmeditsearchreplace.lblsearchfor.caption msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION" msgid "&Search for:" msgstr "Proc&urar por:" #: tfrmeditsearchreplace.rgsearchdirection.caption msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION" msgid "Direction" msgstr "Direcção" #: tfrmextractdlg.caption msgctxt "TFRMEXTRACTDLG.CAPTION" msgid "Unpack files" msgstr "Descomprimir ficheiros" #: tfrmextractdlg.cbextractpath.caption msgid "&Unpack path names if stored with files" msgstr "&Descomprimir nomes de caminho se armazenados com os ficheiros" #: tfrmextractdlg.cbfilemask.text msgctxt "tfrmextractdlg.cbfilemask.text" msgid "*.*" msgstr "*.*" #: tfrmextractdlg.cbinseparatefolder.caption msgid "Unpack each archive to a &separate subdir (name of the archive)" msgstr "Descomprimir cada arquivo para pastas &separadas (nome do arquivo)" #: tfrmextractdlg.cboverwrite.caption msgid "O&verwrite existing files" msgstr "Sobrescre&ver ficheiros existentes" #: tfrmextractdlg.lblextractto.caption msgid "To the &directory:" msgstr "Para a &pasta:" #: tfrmextractdlg.lblfilemask.caption msgid "&Extract files matching file mask:" msgstr "&Extrair ficheiros com esta máscara:" #: tfrmextractdlg.lblpassword.caption msgid "&Password for encrypted files:" msgstr "Senha de ficheiros encri&ptados:" #: tfrmfileexecuteyourself.btnclose.caption msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Fe&char" #: tfrmfileexecuteyourself.caption msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION" msgid "Wait..." msgstr "Aguarde..." #: tfrmfileexecuteyourself.lblfilename.caption msgid "File name:" msgstr "Nome de ficheiro:" #: tfrmfileexecuteyourself.lblfrompath.caption msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION" msgid "From:" msgstr "De:" #: tfrmfileexecuteyourself.lblprompt.caption msgid "Click on Close when the temporary file can be deleted!" msgstr "Clique em Fechar quando o ficheiro temporário puder ser apagado!" #: tfrmfileop.btncancel.caption msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmfileop.btnminimizetopanel.caption msgid "&To panel" msgstr "&Para o painel" #: tfrmfileop.btnviewoperations.caption msgid "&View all" msgstr "&Ver tudo" #: tfrmfileop.lblcurrentoperation.caption msgid "Current operation:" msgstr "Operação actual" #: tfrmfileop.lblfrom.caption msgctxt "TFRMFILEOP.LBLFROM.CAPTION" msgid "From:" msgstr "De:" #: tfrmfileop.lblto.caption msgid "To:" msgstr "Para:" #: tfrmfileproperties.btnclose.caption msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Fe&char" #: tfrmfileproperties.btnsetproperties.caption msgid "&Set properties" msgstr "&Definir propriedades" #: tfrmfileproperties.btnsetpropertiestoallfiles.caption msgid "Set to &all selected files" msgstr "P&ara todos os seleccionados" #: tfrmfileproperties.btnskipfile.caption msgid "Ski&p this file" msgstr "Sa<ar este ficheiro" #: tfrmfileproperties.caption msgctxt "TFRMFILEPROPERTIES.CAPTION" msgid "Properties" msgstr "Propriedades" #: tfrmfileproperties.cbsgid.caption msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmfileproperties.cbsticky.caption msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Pegajoso" #: tfrmfileproperties.cbsuid.caption msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmfileproperties.chkexecutable.caption msgid "Allow &executing file as program" msgstr "Permitir &Executar ficheiro como programa" #: tfrmfileproperties.gbowner.caption msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION" msgid "Owner" msgstr "Dono" #: tfrmfileproperties.lblattrbitsstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bits:" #: tfrmfileproperties.lblattrgroupstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Grupo" #: tfrmfileproperties.lblattrotherstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Outro" #: tfrmfileproperties.lblattrownerstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Dono" #: tfrmfileproperties.lblattrtext.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "-----------" #: tfrmfileproperties.lblattrtextstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "Texto:" #: tfrmfileproperties.lblcontains.caption msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblcontainsstr.caption msgid "Contains:" msgstr "Contém:" #: tfrmfileproperties.lblexec.caption msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "Executar" #: tfrmfileproperties.lblexecutable.caption msgid "Execute:" msgstr "Executar:" #: tfrmfileproperties.lblfile.caption msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION" msgid "File name" msgstr "Nome de ficheiro" #: tfrmfileproperties.lblfilename.caption msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblfilestr.caption msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION" msgid "File name" msgstr "Nome de ficheiro" #: tfrmfileproperties.lblfolder.caption msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblfolderstr.caption msgctxt "tfrmfileproperties.lblfolderstr.caption" msgid "Path:" msgstr "Caminho:" #: tfrmfileproperties.lblgroupstr.caption msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION" msgid "&Group" msgstr "&Grupo" #: tfrmfileproperties.lbllastaccess.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllastaccessstr.caption msgid "Last access:" msgstr "Último acesso:" #: tfrmfileproperties.lbllastmodif.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllastmodifstr.caption msgid "Last modification:" msgstr "Última modificação:" #: tfrmfileproperties.lbllaststchange.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllaststchangestr.caption msgid "Last status change:" msgstr "Última alteração de estado:" #: tfrmfileproperties.lbloctal.caption msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "Octal:" #: tfrmfileproperties.lblownerstr.caption msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION" msgid "O&wner" msgstr "&Dono" #: tfrmfileproperties.lblread.caption msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "Ler" #: tfrmfileproperties.lblsize.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblsizestr.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION" msgid "Size:" msgstr "Tamanho:" #: tfrmfileproperties.lblsymlink.caption msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblsymlinkstr.caption msgid "Symlink to:" msgstr "Ligação simbólica a:" #: tfrmfileproperties.lbltype.caption msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbltypestr.caption msgid "Type:" msgstr "Tipo:" #: tfrmfileproperties.lblwrite.caption msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "Escrever" #: tfrmfileproperties.sgimage.columns[0].title.caption msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption" msgid "Name" msgstr "Nome" #: tfrmfileproperties.sgimage.columns[1].title.caption msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption" msgid "Value" msgstr "Valor" #: tfrmfileproperties.tsattributes.caption msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Atributos" #: tfrmfileproperties.tsplugins.caption msgctxt "tfrmfileproperties.tsplugins.caption" msgid "Plugins" msgstr "Extensões" #: tfrmfileproperties.tsproperties.caption msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION" msgid "Properties" msgstr "Propriedades" #: tfrmfinddlg.actcancel.caption msgctxt "tfrmfinddlg.actcancel.caption" msgid "C&ancel" msgstr "C&ancelar" #: tfrmfinddlg.actcancelclose.caption msgid "Cancel search and close window" msgstr "Cancelar procura e fechar janela" #: tfrmfinddlg.actclose.caption msgctxt "tfrmfinddlg.actclose.caption" msgid "&Close" msgstr "Fe&char" #: tfrmfinddlg.actconfigfilesearchhotkeys.caption msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption" msgid "Configuration of hot keys" msgstr "Configuração de atalhos" #: tfrmfinddlg.actedit.caption msgctxt "tfrmfinddlg.actedit.caption" msgid "&Edit" msgstr "&Editar" #: tfrmfinddlg.actfeedtolistbox.caption msgctxt "tfrmfinddlg.actfeedtolistbox.caption" msgid "Feed to &listbox" msgstr "Enviar à &lista" #: tfrmfinddlg.actfreefrommem.caption msgid "Cancel search, close and free from memory" msgstr "Cancelar procura, fechar e libertar memória" #: tfrmfinddlg.actfreefrommemallothers.caption msgid "For all other \"Find files\", cancel, close and free from memory" msgstr "Para todos os \"Localizar ficheiros\", cancelar, fechar e libertar memória" #: tfrmfinddlg.actgotofile.caption msgctxt "tfrmfinddlg.actgotofile.caption" msgid "&Go to file" msgstr "&Ir para ficheiro" #: tfrmfinddlg.actintellifocus.caption msgctxt "tfrmfinddlg.actintellifocus.caption" msgid "Find Data" msgstr "Localizar dados" #: tfrmfinddlg.actlastsearch.caption msgctxt "tfrmfinddlg.actlastsearch.caption" msgid "&Last search" msgstr "Ú<ima procura" #: tfrmfinddlg.actnewsearch.caption msgctxt "tfrmfinddlg.actnewsearch.caption" msgid "&New search" msgstr "&Nova procura" #: tfrmfinddlg.actnewsearchclearfilters.caption msgid "New search (clear filters)" msgstr "Nova procura (limpar filtros)" #: tfrmfinddlg.actpageadvanced.caption msgid "Go to page \"Advanced\"" msgstr "Ir para a página \"Avançado\"" #: tfrmfinddlg.actpageloadsave.caption msgid "Go to page \"Load/Save\"" msgstr "Ir para a página \"Carregar/Gravar\"" #: tfrmfinddlg.actpagenext.caption msgid "Switch to Nex&t Page" msgstr "Mudar para a página seguin&te" #: tfrmfinddlg.actpageplugins.caption msgid "Go to page \"Plugins\"" msgstr "Ir para a página \"Extensões\"" #: tfrmfinddlg.actpageprev.caption msgid "Switch to &Previous Page" msgstr "Mudar para a &página anterior" #: tfrmfinddlg.actpageresults.caption msgid "Go to page \"Results\"" msgstr "Ir para a página \"Resultados\"" #: tfrmfinddlg.actpagestandard.caption msgid "Go to page \"Standard\"" msgstr "Ir para a página \"Padrão\"" #: tfrmfinddlg.actstart.caption msgctxt "tfrmfinddlg.actstart.caption" msgid "&Start" msgstr "&Iniciar" #: tfrmfinddlg.actview.caption msgctxt "tfrmfinddlg.actview.caption" msgid "&View" msgstr "&Ver" #: tfrmfinddlg.btnaddattribute.caption msgctxt "tfrmfinddlg.btnaddattribute.caption" msgid "&Add" msgstr "&Adicionar" #: tfrmfinddlg.btnattrshelp.caption msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION" msgid "&Help" msgstr "A&juda" #: tfrmfinddlg.btnsavetemplate.caption msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION" msgid "&Save" msgstr "&Gravar" #: tfrmfinddlg.btnsearchdelete.caption msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION" msgid "&Delete" msgstr "&Eliminar" #: tfrmfinddlg.btnsearchload.caption msgid "L&oad" msgstr "&Carregar" #: tfrmfinddlg.btnsearchsave.caption msgid "S&ave" msgstr "Gr&avar" #: tfrmfinddlg.btnsearchsavewithstartingpath.caption msgid "Sa&ve with \"Start in directory\"" msgstr "Gra&var com \"Iniciar na pasta\"" #: tfrmfinddlg.btnsearchsavewithstartingpath.hint msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory" msgstr "Se gravado então \"Iniciar na pasta\" será restaurado ao carregar o modelo. Use se quer fixar a procura numa determinada pasta" #: tfrmfinddlg.btnusetemplate.caption msgid "Use template" msgstr "Usar modelo" #: tfrmfinddlg.caption msgctxt "TFRMFINDDLG.CAPTION" msgid "Find files" msgstr "Localizar ficheiros" #: tfrmfinddlg.cbcasesens.caption msgid "Case sens&itive" msgstr "Sensível a ma&iúsculas" #: tfrmfinddlg.cbdatefrom.caption msgid "&Date from:" msgstr "&Data de:" #: tfrmfinddlg.cbdateto.caption msgid "Dat&e to:" msgstr "Da&ta até:" #: tfrmfinddlg.cbfilesizefrom.caption msgid "S&ize from:" msgstr "Ta&manho de:" #: tfrmfinddlg.cbfilesizeto.caption msgid "Si&ze to:" msgstr "Tam&anho até:" #: tfrmfinddlg.cbfindinarchive.caption msgid "Search in &archives" msgstr "Procurar em &arquivos" #: tfrmfinddlg.cbfindtext.caption msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION" msgid "Find &text in file" msgstr "Localizar &texto num ficheiro" #: tfrmfinddlg.cbfollowsymlinks.caption msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION" msgid "Follow s&ymlinks" msgstr "Seguir s&imbólicas" #: tfrmfinddlg.cbnotcontainingtext.caption msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION" msgid "Find files N&OT containing the text" msgstr "Localizar ficheiros S&EM o texto" #: tfrmfinddlg.cbnotolderthan.caption msgid "N&ot older than:" msgstr "Mais recentes q&ue:" #: tfrmfinddlg.cbopenedtabs.caption msgid "Opened tabs" msgstr "Separadores abertos" #: tfrmfinddlg.cbpartialnamesearch.caption msgid "Searc&h for part of file name" msgstr "Procurar parte do nome de ficheiro" #: tfrmfinddlg.cbregexp.caption msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION" msgid "&Regular expression" msgstr "Expressão ®ular" #: tfrmfinddlg.cbreplacetext.caption msgid "Re&place by" msgstr "Substituir &por" #: tfrmfinddlg.cbselectedfiles.caption msgid "Selected directories and &files" msgstr "Pastas e &ficheiros seleccionados" #: tfrmfinddlg.cbtextregexp.caption msgid "Regular &expression" msgstr "&Expressão regular" #: tfrmfinddlg.cbtimefrom.caption msgid "&Time from:" msgstr "&Hora de:" #: tfrmfinddlg.cbtimeto.caption msgid "Ti&me to:" msgstr "H&ora até:" #: tfrmfinddlg.cbuseplugin.caption msgid "&Use search plugin:" msgstr "&Usar extensão de procura:" #: tfrmfinddlg.chkhex.caption msgid "Hexadecimal" msgstr "" #: tfrmfinddlg.cmbexcludedirectories.hint msgid "Enter directories names that should be excluded from search separated with \";\"" msgstr "Insira os nomes das pastas a excluir da procura separados por \";\"" #: tfrmfinddlg.cmbexcludefiles.hint msgid "Enter files names that should be excluded from search separated with \";\"" msgstr "Insira os nomes dos ficheiros a excluir da procura separados por \";\"" #: tfrmfinddlg.cmbfindfilemask.hint msgid "Enter files names separated with \";\"" msgstr "Insira os nomes de ficheiros separados por \";\"" #: tfrmfinddlg.gbdirectories.caption msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION" msgid "Directories" msgstr "Pastas" #: tfrmfinddlg.gbfiles.caption msgctxt "TFRMFINDDLG.GBFILES.CAPTION" msgid "Files" msgstr "Ficheiros" #: tfrmfinddlg.gbfinddata.caption msgctxt "tfrmfinddlg.gbfinddata.caption" msgid "Find Data" msgstr "Localizar dados" #: tfrmfinddlg.lblattributes.caption msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION" msgid "Attri&butes" msgstr "Atri&butos" #: tfrmfinddlg.lblencoding.caption msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION" msgid "Encodin&g:" msgstr "Co&dificar" #: tfrmfinddlg.lblexcludedirectories.caption msgid "E&xclude subdirectories" msgstr "E&xcluir sub-pastas" #: tfrmfinddlg.lblexcludefiles.caption msgid "&Exclude files" msgstr "&Excluir ficheiros" #: tfrmfinddlg.lblfindfilemask.caption msgid "&File mask" msgstr "&Máscara" #: tfrmfinddlg.lblfindpathstart.caption msgid "Start in &directory" msgstr "Iniciar na &pasta" #: tfrmfinddlg.lblsearchdepth.caption msgid "Search su&bdirectories:" msgstr "Procurar em su&b-pastas:" #: tfrmfinddlg.lbltemplateheader.caption msgid "&Previous searches:" msgstr "Procuras &prévias" #: tfrmfinddlg.miaction.caption msgid "&Action" msgstr "&Acção" #: tfrmfinddlg.mifreefrommemallothers.caption msgid "For all others, cancel, close and free from memory" msgstr "Para todos os outros, cancelar, fechar e libertar memória" #: tfrmfinddlg.miopeninnewtab.caption msgid "Open In New Tab(s)" msgstr "Abrir em novo separador" #: tfrmfinddlg.mioptions.caption msgctxt "tfrmfinddlg.mioptions.caption" msgid "Options" msgstr "Opções" #: tfrmfinddlg.miremovefromllist.caption msgid "Remove from list" msgstr "Remover da lista" #: tfrmfinddlg.miresult.caption msgid "&Result" msgstr "&Resultado" #: tfrmfinddlg.mishowallfound.caption msgid "Show all found items" msgstr "Mostrar todos os itens" #: tfrmfinddlg.mishowineditor.caption msgid "Show In Editor" msgstr "Mostrar no editor" #: tfrmfinddlg.mishowinviewer.caption msgid "Show In Viewer" msgstr "Mostrar no visualizador" #: tfrmfinddlg.miviewtab.caption msgctxt "tfrmfinddlg.miviewtab.caption" msgid "&View" msgstr "&Ver" #: tfrmfinddlg.tsadvanced.caption msgid "Advanced" msgstr "Avançado" #: tfrmfinddlg.tsloadsave.caption msgid "Load/Save" msgstr "Carregar/Gravar" #: tfrmfinddlg.tsplugins.caption msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION" msgid "Plugins" msgstr "Extensões" #: tfrmfinddlg.tsresults.caption msgid "Results" msgstr "Resultados" #: tfrmfinddlg.tsstandard.caption msgid "Standard" msgstr "Padrão" #: tfrmfindview.btnclose.caption msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmfindview.btnfind.caption msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION" msgid "&Find" msgstr "&Localizar" #: tfrmfindview.caption msgctxt "TFRMFINDVIEW.CAPTION" msgid "Find" msgstr "Localizar" #: tfrmfindview.cbcasesens.caption msgid "C&ase sensitive" msgstr "Sensível a m&aiúsculas" #: tfrmhardlink.btncancel.caption msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmhardlink.btnok.caption msgctxt "TFRMHARDLINK.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmhardlink.caption msgid "Create hard link" msgstr "Criar ligação física" #: tfrmhardlink.lblexistingfile.caption msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "&Destino para onde a ligação aponta" #: tfrmhardlink.lbllinktocreate.caption msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "Nome da &ligação" #: tfrmhotdirexportimport.btnselectall.caption msgctxt "tfrmhotdirexportimport.btnselectall.caption" msgid "Import all!" msgstr "Importar tudo!" #: tfrmhotdirexportimport.btnselectiondone.caption msgctxt "tfrmhotdirexportimport.btnselectiondone.caption" msgid "Import selected" msgstr "Importar selecção" #: tfrmhotdirexportimport.caption msgctxt "tfrmhotdirexportimport.caption" msgid "Select the entries your want to import" msgstr "Seleccione as entradas a importar" #: tfrmhotdirexportimport.lbhint.caption msgctxt "tfrmhotdirexportimport.lbhint.caption" msgid "When clicking a sub-menu, it will select the whole menu" msgstr "Ao clicar num sub-menu, selecciona todo o menu" #: tfrmhotdirexportimport.lblhintholdcontrol.caption msgid "Hold CTRL and click entries to select multiple ones" msgstr "Prima Ctrl e clique para seleccionar múltiplas entradas" #: tfrmlinker.btnsave.caption msgctxt "TFRMLINKER.BTNSAVE.CAPTION" msgid "..." msgstr "..." #: tfrmlinker.caption msgctxt "TFRMLINKER.CAPTION" msgid "Linker" msgstr "Ligador" #: tfrmlinker.gbsaveto.caption msgid "Save to..." msgstr "Gravar em..." #: tfrmlinker.grbxcontrol.caption msgid "Item" msgstr "Item" #: tfrmlinker.lblfilename.caption msgctxt "TFRMLINKER.LBLFILENAME.CAPTION" msgid "&File name" msgstr "Nome de &ficheiro" #: tfrmlinker.spbtndown.caption msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION" msgid "Do&wn" msgstr "A&baixo" #: tfrmlinker.spbtndown.hint msgctxt "TFRMLINKER.SPBTNDOWN.HINT" msgid "Down" msgstr "Abaixo" #: tfrmlinker.spbtnrem.caption msgctxt "tfrmlinker.spbtnrem.caption" msgid "&Remove" msgstr "&Remover" #: tfrmlinker.spbtnrem.hint msgctxt "tfrmlinker.spbtnrem.hint" msgid "Delete" msgstr "Eliminar" #: tfrmlinker.spbtnup.caption msgctxt "TFRMLINKER.SPBTNUP.CAPTION" msgid "&Up" msgstr "A&cima" #: tfrmlinker.spbtnup.hint msgctxt "TFRMLINKER.SPBTNUP.HINT" msgid "Up" msgstr "Acima" #: tfrmmain.actabout.caption msgctxt "TFRMMAIN.ACTABOUT.CAPTION" msgid "&About" msgstr "&Sobre" #: tfrmmain.actaddfilenametocmdline.caption msgid "Add file name to command line" msgstr "Adicionar nome de ficheiro à linha de comandos" #: tfrmmain.actaddnewsearch.caption msgid "New search instance..." msgstr "Nova instância de procura..." #: tfrmmain.actaddpathandfilenametocmdline.caption msgid "Add path and file name to command line" msgstr "Adicionar caminho e nome de ficheiro à linha de comandos" #: tfrmmain.actaddpathtocmdline.caption msgid "Copy path to command line" msgstr "Copiar caminho para a linha de comandos" #: tfrmmain.actbenchmark.caption msgid "&Benchmark" msgstr "" #: tfrmmain.actbriefview.caption msgctxt "tfrmmain.actbriefview.caption" msgid "Brief view" msgstr "Vista breve" #: tfrmmain.actbriefview.hint msgid "Brief View" msgstr "Vista breve" #: tfrmmain.actcalculatespace.caption msgid "Calculate &Occupied Space" msgstr "Calcular espaço &ocupado" #: tfrmmain.actchangedir.caption msgid "Change directory" msgstr "Alterar pasta" #: tfrmmain.actchangedirtohome.caption msgid "Change directory to home" msgstr "Alterar pasta para home" #: tfrmmain.actchangedirtoparent.caption msgid "Change Directory To Parent" msgstr "Alterar pasta para pasta-mãe" #: tfrmmain.actchangedirtoroot.caption msgid "Change directory to root" msgstr "Alterar pasta para raiz" #: tfrmmain.actchecksumcalc.caption msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION" msgid "Calculate Check&sum..." msgstr "Calcular check&sum" #: tfrmmain.actchecksumverify.caption msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION" msgid "&Verify Checksum..." msgstr "&Verificar checksum" #: tfrmmain.actclearlogfile.caption msgid "Clear log file" msgstr "Limpar diário" #: tfrmmain.actclearlogwindow.caption msgid "Clear log window" msgstr "Limpar janela de diário" #: tfrmmain.actclosealltabs.caption msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION" msgid "Close &All Tabs" msgstr "Fech&ar todos os separadores" #: tfrmmain.actcloseduplicatetabs.caption msgid "Close Duplicate Tabs" msgstr "Fechar separadores duplicados" #: tfrmmain.actclosetab.caption msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION" msgid "&Close Tab" msgstr "Fe&char separador" #: tfrmmain.actcmdlinenext.caption msgid "Next Command Line" msgstr "Linha de comandos seguinte" #: tfrmmain.actcmdlinenext.hint msgid "Set command line to next command in history" msgstr "Definir linha de comandos para o comando seguinte do histórico" #: tfrmmain.actcmdlineprev.caption msgid "Previous Command Line" msgstr "Linha de comandos anterior" #: tfrmmain.actcmdlineprev.hint msgid "Set command line to previous command in history" msgstr "Definir linha de comandos para o comando anterior do histórico" #: tfrmmain.actcolumnsview.caption msgid "Full" msgstr "Completo" #: tfrmmain.actcolumnsview.hint msgid "Columns View" msgstr "Vista de colunas" #: tfrmmain.actcomparecontents.caption msgid "Compare by &Contents" msgstr "&Comparar por conteúdos" #: tfrmmain.actcomparedirectories.caption msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION" msgid "Compare Directories" msgstr "Comparar pastas" #: tfrmmain.actcomparedirectories.hint msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT" msgid "Compare Directories" msgstr "Comparar pastas" #: tfrmmain.actconfigarchivers.caption msgid "Configuration of Archivers" msgstr "" #: tfrmmain.actconfigdirhotlist.caption msgctxt "tfrmmain.actconfigdirhotlist.caption" msgid "Configuration of Directory Hotlist" msgstr "Configuração da lista de pastas" #: tfrmmain.actconfigfavoritetabs.caption msgid "Configuration of Favorite Tabs" msgstr "Configuração de separadores favoritos" #: tfrmmain.actconfigfoldertabs.caption msgid "Configuration of folder tabs" msgstr "Configuração de separadores de pastas" #: tfrmmain.actconfighotkeys.caption msgctxt "tfrmmain.actconfighotkeys.caption" msgid "Configuration of hot keys" msgstr "Configuração de atalhos" #: tfrmmain.actconfigsavesettings.caption msgid "Save Settings" msgstr "Gravar definições" #: tfrmmain.actconfigsearches.caption msgid "Configuration of searches" msgstr "Configuração de procuras" #: tfrmmain.actconfigtoolbars.caption msgid "Toolbar..." msgstr "Barra de ferramentas..." #: tfrmmain.actconfigtreeviewmenus.caption msgctxt "tfrmmain.actconfigtreeviewmenus.caption" msgid "Configuration of Tree View Menu" msgstr "Configuração do menu da árvore" #: tfrmmain.actconfigtreeviewmenuscolors.caption msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption" msgid "Configuration of Tree View Menu Colors" msgstr "Configuração de cores do menu da árvore" #: tfrmmain.actcontextmenu.caption msgid "Show context menu" msgstr "Mostrar menu contextual" #: tfrmmain.actcopy.caption msgctxt "tfrmmain.actcopy.caption" msgid "Copy" msgstr "Copiar" #: tfrmmain.actcopyalltabstoopposite.caption msgid "Copy all tabs to opposite side" msgstr "Copiar todos os separadores para o lado oposto" #: tfrmmain.actcopyfiledetailstoclip.caption msgid "Copy all shown &columns" msgstr "Copiar todas as &colunas mostradas" #: tfrmmain.actcopyfullnamestoclip.caption msgid "Copy Filename(s) with Full &Path" msgstr "Copiar nomes de ficheiros com caminho com&pleto" #: tfrmmain.actcopynamestoclip.caption msgid "Copy &Filename(s) to Clipboard" msgstr "Copiar nomes de &ficheiros para a área de transferência" #: tfrmmain.actcopynoask.caption msgid "Copy files without asking for confirmation" msgstr "Copiar ficheiros sem pedir confirmação" #: tfrmmain.actcopypathnosepoffilestoclip.caption msgid "Copy Full Path of selected file(s) with no ending dir separator" msgstr "Copiar caminho completo dos ficheiros seleccionados sem separador de pasta final" #: tfrmmain.actcopypathoffilestoclip.caption msgid "Copy Full Path of selected file(s)" msgstr "Copiar caminho completo dos ficheiros seleccionados" #: tfrmmain.actcopysamepanel.caption msgid "Copy to same panel" msgstr "Copiar para o mesmo painel" #: tfrmmain.actcopytoclipboard.caption msgid "&Copy" msgstr "&Copiar" #: tfrmmain.actcountdircontent.caption msgid "Sho&w Occupied Space" msgstr "Mostrar espaço oc&upado" #: tfrmmain.actcuttoclipboard.caption msgid "Cu&t" msgstr "Cor&tar" #: tfrmmain.actdebugshowcommandparameters.caption msgid "Show Command Parameters" msgstr "Mostrar parâmetros de comando" #: tfrmmain.actdelete.caption msgctxt "TFRMMAIN.ACTDELETE.CAPTION" msgid "Delete" msgstr "Eliminar" #: tfrmmain.actdeletesearches.caption msgid "For all searches, cancel, close and free memory" msgstr "Para todas as procuras, cancelar, fechar e libertar memória" #: tfrmmain.actdirhistory.caption msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION" msgid "Directory history" msgstr "Histórico da pasta" #: tfrmmain.actdirhotlist.caption msgid "Directory &Hotlist" msgstr "&Lista da pasta" #: tfrmmain.actdoanycmcommand.caption msgid "Select any command and execute it" msgstr "Seleccione qualquer comando e execute-o" #: tfrmmain.actedit.caption msgctxt "tfrmmain.actedit.caption" msgid "Edit" msgstr "Editar" #: tfrmmain.acteditcomment.caption msgid "Edit Co&mment..." msgstr "Editar co&mentário..." #: tfrmmain.acteditnew.caption msgid "Edit new file" msgstr "Editar novo ficheiro" #: tfrmmain.acteditpath.caption msgid "Edit path field above file list" msgstr "Editar campo de caminho acima da lista de ficheiros" #: tfrmmain.actexchange.caption msgid "Swap &Panels" msgstr "Trocar &painéis" #: tfrmmain.actexecutescript.caption msgid "Execute Script" msgstr "Executar script" #: tfrmmain.actexit.caption msgctxt "TFRMMAIN.ACTEXIT.CAPTION" msgid "E&xit" msgstr "&Sair" #: tfrmmain.actextractfiles.caption msgid "&Extract Files..." msgstr "&Extrair ficheiros..." #: tfrmmain.actfileassoc.caption msgid "Configuration of File &Associations" msgstr "&Associações de ficheiros..." #: tfrmmain.actfilelinker.caption msgid "Com&bine Files..." msgstr "Com&binar ficheiros..." #: tfrmmain.actfileproperties.caption msgid "Show &File Properties" msgstr "Mostrar propriedades de &ficheiro" #: tfrmmain.actfilespliter.caption msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION" msgid "Spl&it File..." msgstr "D&ividir ficheiro" #: tfrmmain.actflatview.caption msgid "&Flat view" msgstr "Vista &plana" #: tfrmmain.actfocuscmdline.caption msgid "Focus command line" msgstr "Foco na linha de comandos" #: tfrmmain.actfocusswap.caption msgid "Swap focus" msgstr "Trocar foco" #: tfrmmain.actfocusswap.hint msgid "Switch between left and right file list" msgstr "Trocar entre a lista esquerda e direita" #: tfrmmain.actgotofirstfile.caption msgid "Place cursor on first file in list" msgstr "Colocar cursor no primeiro ficheiro da lista" #: tfrmmain.actgotolastfile.caption msgid "Place cursor on last file in list" msgstr "Colocar cursor no último ficheiro da lista" #: tfrmmain.acthardlink.caption msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION" msgid "Create &Hard Link..." msgstr "Criar li&gação física" #: tfrmmain.acthelpindex.caption msgid "&Contents" msgstr "&Conteúdo" #: tfrmmain.acthorizontalfilepanels.caption msgid "&Horizontal Panels Mode" msgstr "Modo Painéis &horizontais" #: tfrmmain.actkeyboard.caption msgid "&Keyboard" msgstr "&Teclado" #: tfrmmain.actleftbriefview.caption msgid "Brief view on left panel" msgstr "Vista breve no painel esquerdo" #: tfrmmain.actleftcolumnsview.caption msgid "Columns view on left panel" msgstr "Vista de colunas no painel esquedo" #: tfrmmain.actleftequalright.caption msgid "Left &= Right" msgstr "Esquerdo &= Direito" #: tfrmmain.actleftflatview.caption msgid "&Flat view on left panel" msgstr "Vista &plana no painel esquerdo" #: tfrmmain.actleftopendrives.caption msgid "Open left drive list" msgstr "Abrir lista esquerda de unidades" #: tfrmmain.actleftreverseorder.caption msgid "Re&verse order on left panel" msgstr "Orden in&versa no painel esquerdo" #: tfrmmain.actleftsortbyattr.caption msgid "Sort left panel by &Attributes" msgstr "Ordenar painel esquerdo por &atributos" #: tfrmmain.actleftsortbydate.caption msgid "Sort left panel by &Date" msgstr "Ordenar painel esquerdo por &data" #: tfrmmain.actleftsortbyext.caption msgid "Sort left panel by &Extension" msgstr "Ordenar painel esquerdo por &extensão" #: tfrmmain.actleftsortbyname.caption msgid "Sort left panel by &Name" msgstr "Ordenar painel esquerdo por &nome" #: tfrmmain.actleftsortbysize.caption msgid "Sort left panel by &Size" msgstr "Ordenar painel esquerdo por &tamanho" #: tfrmmain.actleftthumbview.caption msgid "Thumbnails view on left panel" msgstr "Vista de miniaturas no painel esquerdo" #: tfrmmain.actloadfavoritetabs.caption msgid "Load tabs from Favorite Tabs" msgstr "Carregar separadores dos favoritos" #: tfrmmain.actloadselectionfromclip.caption msgid "Load Selection from Clip&board" msgstr "Carregar selecção da área de transferência" #: tfrmmain.actloadselectionfromfile.caption msgid "&Load Selection from File..." msgstr "Carregar se&lecção de ficheiro..." #: tfrmmain.actloadtabs.caption msgid "&Load Tabs from File" msgstr "Carregar &separadores de ficheiro" #: tfrmmain.actmakedir.caption msgid "Create &Directory" msgstr "Criar &pasta" #: tfrmmain.actmarkcurrentextension.caption msgid "Select All with the Same E&xtension" msgstr "Seleccionar todos com a mesma e&xtensão" #: tfrmmain.actmarkcurrentname.caption msgid "Select all files with same name" msgstr "Seleccionar todos com o mesmo nome" #: tfrmmain.actmarkcurrentnameext.caption msgid "Select all files with same name and extension" msgstr "Seleccionar todos com o mesmo nome e extensão" #: tfrmmain.actmarkcurrentpath.caption msgid "Select all in same path" msgstr "Seleccionar todos no mesmo caminho" #: tfrmmain.actmarkinvert.caption msgid "&Invert Selection" msgstr "&Inverter selecção" #: tfrmmain.actmarkmarkall.caption msgid "&Select All" msgstr "&Seleccionar tudo" #: tfrmmain.actmarkminus.caption msgid "Unselect a Gro&up..." msgstr "Remover selecção de grupo..." #: tfrmmain.actmarkplus.caption msgid "Select a &Group..." msgstr "Seleccionar &grupo" #: tfrmmain.actmarkunmarkall.caption msgid "&Unselect All" msgstr "Rem&over todas as selecções" #: tfrmmain.actminimize.caption msgid "Minimize window" msgstr "Minimizar janela" #: tfrmmain.actmultirename.caption msgid "Multi &Rename Tool" msgstr "Ferramenta Multi-renomear" #: tfrmmain.actnetworkconnect.caption msgid "Network &Connect..." msgstr "Li&gar a rede..." #: tfrmmain.actnetworkdisconnect.caption msgid "Network &Disconnect" msgstr "&Desligar de rede" #: tfrmmain.actnetworkquickconnect.caption msgid "Network &Quick Connect..." msgstr "Ligação &rápida a rede..." #: tfrmmain.actnewtab.caption msgid "&New Tab" msgstr "&Novo separador" #: tfrmmain.actnextfavoritetabs.caption msgid "Load the Next Favorite Tabs in the list" msgstr "Carregar os favoritos seguintes na lista" #: tfrmmain.actnexttab.caption msgid "Switch to Nex&t Tab" msgstr "Mudar para o separador seguin&te" #: tfrmmain.actopen.caption msgctxt "TFRMMAIN.ACTOPEN.CAPTION" msgid "Open" msgstr "Abrir" #: tfrmmain.actopenarchive.caption msgid "Try open archive" msgstr "Tentar abrir arquivo" #: tfrmmain.actopenbar.caption msgid "Open bar file" msgstr "Abrir ficheiro barra" #: tfrmmain.actopendirinnewtab.caption msgid "Open &Folder in a New Tab" msgstr "Abrir &pasta em novo separador" #: tfrmmain.actopenvirtualfilesystemlist.caption msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION" msgid "Open &VFS List" msgstr "Abrir lista do S&VF" #: tfrmmain.actoperationsviewer.caption msgid "Operations &Viewer" msgstr "&Visualizador de operações" #: tfrmmain.actoptions.caption msgid "&Options..." msgstr "&Opções..." #: tfrmmain.actpackfiles.caption msgid "&Pack Files..." msgstr "&Comprimir ficheiros" #: tfrmmain.actpanelssplitterperpos.caption msgid "Set splitter position" msgstr "Definir posição do divisor" #: tfrmmain.actpastefromclipboard.caption msgid "&Paste" msgstr "Co&lar" #: tfrmmain.actpreviousfavoritetabs.caption msgid "Load the Previous Favorite Tabs in the list" msgstr "Carregar os favoritos anteriores na lista" #: tfrmmain.actprevtab.caption msgid "Switch to &Previous Tab" msgstr "Mudar para o se¶dor anterior" #: tfrmmain.actquickfilter.caption msgid "Quick filter" msgstr "Filtro rápido" #: tfrmmain.actquicksearch.caption msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION" msgid "Quick search" msgstr "Procura rápida" #: tfrmmain.actquickview.caption msgid "&Quick View Panel" msgstr "Painel &Vista rápida" #: tfrmmain.actrefresh.caption msgid "&Refresh" msgstr "&Actualizar" #: tfrmmain.actreloadfavoritetabs.caption msgid "Reload the last Favorite Tabs loaded" msgstr "Recarregar os últimos favoritos carregados" #: tfrmmain.actrename.caption msgctxt "tfrmmain.actrename.caption" msgid "Move" msgstr "Mover" #: tfrmmain.actrenamenoask.caption msgid "Move/Rename files without asking for confirmation" msgstr "Mover/Renomear ficheiros sem pedir confirmação" #: tfrmmain.actrenameonly.caption msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION" msgid "Rename" msgstr "Renomear" #: tfrmmain.actrenametab.caption msgid "&Rename Tab" msgstr "&Renomear separador" #: tfrmmain.actresavefavoritetabs.caption msgid "Resave on the last Favorite Tabs loaded" msgstr "Regravar os últimos favoritos carregados" #: tfrmmain.actrestoreselection.caption msgid "&Restore Selection" msgstr "&Restaurar selecção" #: tfrmmain.actreverseorder.caption msgid "Re&verse Order" msgstr "Ordem in&versa" #: tfrmmain.actrightbriefview.caption msgid "Brief view on right panel" msgstr "Vista breve no painel direito" #: tfrmmain.actrightcolumnsview.caption msgid "Columns view on right panel" msgstr "Vista de colunas no painel direito" #: tfrmmain.actrightequalleft.caption msgid "Right &= Left" msgstr "Direito &= Esquerdo" #: tfrmmain.actrightflatview.caption msgid "&Flat view on right panel" msgstr "Vista &plana no painel direito" #: tfrmmain.actrightopendrives.caption msgid "Open right drive list" msgstr "Abrir lista direita de unidades" #: tfrmmain.actrightreverseorder.caption msgid "Re&verse order on right panel" msgstr "Ordem in&versa no painel direito" #: tfrmmain.actrightsortbyattr.caption msgid "Sort right panel by &Attributes" msgstr "Ordenar painel direito por &atributos" #: tfrmmain.actrightsortbydate.caption msgid "Sort right panel by &Date" msgstr "Ordenar painel direito por &data" #: tfrmmain.actrightsortbyext.caption msgid "Sort right panel by &Extension" msgstr "Ordenar painel direito por &extensão" #: tfrmmain.actrightsortbyname.caption msgid "Sort right panel by &Name" msgstr "Ordenar painel direito por &nome" #: tfrmmain.actrightsortbysize.caption msgid "Sort right panel by &Size" msgstr "Ordenar painel direito por &tamanho" #: tfrmmain.actrightthumbview.caption msgid "Thumbnails view on right panel" msgstr "Vista de miniaturas no painel direito" #: tfrmmain.actrunterm.caption msgid "Run &Terminal" msgstr "Executar &terminal" #: tfrmmain.actsavefavoritetabs.caption msgid "Save current tabs to a New Favorite Tabs" msgstr "Gravar separadores actuais como novos favoritos" #: tfrmmain.actsaveselection.caption msgid "Sa&ve Selection" msgstr "Gra&var selecção" #: tfrmmain.actsaveselectiontofile.caption msgid "Save S&election to File..." msgstr "Gravar s&elecção para ficheiro..." #: tfrmmain.actsavetabs.caption msgid "&Save Tabs to File" msgstr "Gravar &separadores em ficheiro" #: tfrmmain.actsearch.caption msgid "&Search..." msgstr "&Procurar..." #: tfrmmain.actsetalltabsoptiondirsinnewtab.caption msgid "All tabs Locked with Dir Opened in New Tabs" msgstr "Todos os separadores bloqueados com pasta aberta em novos separadores" #: tfrmmain.actsetalltabsoptionnormal.caption msgid "Set all tabs to Normal" msgstr "Definir todos os separadores como Normal" #: tfrmmain.actsetalltabsoptionpathlocked.caption msgid "Set all tabs to Locked" msgstr "Definir todos os separadores como Bloqueado" #: tfrmmain.actsetalltabsoptionpathresets.caption msgid "All tabs Locked with Dir Changes Allowed" msgstr "Todos os separadores bloqueados com alterações a pasta permitidas" #: tfrmmain.actsetfileproperties.caption msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION" msgid "Change &Attributes..." msgstr "Alterar &atributos" #: tfrmmain.actsettaboptiondirsinnewtab.caption msgid "Locked with Directories Opened in New &Tabs" msgstr "Bloqueado com pastas aber&tas em novos separadores" #: tfrmmain.actsettaboptionnormal.caption msgid "&Normal" msgstr "&Normal" #: tfrmmain.actsettaboptionpathlocked.caption msgid "&Locked" msgstr "B&loqueado" #: tfrmmain.actsettaboptionpathresets.caption msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION" msgid "Locked with &Directory Changes Allowed" msgstr "Bloqueado com alterações de pastas permiti&das" #: tfrmmain.actshellexecute.caption msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION" msgid "Open" msgstr "Abrir" #: tfrmmain.actshellexecute.hint msgid "Open using system associations" msgstr "Abrir usando associações do sistema" #: tfrmmain.actshowbuttonmenu.caption msgid "Show button menu" msgstr "Mostrar menu de botões" #: tfrmmain.actshowcmdlinehistory.caption msgid "Show command line history" msgstr "Mostrar histórico da linha de comandos" #: tfrmmain.actshowmainmenu.caption msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION" msgid "Menu" msgstr "Menu" #: tfrmmain.actshowsysfiles.caption msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION" msgid "Show &Hidden/System Files" msgstr "Mostrar fic&heiros ocultos/de sistema" #: tfrmmain.actsortbyattr.caption msgid "Sort by &Attributes" msgstr "Ordenar por &atributos" #: tfrmmain.actsortbydate.caption msgid "Sort by &Date" msgstr "Ordenar por &data" #: tfrmmain.actsortbyext.caption msgid "Sort by &Extension" msgstr "Ordenar por &extensão" #: tfrmmain.actsortbyname.caption msgid "Sort by &Name" msgstr "Ordenar por &nome" #: tfrmmain.actsortbysize.caption msgid "Sort by &Size" msgstr "Ordenar por &tamanho" #: tfrmmain.actsrcopendrives.caption msgid "Open drive list" msgstr "Abrir lista de unidades" #: tfrmmain.actswitchignorelist.caption msgid "Enable/disable ignore list file to not show file names" msgstr "Activar/Desactivar exibição de nomes na lista de ignorados" #: tfrmmain.actsymlink.caption msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION" msgid "Create Symbolic &Link..." msgstr "Criar &ligação simbólica..." #: tfrmmain.actsyncdirs.caption msgid "Synchronize dirs..." msgstr "Sincronizar pastas..." #: tfrmmain.acttargetequalsource.caption msgid "Target &= Source" msgstr "Destino &= Origem" #: tfrmmain.acttestarchive.caption msgid "&Test Archive(s)" msgstr "Arquivo(s) de &teste" #: tfrmmain.actthumbnailsview.caption msgctxt "tfrmmain.actthumbnailsview.caption" msgid "Thumbnails" msgstr "Miniaturas" #: tfrmmain.actthumbnailsview.hint msgid "Thumbnails View" msgstr "Vista Miniaturas" #: tfrmmain.acttogglefullscreenconsole.caption msgid "Toggle fullscreen mode console" msgstr "Alternar modo de ecrã completo" #: tfrmmain.acttransferleft.caption msgid "Transfer dir under cursor to left window" msgstr "Transferir a pasta sob o cursor para a janela esquerda" #: tfrmmain.acttransferright.caption msgid "Transfer dir under cursor to right window" msgstr "Transferir a pasta sob o cursor para a janela direita" #: tfrmmain.acttreeview.caption msgid "&Tree View Panel" msgstr "Vis&ta em árvore" #: tfrmmain.actuniversalsingledirectsort.caption msgid "Sort according to parameters" msgstr "Ordenar de acordo com os parâmetros" #: tfrmmain.actunmarkcurrentextension.caption msgid "Unselect All with the Same Ex&tension" msgstr "De-seleccionar todos com a mesma ex&tensão" #: tfrmmain.actunmarkcurrentname.caption msgid "Unselect all files with same name" msgstr "De-seleccionar todos com o mesmo nome" #: tfrmmain.actunmarkcurrentnameext.caption msgid "Unselect all files with same name and extension" msgstr "De-seleccionar todos com o mesmo nome e extensão" #: tfrmmain.actunmarkcurrentpath.caption msgid "Unselect all in same path" msgstr "De-seleccionar todos no mesmo caminho" #: tfrmmain.actview.caption msgctxt "tfrmmain.actview.caption" msgid "View" msgstr "Ver" #: tfrmmain.actviewhistory.caption msgid "Show history of visited paths for active view" msgstr "Mostrar histórico de caminhos visitados na vista activa" #: tfrmmain.actviewhistorynext.caption msgid "Go to next entry in history" msgstr "Ir para a entrada seguinte no histórico" #: tfrmmain.actviewhistoryprev.caption msgid "Go to previous entry in history" msgstr "Ir para a entrada anterior no histórico" #: tfrmmain.actviewlogfile.caption msgid "View log file" msgstr "Ver diário" #: tfrmmain.actviewsearches.caption msgid "View current search instances" msgstr "Ver instâncias actuais de procura" #: tfrmmain.actvisithomepage.caption msgid "&Visit Double Commander Website" msgstr "&Visitar a página web do Double Commander" #: tfrmmain.actwipe.caption msgid "Wipe" msgstr "Limpar" #: tfrmmain.actworkwithdirectoryhotlist.caption msgid "Work with Directory Hotlist and parameters" msgstr "Trabalhar com a lista de pastas e parâmetros" #: tfrmmain.btnf10.caption msgctxt "tfrmmain.btnf10.caption" msgid "Exit" msgstr "Sair" #: tfrmmain.btnf7.caption msgctxt "tfrmmain.btnf7.caption" msgid "Directory" msgstr "Pasta" #: tfrmmain.btnf8.caption msgctxt "TFRMMAIN.BTNF8.CAPTION" msgid "Delete" msgstr "Eliminar" #: tfrmmain.btnf9.caption msgctxt "tfrmmain.btnf9.caption" msgid "Terminal" msgstr "Terminal" #: tfrmmain.btnleftdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "*" #: tfrmmain.btnleftdirectoryhotlist.hint msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT" msgid "Directory Hotlist" msgstr "Lista de pastas" #: tfrmmain.btnleftequalright.caption msgctxt "tfrmmain.btnleftequalright.caption" msgid "<" msgstr "<" #: tfrmmain.btnleftequalright.hint msgid "Show current directory of the right panel in the left panel" msgstr "Mostrar a pasta actual do painel direito no painel esquerdo" #: tfrmmain.btnlefthome.caption msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION" msgid "~" msgstr "~" #: tfrmmain.btnlefthome.hint msgctxt "TFRMMAIN.BTNLEFTHOME.HINT" msgid "Go to home directory" msgstr "Ir para a pasta home" #: tfrmmain.btnleftroot.caption msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION" msgid "/" msgstr "/" #: tfrmmain.btnleftroot.hint msgctxt "TFRMMAIN.BTNLEFTROOT.HINT" msgid "Go to root directory" msgstr "Ir para a pasta raiz" #: tfrmmain.btnleftup.caption msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION" msgid ".." msgstr ".." #: tfrmmain.btnleftup.hint msgctxt "TFRMMAIN.BTNLEFTUP.HINT" msgid "Go to parent directory" msgstr "Ir para a pasta-mãe" #: tfrmmain.btnrightdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "*" #: tfrmmain.btnrightdirectoryhotlist.hint msgctxt "tfrmmain.btnrightdirectoryhotlist.hint" msgid "Directory Hotlist" msgstr "Lista de pastas" #: tfrmmain.btnrightequalleft.caption msgctxt "tfrmmain.btnrightequalleft.caption" msgid ">" msgstr ">" #: tfrmmain.btnrightequalleft.hint msgid "Show current directory of the left panel in the right panel" msgstr "Mostrar a pasta actual do painel esquerdo no painel direito" #: tfrmmain.btnrighthome.caption msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION" msgid "~" msgstr "~" #: tfrmmain.btnrightroot.caption msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION" msgid "/" msgstr "/" #: tfrmmain.btnrightup.caption msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION" msgid ".." msgstr ".." #: tfrmmain.caption msgctxt "TFRMMAIN.CAPTION" msgid "Double Commander" msgstr "Double Commander" #: tfrmmain.lblcommandpath.caption msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION" msgid "Path" msgstr "Caminho" #: tfrmmain.mi2080.caption msgid "&20/80" msgstr "&20/80" #: tfrmmain.mi3070.caption msgid "&30/70" msgstr "&30/70" #: tfrmmain.mi4060.caption msgid "&40/60" msgstr "&40/60" #: tfrmmain.mi5050.caption msgid "&50/50" msgstr "&50/50" #: tfrmmain.mi6040.caption msgid "&60/40" msgstr "&60/40" #: tfrmmain.mi7030.caption msgid "&70/30" msgstr "&70/30" #: tfrmmain.mi8020.caption msgid "&80/20" msgstr "&80/20" #: tfrmmain.micancel.caption msgctxt "TFRMMAIN.MICANCEL.CAPTION" msgid "Cancel" msgstr "Cancelar" #: tfrmmain.micopy.caption msgid "Copy..." msgstr "Copiar..." #: tfrmmain.mihardlink.caption msgctxt "TFRMMAIN.MIHARDLINK.CAPTION" msgid "Create link..." msgstr "Criar ligação..." #: tfrmmain.milogclear.caption msgid "Clear" msgstr "Limpar" #: tfrmmain.milogcopy.caption msgctxt "TFRMMAIN.MILOGCOPY.CAPTION" msgid "Copy" msgstr "Copiar" #: tfrmmain.miloghide.caption msgid "Hide" msgstr "Ocultar" #: tfrmmain.milogselectall.caption msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION" msgid "Select All" msgstr "Seleccionar tudo" #: tfrmmain.mimove.caption msgid "Move..." msgstr "Mover..." #: tfrmmain.misymlink.caption msgctxt "TFRMMAIN.MISYMLINK.CAPTION" msgid "Create symlink..." msgstr "Criar ligação simbólica..." #: tfrmmain.mitaboptions.caption msgid "Tab options" msgstr "Opções do separador" #: tfrmmain.mitrayiconexit.caption msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION" msgid "E&xit" msgstr "&Sair" #: tfrmmain.mitrayiconrestore.caption msgid "Restore" msgstr "Restaurar" #: tfrmmain.mnualloperpause.caption msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION" msgid "||" msgstr "||" #: tfrmmain.mnualloperstart.caption msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION" msgid "Start" msgstr "Iniciar" #: tfrmmain.mnualloperstop.caption msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION" msgid "Cancel" msgstr "Cancelar" #: tfrmmain.mnucmd.caption msgid "&Commands" msgstr "&Comandos" #: tfrmmain.mnuconfig.caption msgid "C&onfiguration" msgstr "C&onfiguração" #: tfrmmain.mnufavoritetabs.caption msgid "Favorites" msgstr "Favoritos" #: tfrmmain.mnufiles.caption msgid "&Files" msgstr "&Ficheiros" #: tfrmmain.mnuhelp.caption msgctxt "TFRMMAIN.MNUHELP.CAPTION" msgid "&Help" msgstr "A&juda" #: tfrmmain.mnumark.caption msgid "&Mark" msgstr "&Marcar" #: tfrmmain.mnunetwork.caption msgctxt "TFRMMAIN.MNUNETWORK.CAPTION" msgid "Network" msgstr "Rede" #: tfrmmain.mnushow.caption msgid "&Show" msgstr "Mo&strar" #: tfrmmain.mnutaboptions.caption msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION" msgid "Tab &Options" msgstr "&Opções do separador" #: tfrmmain.mnutabs.caption msgid "&Tabs" msgstr "&Separadores" #: tfrmmain.tbchangedir.caption msgid "CD" msgstr "CD" #: tfrmmain.tbcopy.caption msgctxt "TFRMMAIN.TBCOPY.CAPTION" msgid "Copy" msgstr "Copiar" #: tfrmmain.tbcut.caption msgctxt "TFRMMAIN.TBCUT.CAPTION" msgid "Cut" msgstr "Cortar" #: tfrmmain.tbdelete.caption msgctxt "TFRMMAIN.TBDELETE.CAPTION" msgid "Delete" msgstr "Eliminar" #: tfrmmain.tbedit.caption msgctxt "TFRMMAIN.TBEDIT.CAPTION" msgid "Edit" msgstr "Editar" #: tfrmmain.tbpaste.caption msgctxt "TFRMMAIN.TBPASTE.CAPTION" msgid "Paste" msgstr "Colar" #: tfrmmaincommandsdlg.btncancel.caption msgctxt "tfrmmaincommandsdlg.btncancel.caption" msgid "&Cancel" msgstr "&Cancelar" #: tfrmmaincommandsdlg.btnok.caption msgctxt "tfrmmaincommandsdlg.btnok.caption" msgid "&OK" msgstr "&Aceitar" #: tfrmmaincommandsdlg.caption msgid "Select your internal command" msgstr "Seleccione o seu comando interno" #: tfrmmaincommandsdlg.cbcategorysortornot.text msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text" msgid "Legacy sorted" msgstr "Ordem de idade" #: tfrmmaincommandsdlg.cbcommandssortornot.text msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text" msgid "Legacy sorted" msgstr "Ordem de idade" #: tfrmmaincommandsdlg.cbselectallcategorydefault.caption msgid "Select all categories by default" msgstr "Escolher todas as categorias por predefinição" #: tfrmmaincommandsdlg.gbselection.caption msgid "Selection:" msgstr "Selecção:" #: tfrmmaincommandsdlg.lblcategory.caption msgid "&Categories:" msgstr "&Categorias:" #: tfrmmaincommandsdlg.lblcommandname.caption msgid "Command &name:" msgstr "&Nome do comando:" #: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption msgid "&Filter:" msgstr "&Filtro:" #: tfrmmaincommandsdlg.lblhint.caption msgid "Hint:" msgstr "Dica:" #: tfrmmaincommandsdlg.lblhotkey.caption msgid "Hotkey:" msgstr "Atalho:" #: tfrmmaincommandsdlg.lblselectedcommand.caption msgid "cm_name" msgstr "cm_name" #: tfrmmaincommandsdlg.lblselectedcommandcategory.caption msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption" msgid "Category" msgstr "Categoria" #: tfrmmaincommandsdlg.lblselectedcommandhelp.caption msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption" msgid "Help" msgstr "Ajuda" #: tfrmmaincommandsdlg.lblselectedcommandhint.caption msgid "Hint" msgstr "Dica" #: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption" msgid "Hotkey" msgstr "Atalho" #: tfrmmaskinputdlg.btnaddattribute.caption msgctxt "tfrmmaskinputdlg.btnaddattribute.caption" msgid "&Add" msgstr "&Adicionar" #: tfrmmaskinputdlg.btnattrshelp.caption msgctxt "tfrmmaskinputdlg.btnattrshelp.caption" msgid "&Help" msgstr "A&juda" #: tfrmmaskinputdlg.btncancel.caption msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmmaskinputdlg.btndefinetemplate.caption msgid "&Define..." msgstr "&Definir..." #: tfrmmaskinputdlg.btnok.caption msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmmaskinputdlg.chkcasesensitive.caption msgid "Case sensitive" msgstr "Sensível a maiúsculas" #: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption msgid "Ignore accents and ligatures" msgstr "Ignorar acentos e ligações" #: tfrmmaskinputdlg.lblattributes.caption msgid "Attri&butes:" msgstr "Atri&butos:" #: tfrmmaskinputdlg.lblprompt.caption msgid "Input Mask:" msgstr "Máscara de entrada:" #: tfrmmaskinputdlg.lblsearchtemplate.caption msgid "O&r select predefined selection type:" msgstr "Ou selecciona&r tipo predefinido:" #: tfrmmkdir.btncancel.caption msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmmkdir.btnok.caption msgctxt "TFRMMKDIR.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmmkdir.caption msgid "Create new directory" msgstr "Criar nova pasta" #: tfrmmkdir.lblmakedir.caption msgid "&Input new directory name:" msgstr "&Insira o nome da nova pasta:" #: tfrmmodview.btnpath1.caption msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath2.caption msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath3.caption msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath4.caption msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath5.caption msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.caption msgctxt "TFRMMODVIEW.CAPTION" msgid "New Size" msgstr "Novo tamanho" #: tfrmmodview.lblheight.caption msgid "Height :" msgstr "Altura:" #: tfrmmodview.lblpath1.caption msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION" msgid "1" msgstr "1" #: tfrmmodview.lblpath2.caption msgctxt "tfrmmodview.lblpath2.caption" msgid "2" msgstr "2" #: tfrmmodview.lblpath3.caption msgctxt "tfrmmodview.lblpath3.caption" msgid "3" msgstr "3" #: tfrmmodview.lblpath4.caption msgid "4" msgstr "4" #: tfrmmodview.lblpath5.caption msgid "5" msgstr "5" #: tfrmmodview.lblquality.caption msgid "Quality of compress to Jpg" msgstr "Qualidade de compressão jpg" #: tfrmmodview.lblwidth.caption msgid "Width :" msgstr "Largura:" #: tfrmmodview.rbbmp.caption msgid "BMP" msgstr "BMP" #: tfrmmodview.rbico.caption msgid "ICO" msgstr "ICO" #: tfrmmodview.rbjpg.caption msgid "JPG" msgstr "JPG" #: tfrmmodview.rbpng.caption msgid "PNG" msgstr "PNG" #: tfrmmodview.rbpnm.caption msgid "PNM" msgstr "PNM" #: tfrmmodview.teheight.text msgctxt "tfrmmodview.teheight.text" msgid "Height" msgstr "Altura" #: tfrmmodview.tequality.text msgid "80" msgstr "80" #: tfrmmodview.tewidth.text msgctxt "TFRMMODVIEW.TEWIDTH.TEXT" msgid "Width" msgstr "Largura" #: tfrmmsg.lblmsg.caption msgid "456456465465465" msgstr "456456465465465" #: tfrmmultirename.btnclose.caption msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Fe&char" #: tfrmmultirename.btndeletepreset.caption msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION" msgid "&Delete" msgstr "&Eliminar" #: tfrmmultirename.btnedit.caption msgctxt "tfrmmultirename.btnedit.caption" msgid "&Edit" msgstr "&Editar" #: tfrmmultirename.btnextmenu.caption msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION" msgid "..." msgstr "..." #: tfrmmultirename.btnloadpreset.caption msgid "&Load" msgstr "Ca&rregar" #: tfrmmultirename.btnnamemenu.caption msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION" msgid "..." msgstr "..." #: tfrmmultirename.btnrename.caption msgctxt "tfrmmultirename.btnrename.caption" msgid "&Rename" msgstr "&Renomear" #: tfrmmultirename.btnrestore.caption msgid "Reset &all" msgstr "Re&por tudo" #: tfrmmultirename.btnsavepreset.caption msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION" msgid "&Save" msgstr "&Gravar" #: tfrmmultirename.caption msgctxt "TFRMMULTIRENAME.CAPTION" msgid "MultiRename" msgstr "Multi-renomear" #: tfrmmultirename.cblog.caption msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION" msgid "Ena&ble" msgstr "Ac&tivar" #: tfrmmultirename.cbregexp.caption msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION" msgid "Regular e&xpressions" msgstr "E&xpressões regulares" #: tfrmmultirename.cbusesubs.caption msgid "&Use substitution" msgstr "&Usar substituição" #: tfrmmultirename.cmbxwidth.text msgid "01" msgstr "01" #: tfrmmultirename.edinterval.text msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT" msgid "1" msgstr "1" #: tfrmmultirename.edpoc.text msgctxt "TFRMMULTIRENAME.EDPOC.TEXT" msgid "1" msgstr "1" #: tfrmmultirename.extension.caption msgid "[E] Extension" msgstr "[E] Extensão" #: tfrmmultirename.gbcounter.caption msgid "Counter" msgstr "Contador" #: tfrmmultirename.gbfindreplace.caption msgid "Find && Replace" msgstr "Localizar && substituir" #: tfrmmultirename.gblog.caption msgid "Log Result" msgstr "Resultado do diário" #: tfrmmultirename.gbmaska.caption msgid "Mask" msgstr "Máscara" #: tfrmmultirename.gbpresets.caption msgid "Presets" msgstr "Predefinições" #: tfrmmultirename.lbext.caption msgid "&Extension" msgstr "&Extensão" #: tfrmmultirename.lbfind.caption msgid "&Find..." msgstr "&Localizar" #: tfrmmultirename.lbinterval.caption msgid "&Interval" msgstr "&Intervalo" #: tfrmmultirename.lbname.caption msgid "File &Name" msgstr "&Nome de ficheiro" #: tfrmmultirename.lbreplace.caption msgid "Re&place..." msgstr "Su&bstituir..." #: tfrmmultirename.lbstnb.caption msgid "S&tart Number" msgstr "&Número inicial" #: tfrmmultirename.lbwidth.caption msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION" msgid "&Width" msgstr "&Largura" #: tfrmmultirename.micounter.caption msgid "[C] Counter" msgstr "[C] Contador" #: tfrmmultirename.miday.caption msgid "[D] Day" msgstr "[D] Dia" #: tfrmmultirename.miday1.caption msgid "[DD] Day (2 digits)" msgstr "[DD] Dia (2 dígitos)" #: tfrmmultirename.miday2.caption msgid "[DDD] Day of the week (short, e.g., \"mon\")" msgstr "[DDD] Dia da semana (curto, ex. \"Seg\")" #: tfrmmultirename.miday3.caption msgid "[DDDD] Day of the week (long, e.g., \"monday\")" msgstr "[DDDD] Dia da semana (longo, ex. \"Segunda\")" #: tfrmmultirename.miextensionx.caption msgid "[Ex] Character at position x" msgstr "[Ex] Carácter na posição x" #: tfrmmultirename.miextensionxx.caption msgid "[Ex:y] Characters from position x to y" msgstr "[Ex:y] Caracteres desde a posição x até y" #: tfrmmultirename.mihour.caption msgid "[h] Hour" msgstr "[h] Hora" #: tfrmmultirename.mihour1.caption msgid "[hh] Hour (2 digits)" msgstr "[hh] Hora (2 dígitos)" #: tfrmmultirename.miminute.caption msgid "[n] Minute" msgstr "[n] Minuto" #: tfrmmultirename.miminute1.caption msgid "[nn] Minute (2 digits)" msgstr "[nn] Minuto (2 dígitos)" #: tfrmmultirename.mimonth.caption msgid "[M] Month" msgstr "[M] Mês" #: tfrmmultirename.mimonth1.caption msgid "[MM] Month (2 digits)" msgstr "[MM] Mês (2 dígitos)" #: tfrmmultirename.mimonth2.caption msgid "[MMM] Month name (short, e.g., \"jan\")" msgstr "[MMM] Nome do mês (curto, ex. \"Jan\")" #: tfrmmultirename.mimonth3.caption msgid "[MMMM] Month name (long, e.g., \"january\")" msgstr "[MMMM] Nome do mês (longo, ex. \"Janeiro\")" #: tfrmmultirename.miname.caption msgid "[N] Name" msgstr "[N] Nome" #: tfrmmultirename.minamex.caption msgid "[Nx] Character at position x" msgstr "[Nx] Carácter na posição x" #: tfrmmultirename.minamexx.caption msgid "[Nx:y] Characters from position x to y" msgstr "[Nx:y] Caracteres desde a posição x até y" #: tfrmmultirename.minext.caption msgid "Time..." msgstr "Hora..." #: tfrmmultirename.minextextension.caption msgid "Extension..." msgstr "Extensão..." #: tfrmmultirename.minextname.caption msgid "Name..." msgstr "Nome..." #: tfrmmultirename.miplugin.caption msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION" msgid "Plugin" msgstr "Extensão" #: tfrmmultirename.misecond.caption msgid "[s] Second" msgstr "[s] Segundo" #: tfrmmultirename.misecond1.caption msgid "[ss] Second (2 digits)" msgstr "[ss] Segundo (2 dígitos)" #: tfrmmultirename.miyear.caption msgid "[Y] Year (2 digits)" msgstr "[Y] Ano (2 dígitos)" #: tfrmmultirename.miyear1.caption msgid "[YYYY] Year (4 digits)" msgstr "[YYYY] Ano (4 dígitos)" #: tfrmmultirename.mnueditnames.caption msgid "Edit names..." msgstr "Editar nomes..." #: tfrmmultirename.mnuloadfromfile.caption msgid "Load names from file..." msgstr "Carregar nomes de ficheiro..." #: tfrmmultirename.n1.caption msgctxt "TFRMMULTIRENAME.N1.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n2.caption msgctxt "TFRMMULTIRENAME.N2.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n3.caption msgctxt "TFRMMULTIRENAME.N3.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n4.caption msgctxt "TFRMMULTIRENAME.N4.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n5.caption msgctxt "TFRMMULTIRENAME.N5.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.stringgrid.columns[0].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION" msgid "Old File Name" msgstr "Nome antigo de ficheiro" #: tfrmmultirename.stringgrid.columns[1].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION" msgid "New File Name" msgstr "Novo nome de ficheiro" #: tfrmmultirename.stringgrid.columns[2].title.caption msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION" msgid "File Path" msgstr "Caminho de ficheiro" #: tfrmmultirenamewait.caption msgctxt "tfrmmultirenamewait.caption" msgid "Double Commander" msgstr "Double Commander" #: tfrmmultirenamewait.lblmessage.caption msgid "Click OK when you have closed the editor to load the changed names!" msgstr "Clique Aceitar quando fechar o editor para carregar os nomes alterados!" #: tfrmopenwith.caption msgid "Choose an application" msgstr "Escolha uma aplicação" #: tfrmopenwith.chkcustomcommand.caption msgid "Custom command" msgstr "Comando personalizado" #: tfrmopenwith.chksaveassociation.caption msgid "Save association" msgstr "Gravar associação" #: tfrmopenwith.chkuseasdefault.caption msgid "Set selected application as default action" msgstr "Definir aplicação seleccionada como acção predefinida" #: tfrmopenwith.lblmimetype.caption msgid "File type to be opened: %s" msgstr "Tipo de ficheiro a abrir: %s" #: tfrmopenwith.milistoffiles.caption msgid "Multiple file names" msgstr "Múltiplos nomes de ficheiro" #: tfrmopenwith.milistoffiles.hint msgid "%F" msgstr "%F" #: tfrmopenwith.milistofurls.caption msgid "Multiple URIs" msgstr "Múltiplos URIs" #: tfrmopenwith.milistofurls.hint msgid "%U" msgstr "%U" #: tfrmopenwith.misinglefilename.caption msgid "Single file name" msgstr "Nome de ficheiro único" #: tfrmopenwith.misinglefilename.hint msgid "%f" msgstr "%f" #: tfrmopenwith.misingleurl.caption msgid "Single URI" msgstr "URI único" #: tfrmopenwith.misingleurl.hint msgid "%u" msgstr "%u" #: tfrmoptions.btnapply.caption msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION" msgid "&Apply" msgstr "&Aplicar" #: tfrmoptions.btncancel.caption msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmoptions.btnok.caption msgctxt "TFRMOPTIONS.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmoptions.caption msgctxt "TFRMOPTIONS.CAPTION" msgid "Options" msgstr "Opções" #: tfrmoptions.lblemptyeditor.caption msgid "Please select one of the subpages, this page does not contain any settings." msgstr "Por favor seleccione uma das sub-páginas, esta página não contém definições." #: tfrmoptionsarchivers.btnarchiveradd.caption msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption" msgid "A&dd" msgstr "A&dicionar" #: tfrmoptionsarchivers.btnarchiveraddhelper.hint msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverapply.caption msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption" msgid "A&pply" msgstr "A&plicar" #: tfrmoptionsarchivers.btnarchivercopy.caption msgid "Cop&y" msgstr "Copiar" #: tfrmoptionsarchivers.btnarchiverdelete.caption msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption" msgid "Delete" msgstr "&Eliminar" #: tfrmoptionsarchivers.btnarchiverdeletehelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverextracthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverlisthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverother.caption msgid "Oth&er..." msgstr "Outro..." #: tfrmoptionsarchivers.btnarchiverrelativer.hint msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint" msgid "Some functions to select appropriate path" msgstr "Funções para seleccionar o caminho correcto" #: tfrmoptionsarchivers.btnarchiverrename.caption msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption" msgid "&Rename" msgstr "&Renomear" #: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchivertesthelper.hint msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.bvlarchiverids.caption msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption" msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:" msgstr "" #: tfrmoptionsarchivers.bvlarchiveroptions.caption msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption" msgid "Options:" msgstr "Opções:" #: tfrmoptionsarchivers.bvlarchiverparsingmode.caption msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption" msgid "Format parsing mode:" msgstr "Formatar modo de análise:" #: tfrmoptionsarchivers.chkarchiverenabled.caption msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption" msgid "E&nabled" msgstr "Ac&tivo" #: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption msgid "De&bug mode" msgstr "Modo Dep&uração" #: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption" msgid "S&how console output" msgstr "Mostrar saída da co&nsola" #: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption msgid "Uni&x file attributes" msgstr "" #: tfrmoptionsarchivers.ckbarchiverunixpath.caption msgid "&Unix path delimiter \"/\"" msgstr "" #: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption msgid "Windows &file attributes" msgstr "" #: tfrmoptionsarchivers.ckbarchiverwindowspath.caption msgid "Windows path deli&miter \"\\\"" msgstr "" #: tfrmoptionsarchivers.lblarchiveradd.caption msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption" msgid "Add&ing:" msgstr "A ad&icionar:" #: tfrmoptionsarchivers.lblarchiverarchiver.caption msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption" msgid "Arc&hiver:" msgstr "Ar&quivador:" #: tfrmoptionsarchivers.lblarchiverdelete.caption msgid "De&lete:" msgstr "Eliminar:" #: tfrmoptionsarchivers.lblarchiverdescription.caption msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption" msgid "De&scription:" msgstr "De&scrição:" #: tfrmoptionsarchivers.lblarchiverextension.caption msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption" msgid "E&xtension:" msgstr "E&xtensão:" #: tfrmoptionsarchivers.lblarchiverextract.caption msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption" msgid "Ex&tract:" msgstr "Ex&trair:" #: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption msgid "Extract &without path:" msgstr "Extrair sem caminho:" #: tfrmoptionsarchivers.lblarchiveridposition.caption msgid "ID Po&sition:" msgstr "Posição da ID:" #: tfrmoptionsarchivers.lblarchiverids.caption msgid "&ID:" msgstr "ID:" #: tfrmoptionsarchivers.lblarchiveridseekrange.caption msgid "ID See&k Range:" msgstr "Intervalo de procura de ID:" #: tfrmoptionsarchivers.lblarchiverlist.caption msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption" msgid "&List:" msgstr "&Lista:" #: tfrmoptionsarchivers.lblarchiverlistbox.caption msgid "Archi&vers:" msgstr "Arquivadores:" #: tfrmoptionsarchivers.lblarchiverlistend.caption msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption" msgid "Listing &finish (optional):" msgstr "&Final da lista (opcional):" #: tfrmoptionsarchivers.lblarchiverlistformat.caption msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption" msgid "Listing for&mat:" msgstr "For&mato da lista:" #: tfrmoptionsarchivers.lblarchiverliststart.caption msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption" msgid "Listin&g start (optional):" msgstr "Iní&cio da lista (opcional):" #: tfrmoptionsarchivers.lblarchiverpasswordquery.caption msgid "Password &query string:" msgstr "Cadeia de consulta da palavra passe:" #: tfrmoptionsarchivers.lblarchiverselfextract.caption msgid "Create self extractin&g archive:" msgstr "Criar arquivo de extracção automática:" #: tfrmoptionsarchivers.lblarchivertest.caption msgid "Tes&t:" msgstr "Teste:" #: tfrmoptionsarchivers.miarchiverautoconfigure.caption msgid "Auto Configure" msgstr "A&uto-configurar" #: tfrmoptionsarchivers.miarchiverdisableall.caption msgid "Disable all" msgstr "" #: tfrmoptionsarchivers.miarchiverdiscardmodification.caption msgid "Discard modifications" msgstr "" #: tfrmoptionsarchivers.miarchiverenableall.caption msgid "Enable all" msgstr "" #: tfrmoptionsarchivers.miarchiverexport.caption msgctxt "tfrmoptionsarchivers.miarchiverexport.caption" msgid "Export..." msgstr "Exportar..." #: tfrmoptionsarchivers.miarchiverimport.caption msgctxt "tfrmoptionsarchivers.miarchiverimport.caption" msgid "Import..." msgstr "Importar..." #: tfrmoptionsarchivers.miarchiversortarchivers.caption msgid "Sort archivers" msgstr "" #: tfrmoptionsarchivers.tbarchiveradditional.caption msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION" msgid "Additional" msgstr "Adicional" #: tfrmoptionsarchivers.tbarchivergeneral.caption msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION" msgid "General" msgstr "Geral" #: tfrmoptionsautorefresh.cbwatchattributeschange.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION" msgid "When &size, date or attributes change" msgstr "Quando tamanho, data ou atributo&s mudem" #: tfrmoptionsautorefresh.cbwatchexcludedirs.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION" msgid "For the following &paths and their subdirectories:" msgstr "Para os seguintes caminhos e suas sub-&pastas:" #: tfrmoptionsautorefresh.cbwatchfilenamechange.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION" msgid "When &files are created, deleted or renamed" msgstr "Quando &ficheiros sejam criados, eliminados ou renomeados" #: tfrmoptionsautorefresh.cbwatchonlyforeground.caption msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION" msgid "When application is in the &background" msgstr "Quando a aplicação está em 2º &plano" #: tfrmoptionsautorefresh.gbautorefreshdisable.caption msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION" msgid "Disable auto-refresh" msgstr "Desactivar actualização automática" #: tfrmoptionsautorefresh.gbautorefreshenable.caption msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION" msgid "Refresh file list" msgstr "Actualizar lista de ficheiros" #: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION" msgid "Al&ways show tray icon" msgstr "Mos&trar sempre ícone de tabuleiro" #: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption msgid "Automatically &hide unmounted devices" msgstr "&Ocultar automaticamente dispositivos não montados" #: tfrmoptionsbehavior.cbminimizetotray.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION" msgid "Mo&ve icon to system tray when minimized" msgstr "Mo&ver ícone para o tabuleiro de sistema ao minimizar" #: tfrmoptionsbehavior.cbonlyonce.caption msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION" msgid "A&llow only one copy of DC at a time" msgstr "&Permitir só uma instância do DC de cada vez" #: tfrmoptionsbehavior.edtdrivesblacklist.hint msgid "Here you can enter one or more drives or mount points, separated by \";\"." msgstr "Aqui pode inserir um ou mais dispositivos ou pontos de montagem, separados por \";\"." #: tfrmoptionsbehavior.lbldrivesblacklist.caption msgid "Drives &blacklist" msgstr "Lista &negra de dispositivos" #: tfrmoptionsbriefview.gbcolumns.caption msgid "Columns size" msgstr "Tamanho das colunas" #: tfrmoptionsbriefview.gbshowfileext.caption msgid "Show file extensions" msgstr "Mostrar extensões de ficheiro" #: tfrmoptionsbriefview.rbaligned.caption msgid "ali&gned (with Tab)" msgstr "Alin&hada (com Tab)" #: tfrmoptionsbriefview.rbdirectly.caption msgid "di&rectly after filename" msgstr "Após o nome de fichei&ro" #: tfrmoptionsbriefview.rbuseautosize.caption msgid "Auto" msgstr "Automático" #: tfrmoptionsbriefview.rbusefixedcount.caption msgid "Fixed columns count" msgstr "Total de colunas fixas" #: tfrmoptionsbriefview.rbusefixedwidth.caption msgid "Fixed columns width" msgstr "Largura fixa" #: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption msgid "Cut &text to column width" msgstr "Cortar &texto na largura da coluna" #: tfrmoptionscolumnsview.cbextendcellwidth.caption msgid "&Extend cell width if text is not fitting into column" msgstr "&Estender largura da célula se o texto não couber na coluna" #: tfrmoptionscolumnsview.cbgridhorzline.caption msgid "&Horizontal lines" msgstr "Linhas &horizontais" #: tfrmoptionscolumnsview.cbgridvertline.caption msgid "&Vertical lines" msgstr "Linhas &verticais" #: tfrmoptionscolumnsview.chkautofillcolumns.caption msgid "A&uto fill columns" msgstr "Preencher automaticamente colunas" #: tfrmoptionscolumnsview.gbshowgrid.caption msgid "Show grid" msgstr "Mostrar grelha" #: tfrmoptionscolumnsview.grpautosizecolumns.caption msgid "Auto-size columns" msgstr "Tamanho de coluna automático" #: tfrmoptionscolumnsview.lblautosizecolumn.caption msgid "Auto si&ze column:" msgstr "Tamanho de c&oluna automático:" #: tfrmoptionsconfiguration.btnconfigapply.caption msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION" msgid "A&pply" msgstr "A&plicar" #: tfrmoptionsconfiguration.btnconfigedit.caption msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION" msgid "&Edit" msgstr "&Editar" #: tfrmoptionsconfiguration.cbcmdlinehistory.caption msgid "Co&mmand line history" msgstr "Histórico da linha de co&mandos" #: tfrmoptionsconfiguration.cbdirhistory.caption msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION" msgid "&Directory history" msgstr "Histórico de &pastas" #: tfrmoptionsconfiguration.cbfilemaskhistory.caption msgid "&File mask history" msgstr "Histórico de máscaras de &ficheiros" #: tfrmoptionsconfiguration.chksaveconfiguration.caption msgid "Sa&ve configuration" msgstr "Gra&var configuração" #: tfrmoptionsconfiguration.chksearchreplacehistory.caption msgid "Searc&h/Replace history" msgstr "&Histórico de Localizar/Substituir" #: tfrmoptionsconfiguration.gbdirectories.caption msgctxt "tfrmoptionsconfiguration.gbdirectories.caption" msgid "Directories" msgstr "Pastas" #: tfrmoptionsconfiguration.gblocconfigfiles.caption msgid "Location of configuration files" msgstr "Localização dos ficheiros de configuração" #: tfrmoptionsconfiguration.gbsaveonexit.caption msgid "Save on exit" msgstr "Gravar ao sair" #: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption msgid "Sort order of configuration order in left tree" msgstr "Ordem da configuração na árvore esquerda" #: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption msgid "Set on command line" msgstr "Definir na linha de comandos" #: tfrmoptionsconfiguration.lblhighlighters.caption msgid "Highlighters:" msgstr "" #: tfrmoptionsconfiguration.lbliconthemes.caption msgid "Icon themes:" msgstr "Temas de ícones:" #: tfrmoptionsconfiguration.lblthumbcache.caption msgid "Thumbnails cache:" msgstr "Memória de miniaturas:" #: tfrmoptionsconfiguration.rbprogramdir.caption msgid "P&rogram directory (portable version)" msgstr "Pasta do p&rograma (versão portátil)" #: tfrmoptionsconfiguration.rbuserhomedir.caption msgid "&User home directory" msgstr "Pasta home do &utilizador" #: tfrmoptionscustomcolumns.btnallallowovercolor.caption msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallallowovercolor.hint msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallbackcolor.caption msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallbackcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallbackcolor2.caption msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallbackcolor2.hint msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallcursorcolor.caption msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallcursorcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallcursortext.caption msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallcursortext.hint msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallfont.caption msgctxt "tfrmoptionscustomcolumns.btnallfont.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallfont.hint msgctxt "tfrmoptionscustomcolumns.btnallfont.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallforecolor.caption msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallforecolor.hint msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnallmarkcolor.caption msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnallmarkcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption" msgid "All" msgstr "Tudo" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint" msgid "Apply modification to all columns" msgstr "Aplicar alteração a todas as colunas" #: tfrmoptionscustomcolumns.btnbackcolor.caption msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnbackcolor2.caption msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursorbordercolor.caption msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursorcolor.caption msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursortext.caption msgctxt "tfrmoptionscustomcolumns.btncursortext.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption" msgid "&Delete" msgstr "&Eliminar" #: tfrmoptionscustomcolumns.btnfont.caption msgctxt "tfrmoptionscustomcolumns.btnfont.caption" msgid "..." msgstr "..." #: tfrmoptionscustomcolumns.btnforecolor.caption msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btngotosetdefault.caption msgid "Go to set default" msgstr "Predefinições" #: tfrmoptionscustomcolumns.btngotosetdefault.hint msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btninactivecursorcolor.caption msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btninactivemarkcolor.caption msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnmarkcolor.caption msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnnewconfig.caption msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption" msgid "New" msgstr "Novo" #: tfrmoptionscustomcolumns.btnnext.caption msgid "Next" msgstr "Seguinte" #: tfrmoptionscustomcolumns.btnprev.caption msgid "Previous" msgstr "Anterior" #: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption" msgid "Rename" msgstr "Renomear" #: tfrmoptionscustomcolumns.btnresetallowovercolor.caption msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetallowovercolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetbackcolor.caption msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetbackcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetbackcolor2.caption msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetbackcolor2.hint msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetcursorborder.caption msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursorborder.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetcursorcolor.caption msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursorcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetcursortext.caption msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursortext.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetfont.caption msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetfont.hint msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetforecolor.caption msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetforecolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetframecursor.caption msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetframecursor.hint msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetmarkcolor.caption msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetmarkcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint" msgid "Reset to default" msgstr "Repor predefinição" #: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption" msgid "Save as" msgstr "Gravar como" #: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption" msgid "Save" msgstr "Gravar" #: tfrmoptionscustomcolumns.cballowovercolor.caption msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption" msgid "Allow Overcolor" msgstr "Permitir cor sobreposta" #: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption msgid "When clicking to change something, change for all columns" msgstr "Ao clicar para alterar algo, alterar em todas as colunas" #: tfrmoptionscustomcolumns.cbconfigcolumns.text msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text" msgid "General" msgstr "Geral" #: tfrmoptionscustomcolumns.cbcursorborder.caption msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption" msgid "Cursor border" msgstr "Contorno do cursor" #: tfrmoptionscustomcolumns.cbuseframecursor.caption msgid "Use Frame Cursor" msgstr "Usar cursor vazio" #: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption msgid "Use Inactive Selection Color" msgstr "Usar cor de selecção inactiva" #: tfrmoptionscustomcolumns.cbuseinvertedselection.caption msgid "Use Inverted Selection" msgstr "Usar selecção invertida" #: tfrmoptionscustomcolumns.chkusecustomview.caption msgid "Use custom font and color for this view" msgstr "Usar letra e cor personalizadas nesta vista" #: tfrmoptionscustomcolumns.lblbackcolor.caption msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption" msgid "BackGround:" msgstr "Fundo:" #: tfrmoptionscustomcolumns.lblbackcolor2.caption msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption" msgid "Background 2:" msgstr "Fundo 2:" #: tfrmoptionscustomcolumns.lblconfigcolumns.caption msgid "Con&figure columns view:" msgstr "Con&figurar vista de colunas:" #: tfrmoptionscustomcolumns.lblcurrentcolumn.caption msgid "[Current Column Name]" msgstr "[Nome actual de coluna]" #: tfrmoptionscustomcolumns.lblcursorcolor.caption msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption" msgid "Cursor Color:" msgstr "Cor do cursor:" #: tfrmoptionscustomcolumns.lblcursortext.caption msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption" msgid "Cursor Text:" msgstr "Texto do cursor:" #: tfrmoptionscustomcolumns.lblfontname.caption msgctxt "tfrmoptionscustomcolumns.lblfontname.caption" msgid "Font:" msgstr "Letra:" #: tfrmoptionscustomcolumns.lblfontsize.caption msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption" msgid "Size:" msgstr "Tamanho:" #: tfrmoptionscustomcolumns.lblforecolor.caption msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption" msgid "Text Color:" msgstr "Cor do texto:" #: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption" msgid "Inactive Cursor Color:" msgstr "Cor do cursor inactivo:" #: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption" msgid "Inactive Mark Color:" msgstr "Cor de marca inactiva:" #: tfrmoptionscustomcolumns.lblmarkcolor.caption msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption" msgid "Mark Color:" msgstr "Cor de marca:" #: tfrmoptionscustomcolumns.lblpreviewtop.caption msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "Abaixo está uma antevisão. Mova o cursor e seleccione ficheiros para ver imediatamente o aspecto das várias definições." #: tfrmoptionscustomcolumns.lblworkingcolumn.caption msgid "Settings for column:" msgstr "Definições da coluna:" #: tfrmoptionscustomcolumns.miaddcolumn.caption msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption" msgid "Add column" msgstr "Adicionar coluna" #: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption msgid "Position of frame panel after the comparison:" msgstr "Posição do painel após a comparação:" #: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption msgid "Add directory of the &active frame" msgstr "Adicionar pasta da moldura &activa" #: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption msgid "Add &directories of the active && inactive frames" msgstr "A&dicionar pastas das molduras activas && inactivas" #: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption msgid "Add directory I will bro&wse to" msgstr "Adicionar pasta para onde vou na&vegar" #: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption" msgid "Add a copy of the selected entry" msgstr "Adicionar uma cópia da entrada seleccionada" #: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption msgid "Add current &selected or active directories of active frame" msgstr "Adicionar &selecção actual ou pastas activas da moldura activa" #: tfrmoptionsdirectoryhotlist.actaddseparator.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption" msgid "Add a separator" msgstr "Adicionar um separador" #: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption msgid "Add a sub menu" msgstr "Adicionar um sub-menu" #: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption" msgid "Add directory I will type" msgstr "Adicionar a pasta que vou digitar" #: tfrmoptionsdirectoryhotlist.actcollapseall.caption msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption" msgid "Collapse all" msgstr "Colapsar tudo" #: tfrmoptionsdirectoryhotlist.actcollapseitem.caption msgid "Collapse item" msgstr "Colapsar item" #: tfrmoptionsdirectoryhotlist.actcut.caption msgid "Cut selection of entries" msgstr "Cortar selecção de entradas" #: tfrmoptionsdirectoryhotlist.actdeleteall.caption msgid "Delete all!" msgstr "Eliminar tudo!" #: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption" msgid "Delete selected item" msgstr "Eliminar o item seleccionado" #: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption msgid "Delete sub-menu and all its elements" msgstr "Eliminar sub-menu e todos os seus elementos" #: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption msgid "Delete just sub-menu but keep elements" msgstr "Eliminar sub-menu mas manter os elementos" #: tfrmoptionsdirectoryhotlist.actexpanditem.caption msgid "Expand item" msgstr "Expandir item" #: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption msgid "Focus tree window" msgstr "Focar janela da árvore" #: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption msgid "Goto first item" msgstr "Ir para o 1º item" #: tfrmoptionsdirectoryhotlist.actgotolastitem.caption msgid "Goto last item" msgstr "Ir para o último item" #: tfrmoptionsdirectoryhotlist.actgotonextitem.caption msgid "Go to next item" msgstr "Ir para o item seguinte" #: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption msgid "Go to previous item" msgstr "Ir para o item anterior" #: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption msgid "Insert directory of the &active frame" msgstr "Inserir pasta da moldura &activa" #: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption msgid "Insert &directories of the active && inactive frames" msgstr "Inserir pastas &das molduras activa && inactiva" #: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption msgid "Insert directory I will bro&wse to" msgstr "Inserir pasta para onde vou na&vegar" #: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption msgid "Insert a copy of the selected entry" msgstr "Inserir cópia da entrada seleccionada" #: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption msgid "Insert current &selected or active directories of active frame" msgstr "Inserir pastas &selecção actual ou pastas activas da moldura activa" #: tfrmoptionsdirectoryhotlist.actinsertseparator.caption msgid "Insert a separator" msgstr "Inserir um separador" #: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption msgid "Insert sub menu" msgstr "Inserir sub-menu" #: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption" msgid "Insert directory I will type" msgstr "Inserir a pasta que vou digitar" #: tfrmoptionsdirectoryhotlist.actmovetonext.caption msgid "Move to next" msgstr "Mover para seguinte" #: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption msgid "Move to previous" msgstr "Mover para anterior" #: tfrmoptionsdirectoryhotlist.actopenallbranches.caption msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption" msgid "Open all branches" msgstr "Abrir todos os ramos" #: tfrmoptionsdirectoryhotlist.actpaste.caption msgid "Paste what was cut" msgstr "Colar o que foi cortado" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption msgid "Search && replace in &path" msgstr "&Procurar && substituir no caminho" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption msgid "Search && replace in both path and target" msgstr "Procurar && substituir no caminho e no destino" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption msgid "Search && replace in &target path" msgstr "Procurar && substituir no caminho des&tino" #: tfrmoptionsdirectoryhotlist.acttweakpath.caption msgid "Tweak path" msgstr "Afinar caminho" #: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption msgid "Tweak target path" msgstr "Afinar caminho destino" #: tfrmoptionsdirectoryhotlist.btnadd.caption msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption" msgid "A&dd..." msgstr "Adicionar..." #: tfrmoptionsdirectoryhotlist.btnbackup.caption msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption" msgid "Bac&kup..." msgstr "Segurança..." #: tfrmoptionsdirectoryhotlist.btndelete.caption msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption" msgid "De&lete..." msgstr "Eliminar..." #: tfrmoptionsdirectoryhotlist.btnexport.caption msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption" msgid "E&xport..." msgstr "Exportar..." #: tfrmoptionsdirectoryhotlist.btnhelp.caption msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption" msgid "&Help" msgstr "Ajuda" #: tfrmoptionsdirectoryhotlist.btnimport.caption msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption" msgid "Impo&rt..." msgstr "Importar..." #: tfrmoptionsdirectoryhotlist.btninsert.caption msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption" msgid "&Insert..." msgstr "Inserir..." #: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption msgid "&Miscellaneous..." msgstr "Diversos..." #: tfrmoptionsdirectoryhotlist.btnrelativepath.hint msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint" msgid "Some functions to select appropriate path" msgstr "Algumas funções para escolher o caminho apropriado" #: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint" msgid "Some functions to select appropriate target" msgstr "Algumas funções para escolher o destino apropriado" #: tfrmoptionsdirectoryhotlist.btnsort.caption msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption" msgid "&Sort..." msgstr "Ordenar..." #: tfrmoptionsdirectoryhotlist.cbaddtarget.caption msgid "&When adding directory, add also target" msgstr "Ao adicionar a pasta, adicionar também o destino" #: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption" msgid "Alwa&ys expand tree" msgstr "Expandir sempre a árvore" #: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption msgid "Show only &valid environment variables" msgstr "Mostrar só variáveis de ambiente válidas" #: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption msgid "In pop&up, show [path also]" msgstr "No balão, mostrar [o caminho]" #: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text" msgid "Name, a-z" msgstr "Nome, a-z" #: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text" msgid "Name, a-z" msgstr "Nome, a-z" #: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption msgid "Directory Hotlist (reorder by drag && drop)" msgstr "Lista de pastas (ordenar com arrastar/largar)" #: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption" msgid "Other options" msgstr "Outras opções" #: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption" msgid "Name:" msgstr "Nome:" #: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption" msgid "Path:" msgstr "Caminho:" #: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption" msgid "&Target:" msgstr "Destino:" #: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption" msgid "...current le&vel of item(s) selected only" msgstr "...só nível actual de itens seleccionados" #: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption" msgid "Scan all &hotdir's path to validate the ones that actually exist" msgstr "Analisar todos os caminhos de pastas para validar os que realmente existem" #: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption" msgid "&Scan all hotdir's path && target to validate the ones that actually exist" msgstr "Analisar todos os caminhos e destinos de pastas para validar os que realmente existem" #: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption msgid "to a Directory &Hotlist file (.hotlist)" msgstr "para um ficheiro de lista de pastas (.hotlist)" #: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption" msgid "to a \"wincmd.ini\" of TC (&keep existing)" msgstr "to a \"wincmd.ini\" of TC (keep existing)" #: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption" msgid "to a \"wincmd.ini\" of TC (&erase existing)" msgstr "num \"wincmd.ini\" de TC (eliminar existente)" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption" msgid "Go to &configure TC related info" msgstr "Ir para a informação de configuração TC" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption" msgid "Go to &configure TC related info" msgstr "Ir para a informação de configuração TC" #: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption msgid "HotDirTestMenu" msgstr "Menu de teste HotDir" #: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption msgid "from a Directory &Hotlist file (.hotlist)" msgstr "de um ficheiro de lista de pastas (.hotlist)" #: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption msgid "from \"&wincmd.ini\" of TC" msgstr "de \"wincmd.ini\" de TC" #: tfrmoptionsdirectoryhotlist.minavigate.caption msgid "&Navigate..." msgstr "&Navegar..." #: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption msgid "&Restore a backup of Directory Hotlist" msgstr "Restaurar uma segurança de uma lista de pastas" #: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption msgid "&Save a backup of current Directory Hotlist" msgstr "Gravar uma segurança da actual lista de pastas" #: tfrmoptionsdirectoryhotlist.misearchandreplace.caption msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption" msgid "Search and &replace..." msgstr "Localizar e substituir..." #: tfrmoptionsdirectoryhotlist.misorteverything.caption msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption" msgid "...everything, from A to &Z!" msgstr "...tudo, de A a Z!" #: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption" msgid "...single &group of item(s) only" msgstr "... só um único grupo de itens!" #: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption" msgid "...&content of submenu(s) selected, no sublevel" msgstr "...conteúdo do sub-menu seleccionado, sem sub-níveis" #: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption" msgid "...content of submenu(s) selected and &all sublevels" msgstr "...conteúdo do sub-menu seleccionado, com sub-níveis" #: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption" msgid "Test resultin&g menu" msgstr "Testar menu resultante" #: tfrmoptionsdirectoryhotlist.mitweakpath.caption msgid "Tweak &path" msgstr "Afinar camin&ho" #: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption msgid "Tweak &target path" msgstr "Afinar caminho des&tino" #: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption msgid "Addition from main panel" msgstr "Adição do painel principal:" #: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption msgid "From all the supported formats, ask which one to use every time" msgstr "Entre todos os formatos suportados, perguntar sempre qual usar" #: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)" msgstr "Ao gravar texto Unicode, gravar em formato UTF8 (senão grava em formato UTF16)" #: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption msgid "When dropping text, generate filename automatically (otherwise will prompt the user)" msgstr "Ao largar texto, gerar nome de ficheiro automaticamente (senão pede ao utilizador)" #: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption msgid "&Show confirmation dialog after drop" msgstr "Mo&strar diálogo de confirmação após largar" #: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption msgid "When drag && dropping text into panels:" msgstr "Ao arrastar e largar texto nos painéis:" #: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption msgid "Place the most desired format on top of list (use dag && drop):" msgstr "Pôr o formato mais desejado no topo da lista (usar arrastar/largar):" #: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption msgid "(if the most desired is not present, we'll take second one and so on)" msgstr "(se o mais desejado não existir, será usado o segundo e assim por diante)" #: tfrmoptionsdragdrop.lblwarningforaskformat.caption msgid "(will not work with some source application, so try to uncheck if problem)" msgstr "(não funcionará com algumas aplicações fonte, tente desmarcar se tiver problemas)" #: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption msgid "Show &file system" msgstr "Mostrar sistema de &ficheiros" #: tfrmoptionsdriveslistbutton.cbshowfreespace.caption msgid "Show fr&ee space" msgstr "Mostrar &espaço livre" #: tfrmoptionsdriveslistbutton.cbshowlabel.caption msgid "Show &label" msgstr "Mostrar rótu&lo" #: tfrmoptionsdriveslistbutton.gbdriveslist.caption msgid "Drives list" msgstr "Lista de unidades" #: tfrmoptionseditor.chkautoindent.caption msgid "Auto Indent" msgstr "" #: tfrmoptionseditor.chkautoindent.hint msgid "Allows to indent the caret, when new line is created with , with the same amount of leading white space as the preceding line" msgstr "" #: tfrmoptionseditor.chkscrollpastendline.caption msgid "Caret past end of line" msgstr "Cursor após o fim da linha" #: tfrmoptionseditor.chkscrollpastendline.hint msgid "Allows caret to go into empty space beyond end-of-line position" msgstr "" #: tfrmoptionseditor.chkshowspecialchars.caption msgid "Show special characters" msgstr "Mostrar caracteres especiais" #: tfrmoptionseditor.chkshowspecialchars.hint msgid "Shows special characters for spaces and tabulations" msgstr "" #: tfrmoptionseditor.chktabindent.caption msgid "Tab indents blocks" msgstr "" #: tfrmoptionseditor.chktabindent.hint msgid "When active and act as block indent, unindent when text is selected" msgstr "" #: tfrmoptionseditor.chktabstospaces.caption msgid "Use spaces instead tab characters" msgstr "" #: tfrmoptionseditor.chktabstospaces.hint msgid "Converts tab characters to a specified number of space characters (when entering)" msgstr "" #: tfrmoptionseditor.chktrimtrailingspaces.caption msgid "Delete trailing spaces" msgstr "" #: tfrmoptionseditor.chktrimtrailingspaces.hint msgid "Auto delete trailing spaces, this applies only to edited lines" msgstr "" #: tfrmoptionseditor.gbinternaleditor.caption msgid "Internal editor options" msgstr "Opções internas do editor" #: tfrmoptionseditorcolors.backgroundlabel.caption msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption" msgid "Bac&kground" msgstr "F&undo" #: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION" msgid "Bac&kground" msgstr "F&undo" #: tfrmoptionseditorcolors.btnresetmask.hint msgid "Reset" msgstr "Repor" #: tfrmoptionseditorcolors.btnsavemask.hint msgctxt "tfrmoptionseditorcolors.btnsavemask.hint" msgid "Save" msgstr "Gravar" #: tfrmoptionseditorcolors.bvlattributesection.caption msgid "Element Attributes" msgstr "Atributos de elemento" #: tfrmoptionseditorcolors.foregroundlabel.caption msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption" msgid "Fo®round" msgstr "1º p&lano" #: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION" msgid "Fo®round" msgstr "1º p&lano" #: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption msgid "&Text-mark" msgstr "Marca de &texto" #: tfrmoptionseditorcolors.tbtnglobal.caption msgid "Use (and edit) &global scheme settings" msgstr "Usar (e editar) definições de esquema &globais" #: tfrmoptionseditorcolors.tbtnlocal.caption msgid "Use &local scheme settings" msgstr "Usar definições de esquema &locais" #: tfrmoptionseditorcolors.textboldcheckbox.caption msgid "&Bold" msgstr "&Negrito" #: tfrmoptionseditorcolors.textboldradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION" msgid "In&vert" msgstr "In&verter" #: tfrmoptionseditorcolors.textboldradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION" msgid "O&ff" msgstr "Desl&igar" #: tfrmoptionseditorcolors.textboldradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION" msgid "O&n" msgstr "Li&gar" #: tfrmoptionseditorcolors.textitaliccheckbox.caption msgid "&Italic" msgstr "&Itálico" #: tfrmoptionseditorcolors.textitalicradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION" msgid "In&vert" msgstr "In&verter" #: tfrmoptionseditorcolors.textitalicradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION" msgid "O&ff" msgstr "Desl&igar" #: tfrmoptionseditorcolors.textitalicradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION" msgid "O&n" msgstr "Li&gar" #: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption msgid "&Strike Out" msgstr "&Rasurado" #: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION" msgid "In&vert" msgstr "In&verter" #: tfrmoptionseditorcolors.textstrikeoutradiooff.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION" msgid "O&ff" msgstr "Desl&igar" #: tfrmoptionseditorcolors.textstrikeoutradioon.caption msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION" msgid "O&n" msgstr "Li&gar" #: tfrmoptionseditorcolors.textunderlinecheckbox.caption msgid "&Underline" msgstr "&Sublinhado" #: tfrmoptionseditorcolors.textunderlineradioinvert.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption" msgid "In&vert" msgstr "In&verter" #: tfrmoptionseditorcolors.textunderlineradiooff.caption msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption" msgid "O&ff" msgstr "Desl&igar" #: tfrmoptionseditorcolors.textunderlineradioon.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption" msgid "O&n" msgstr "Li&gar" #: tfrmoptionsfavoritetabs.btnadd.caption msgctxt "tfrmoptionsfavoritetabs.btnadd.caption" msgid "Add..." msgstr "Adicionar..." #: tfrmoptionsfavoritetabs.btndelete.caption msgctxt "tfrmoptionsfavoritetabs.btndelete.caption" msgid "Delete..." msgstr "Eliminar..." #: tfrmoptionsfavoritetabs.btnimportexport.caption msgid "Import/Export" msgstr "Importar/Exportar" #: tfrmoptionsfavoritetabs.btninsert.caption msgctxt "tfrmoptionsfavoritetabs.btninsert.caption" msgid "Insert..." msgstr "Inserir..." #: tfrmoptionsfavoritetabs.btnrename.caption msgctxt "tfrmoptionsfavoritetabs.btnrename.caption" msgid "Rename" msgstr "Renomear" #: tfrmoptionsfavoritetabs.btnsort.caption msgctxt "tfrmoptionsfavoritetabs.btnsort.caption" msgid "Sort..." msgstr "Ordenar..." #: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text" msgid "None" msgstr "Nada" #: tfrmoptionsfavoritetabs.cbfullexpandtree.caption msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption" msgid "Always expand tree" msgstr "Expandir sempre a árvore" #: tfrmoptionsfavoritetabs.cbsavedirhistory.text msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text" msgid "No" msgstr "Não" #: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text" msgid "Left" msgstr "Esquerda" #: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text" msgid "Right" msgstr "Direita" #: tfrmoptionsfavoritetabs.gbfavoritetabs.caption msgid "Favorite Tabs list (reorder by drag && drop)" msgstr "Lista de separadores favoritos (ordenar com arrastar/largar)" #: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption" msgid "Other options" msgstr "Outras opções" #: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption msgid "What to restore where for the selected entry:" msgstr "O que restaurar onde na entrada seleccionada:" #: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption msgid "Existing tabs to keep:" msgstr "Separadores existentes a manter:" #: tfrmoptionsfavoritetabs.lblsavedirhistory.caption msgid "Save dir history:" msgstr "Gravar histórico da pasta:" #: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption msgid "Tabs saved on left to be restored to:" msgstr "Separadores gravados à esquerda a restaurar:" #: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption msgid "Tabs saved on right to be restored to:" msgstr "Separadores gravados à direita a restaurar:" #: tfrmoptionsfavoritetabs.menuitem1.caption msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.menuitem2.caption msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miaddseparator.caption msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption" msgid "a separator" msgstr "um separador" #: tfrmoptionsfavoritetabs.miaddseparator2.caption msgid "Add separator" msgstr "Adicionar separador" #: tfrmoptionsfavoritetabs.miaddsubmenu.caption msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption" msgid "sub-menu" msgstr "sub-menu" #: tfrmoptionsfavoritetabs.miaddsubmenu2.caption msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption" msgid "Add sub-menu" msgstr "Adicionar sub-menu" #: tfrmoptionsfavoritetabs.micollapseall.caption msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption" msgid "Collapse all" msgstr "Colapsar tudo" #: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption" msgid "...current level of item(s) selected only" msgstr "...só o nível actual de itens seleccionado" #: tfrmoptionsfavoritetabs.micutselection.caption msgctxt "tfrmoptionsfavoritetabs.micutselection.caption" msgid "Cut" msgstr "Cortar" #: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption" msgid "delete all!" msgstr "eliminar tudo!" #: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption" msgid "sub-menu and all its elements" msgstr "sub-menu e todos os elementos" #: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption" msgid "just sub-menu but keep elements" msgstr "só sub-menu, manter elementos" #: tfrmoptionsfavoritetabs.mideleteselectedentry.caption msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption" msgid "selected item" msgstr "item seleccionado" #: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption" msgid "Delete selected item" msgstr "Eliminar o item seleccionado" #: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption msgid "Export selection to legacy .tab file(s)" msgstr "Exportar selecção para ficheiro(s) .tab" #: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption msgid "FavoriteTabsTestMenu" msgstr "Menu de tese de favoritos" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption msgid "Import legacy .tab file(s) according to default setting" msgstr "Importar ficheiro(s) .tab de acordo com a predefinição" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption" msgid "Import legacy .tab file(s) at selected position" msgstr "Importar ficheiro(s) .tab na posição seleccionada" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption" msgid "Import legacy .tab file(s) at selected position" msgstr "Importar ficheiro(s) .tab na posição seleccionada" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption msgid "Import legacy .tab file(s) at selected position in a sub menu" msgstr "Importar ficheiro(s) .tab na posição seleccionada num sub-menu" #: tfrmoptionsfavoritetabs.miinsertseparator.caption msgid "Insert separator" msgstr "Inserir separador" #: tfrmoptionsfavoritetabs.miinsertsubmenu.caption msgid "Insert sub-menu" msgstr "Inserir sub-menu" #: tfrmoptionsfavoritetabs.miopenallbranches.caption msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption" msgid "Open all branches" msgstr "Abrir todos os ramos" #: tfrmoptionsfavoritetabs.mipasteselection.caption msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption" msgid "Paste" msgstr "Colar" #: tfrmoptionsfavoritetabs.mirename.caption msgctxt "tfrmoptionsfavoritetabs.mirename.caption" msgid "Rename" msgstr "Renomear" #: tfrmoptionsfavoritetabs.miseparator1.caption msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator10.caption msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator11.caption msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator2.caption msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator3.caption msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator7.caption msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator8.caption msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator9.caption msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.misorteverything.caption msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption" msgid "...everything, from A to Z!" msgstr "...tudo, de A a Z!" #: tfrmoptionsfavoritetabs.misortsinglegroup.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption" msgid "...single group of item(s) only" msgstr "... só um único grupo de itens!" #: tfrmoptionsfavoritetabs.misortsinglegroup2.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption" msgid "Sort single group of item(s) only" msgstr "Ordenar só grupo único de itens" #: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption" msgid "...content of submenu(s) selected, no sublevel" msgstr "...conteúdo do sub-menu seleccionado, sem sub-níveis" #: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption" msgid "...content of submenu(s) selected and all sublevels" msgstr "...conteúdo do sub-menu seleccionado, com sub-níveis" #: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption" msgid "Test resulting menu" msgstr "Testar menu resultante" #: tfrmoptionsfileassoc.btnaddact.caption msgctxt "tfrmoptionsfileassoc.btnaddact.caption" msgid "Add" msgstr "Adicionar" #: tfrmoptionsfileassoc.btnaddext.caption msgctxt "tfrmoptionsfileassoc.btnaddext.caption" msgid "&Add" msgstr "&Adicionar" #: tfrmoptionsfileassoc.btnaddnewtype.caption msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption" msgid "A&dd" msgstr "A&dicionar" #: tfrmoptionsfileassoc.btncloneact.caption msgid "Clone" msgstr "Clonar" #: tfrmoptionsfileassoc.btndownact.caption msgctxt "tfrmoptionsfileassoc.btndownact.caption" msgid "&Down" msgstr "A&baixo" #: tfrmoptionsfileassoc.btneditext.caption msgctxt "tfrmoptionsfileassoc.btneditext.caption" msgid "Edit" msgstr "Editar" #: tfrmoptionsfileassoc.btninsertact.caption msgctxt "tfrmoptionsfileassoc.btninsertact.caption" msgid "Insert" msgstr "Inserir" #: tfrmoptionsfileassoc.btninsertext.caption msgctxt "tfrmoptionsfileassoc.btninsertext.caption" msgid "Insert" msgstr "Inserir" #: tfrmoptionsfileassoc.btnremoveact.caption msgctxt "tfrmoptionsfileassoc.btnremoveact.caption" msgid "Remo&ve" msgstr "Remo&ver" #: tfrmoptionsfileassoc.btnremoveext.caption msgctxt "tfrmoptionsfileassoc.btnremoveext.caption" msgid "Re&move" msgstr "Re&mover" #: tfrmoptionsfileassoc.btnremovetype.caption msgctxt "tfrmoptionsfileassoc.btnremovetype.caption" msgid "&Remove" msgstr "&Remover" #: tfrmoptionsfileassoc.btnrenametype.caption msgctxt "tfrmoptionsfileassoc.btnrenametype.caption" msgid "R&ename" msgstr "R&enomear" #: tfrmoptionsfileassoc.btnupact.caption msgctxt "tfrmoptionsfileassoc.btnupact.caption" msgid "&Up" msgstr "A&cima" #: tfrmoptionsfileassoc.destartpath.hint msgid "Starting path of the command. Never quote this string." msgstr "Caminho inicial do comando. Não usar aspas nesta cadeia." #: tfrmoptionsfileassoc.edbactionname.hint msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you" msgstr "Nome da acção. Nunca é passado ao sistema, é só uma mnemónica escolhida por si e para si" #: tfrmoptionsfileassoc.edtparams.hint msgid "Parameter to pass to the command. Long filename with spaces should be quoted." msgstr "Parâmetro a passar ao comando. Usar aspas em nomes de ficheiro longos e com espaços." #: tfrmoptionsfileassoc.fnecommand.hint msgid "Command to execute. Long filename with space should be quoted." msgstr "Comando a executar. Usar aspas em nomes de ficheiro longos e com espaços." #: tfrmoptionsfileassoc.gbactiondescription.caption msgid "Action description:" msgstr "Descrição da acção:" #: tfrmoptionsfileassoc.gbactions.caption msgctxt "tfrmoptionsfileassoc.gbactions.caption" msgid "Actions" msgstr "Acções" #: tfrmoptionsfileassoc.gbexts.caption msgctxt "tfrmoptionsfileassoc.gbexts.caption" msgid "Extensions" msgstr "Extensões" #: tfrmoptionsfileassoc.gbexts.hint msgid "Can be sorted by drag & drop" msgstr "Pode ordenar com arrastar/largar" #: tfrmoptionsfileassoc.gbfiletypes.caption msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption" msgid "File types" msgstr "Tipos de ficheiro" #: tfrmoptionsfileassoc.gbicon.caption msgctxt "tfrmoptionsfileassoc.gbicon.caption" msgid "Icon" msgstr "Ícone" #: tfrmoptionsfileassoc.lbactions.hint msgid "Actions may be sorted by drag & drop" msgstr "Pode ordenar acções com arrastar/largar" #: tfrmoptionsfileassoc.lbexts.hint msgid "Extensions may be sorted by drag & drop" msgstr "Pode ordenar extensões com arrastar/largar" #: tfrmoptionsfileassoc.lbfiletypes.hint msgid "File types may be sorted by drag & drop" msgstr "Pode ordenar tipos de ficheiro com arrastar/largar" #: tfrmoptionsfileassoc.lblaction.caption msgctxt "tfrmoptionsfileassoc.lblaction.caption" msgid "Action name:" msgstr "Nome:" #: tfrmoptionsfileassoc.lblcommand.caption msgctxt "tfrmoptionsfileassoc.lblcommand.caption" msgid "&Command:" msgstr "&Comando" #: tfrmoptionsfileassoc.lblexternalparameters.caption msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption" msgid "Parameter&s:" msgstr "Parâmetro&s:" #: tfrmoptionsfileassoc.lblstartpath.caption msgctxt "tfrmoptionsfileassoc.lblstartpath.caption" msgid "Start pat&h:" msgstr "Camin&ho inicial:" #: tfrmoptionsfileassoc.menuitem1.caption msgctxt "tfrmoptionsfileassoc.menuitem1.caption" msgid "-" msgstr "-" #: tfrmoptionsfileassoc.menuitem3.caption msgid "Custom with..." msgstr "Personalizado com..." #: tfrmoptionsfileassoc.micustom.caption msgid "Custom" msgstr "Personalizado" #: tfrmoptionsfileassoc.miedit.caption msgctxt "tfrmoptionsfileassoc.miedit.caption" msgid "Edit" msgstr "Editar" #: tfrmoptionsfileassoc.mieditor.caption msgctxt "tfrmoptionsfileassoc.mieditor.caption" msgid "Open in Editor" msgstr "Abrir no editor" #: tfrmoptionsfileassoc.mieditwith.caption msgid "Edit with..." msgstr "Editar com..." #: tfrmoptionsfileassoc.migetoutputfromcommand.caption msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption" msgid "Get output from command" msgstr "Obter saída do comando" #: tfrmoptionsfileassoc.miinternaleditor.caption msgid "Open in Internal Editor" msgstr "Abrir no editor interno" #: tfrmoptionsfileassoc.miinternalviewer.caption msgid "Open in Internal Viewer" msgstr "Abrir no visualizador interno" #: tfrmoptionsfileassoc.miopen.caption msgctxt "tfrmoptionsfileassoc.miopen.caption" msgid "Open" msgstr "Abrir" #: tfrmoptionsfileassoc.miopenwith.caption msgid "Open with..." msgstr "Abrir com..." #: tfrmoptionsfileassoc.miseparator.caption msgctxt "tfrmoptionsfileassoc.miseparator.caption" msgid "-" msgstr "-" #: tfrmoptionsfileassoc.mishell.caption msgctxt "tfrmoptionsfileassoc.mishell.caption" msgid "Run in terminal" msgstr "Executar no terminal" #: tfrmoptionsfileassoc.miview.caption msgctxt "tfrmoptionsfileassoc.miview.caption" msgid "View" msgstr "Ver" #: tfrmoptionsfileassoc.miviewer.caption msgctxt "tfrmoptionsfileassoc.miviewer.caption" msgid "Open in Viewer" msgstr "Abrir no visualizador" #: tfrmoptionsfileassoc.miviewwith.caption msgid "View with..." msgstr "Ver com..." #: tfrmoptionsfileassoc.sbtnicon.hint msgid "Click me to change icon!" msgstr "Clique para alterar o ícone!" #: tfrmoptionsfileassocextra.cbexecuteviashell.caption msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption" msgid "Execute via shell" msgstr "Executar numa shell" #: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption msgid "Extended context menu" msgstr "Menu contextual estendido" #: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption msgid "File association configuration" msgstr "Configuração de associações de ficheiros" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption msgid "Offer to add selection to file association when not included already" msgstr "Sugerir a adição da associação do ficheiro quando ainda não estiver incluída" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint" msgid "When accessing file association, offer to add current selected file if not already included in a configured file type" msgstr "Ao aceder a associações de ficheiros, sugerir a adição do ficheiro actual se ainda não estiver incluído num tipo configurado" #: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption" msgid "Execute via terminal and close" msgstr "Executar no terminal e fechar" #: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption" msgid "Execute via terminal and stay open" msgstr "Executar no terminal e manter aberto" #: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption msgid "Extended options items:" msgstr "Itens de opções estendidas:" #: tfrmoptionsfileoperations.bvlconfirmations.caption msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption" msgid "Show confirmation window for:" msgstr "Mostrar diálogo de confirmação para:" #: tfrmoptionsfileoperations.cbcopyconfirmation.caption msgid "Cop&y operation" msgstr "Operação Cop&iar" #: tfrmoptionsfileoperations.cbdeleteconfirmation.caption msgid "&Delete operation" msgstr "Operação &Eliminar" #: tfrmoptionsfileoperations.cbdeletetotrash.caption msgid "Dele&te to recycle bin (Shift key reverses this setting)" msgstr "" "Eliminar para a reciclagem (\n" "Shift rever&te esta definição)\n" #: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption msgid "D&elete to trash operation" msgstr "Operação &Eliminar para o lixo" #: tfrmoptionsfileoperations.cbdropreadonlyflag.caption msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION" msgid "D&rop readonly flag" msgstr "La&rgar marca Só de leitura" #: tfrmoptionsfileoperations.cbmoveconfirmation.caption msgid "&Move operation" msgstr "Operação &Mover" #: tfrmoptionsfileoperations.cbprocesscomments.caption msgid "&Process comments with files/folders" msgstr "&Comentários do processo com ficheiros/pastas" #: tfrmoptionsfileoperations.cbrenameselonlyname.caption msgid "Select &file name without extension when renaming" msgstr "Seleccionar nome de &ficheiro sem extensão ao renomear" #: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption msgid "Sho&w tab select panel in copy/move dialog" msgstr "Mos&trar painel de selecção de separador no diálogo Copiar/Mover" #: tfrmoptionsfileoperations.cbskipfileoperror.caption msgid "S&kip file operations errors and write them to log window" msgstr "Saltar erros de &operações de ficheiros e escrevê-los no diário" #: tfrmoptionsfileoperations.gbexecutingoperations.caption msgid "Executing operations" msgstr "A executar as operações" #: tfrmoptionsfileoperations.gbuserinterface.caption msgid "User interface" msgstr "Ambiente do utilizador" #: tfrmoptionsfileoperations.lblbuffersize.caption msgid "&Buffer size for file operations (in KB):" msgstr "Tamanho do &buffer para operações de ficheiros (em KB):" #: tfrmoptionsfileoperations.lblhashbuffersize.caption msgid "Buffer size for &hash calculation (in KB):" msgstr "Tamanho do buffer para cálculo de &hash (em KB):" #: tfrmoptionsfileoperations.lblprogresskind.caption msgid "Show operations progress &initially in" msgstr "Mostrar progresso da operação &inicialmente em" #: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption" msgid "Duplicated name auto-rename style:" msgstr "Estilo de renomeação automática de duplicados:" #: tfrmoptionsfileoperations.lblwipepassnumber.caption msgid "&Number of wipe passes:" msgstr "&Número de passagens de limpeza:" #: tfrmoptionsfilepanelscolors.btnbackcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnbackcolor2.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursortext.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnforecolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnindbackcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnindcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnmarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption msgid "Reset to DC default" msgstr "Repor predefinição do DC" #: tfrmoptionsfilepanelscolors.cballowovercolor.caption msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption" msgid "Allow Overcolor" msgstr "Permitir cor sobreposta" #: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption msgid "Use &Frame Cursor" msgstr "Usar &cursor vazio" #: tfrmoptionsfilepanelscolors.cbbusegradientind.caption msgid "Use &Gradient Indicator" msgstr "Usar indicador de &gradiente" #: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption msgid "Use Inactive Sel Color" msgstr "Usar cor de selecção inactiva" #: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption msgid "U&se Inverted Selection" msgstr "U&sar selecção invertida" #: tfrmoptionsfilepanelscolors.cbusecursorborder.caption msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption" msgid "Cursor border" msgstr "Contorno do cursor" #: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION" msgid "Drive Free Space Indicator" msgstr "Indicador de espaço livre na unidade" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption msgid "Bac&kground:" msgstr "F&undo:" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION" msgid "Backg&round 2:" msgstr "Fu&ndo 2:" #: tfrmoptionsfilepanelscolors.lblcursorcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION" msgid "C&ursor Color:" msgstr "Cor do c&ursor:" #: tfrmoptionsfilepanelscolors.lblcursortext.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION" msgid "Cursor Te&xt:" msgstr "Te&xto do cursor:" #: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption" msgid "Inactive Cursor Color:" msgstr "Cor do cursor inactivo:" #: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption" msgid "Inactive Mark Color:" msgstr "Cor de marca inactiva:" #: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption msgid "&Brightness level of inactive panel" msgstr "Nível de &brilho do painel inactivo" #: tfrmoptionsfilepanelscolors.lblindbackcolor.caption msgid "In&dicator Back Color:" msgstr "Cor de fun&do:" #: tfrmoptionsfilepanelscolors.lblindcolor.caption msgid "&Indicator Fore Color:" msgstr "Cor de &1º plano:" #: tfrmoptionsfilepanelscolors.lblmarkcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION" msgid "&Mark Color:" msgstr "Cor da &marca:" #: tfrmoptionsfilepanelscolors.lblpreview.caption msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings." msgstr "Abaixo está uma antevisão. Pode mover o cursor, seleccionar ficheiros e ver imediatamente o aspecto das várias definições." #: tfrmoptionsfilepanelscolors.lbltextcolor.caption msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION" msgid "T&ext Color:" msgstr "Cor do t&exto" #: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption msgid "When launching file search, clear file mask filter" msgstr "Ao lançar uma procura de ficheiros, limpar o filtro de máscaras" #: tfrmoptionsfilesearch.cbpartialnamesearch.caption msgctxt "tfrmoptionsfilesearch.cbpartialnamesearch.caption" msgid "&Search for part of file name" msgstr "&Procurar parte do nome do ficheiro" #: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption msgid "Show menu bar in \"Find files\"" msgstr "Mostrar barra de menu no \"Localizar ficheiros\"" #: tfrmoptionsfilesearch.dbtextsearch.caption msgctxt "tfrmoptionsfilesearch.dbtextsearch.caption" msgid "Text search in files" msgstr "Procurar texto em ficheiros" #: tfrmoptionsfilesearch.gbfilesearch.caption msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption" msgid "File search" msgstr "Procurar ficheiro" #: tfrmoptionsfilesearch.lblnewsearchfilters.caption msgid "Current filters with \"New search\" button:" msgstr "Filtros actuais com botão \"Nova procura\":" #: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption msgctxt "tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption" msgid "Default search template:" msgstr "Modelo de procura predefinido:" #: tfrmoptionsfilesearch.rbusemmapinsearch.caption msgctxt "tfrmoptionsfilesearch.rbusemmapinsearch.caption" msgid "Use memory mapping for search te&xt in files" msgstr "Usar mapa de memória para procurar te&xto em ficheiros" #: tfrmoptionsfilesearch.rbusestreaminsearch.caption msgctxt "tfrmoptionsfilesearch.rbusestreaminsearch.caption" msgid "&Use stream for search text in files" msgstr "&Usar corrente para procurar texto em ficheiros" #: tfrmoptionsfilesviews.btnaddattribute.caption msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption" msgid "&Add" msgstr "&Adicionar" #: tfrmoptionsfilesviews.btnattrshelp.caption msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption" msgid "&Help" msgstr "A&juda" #: tfrmoptionsfilesviews.cbdblclicktoparent.caption msgid "Enable changing to &parent folder when double-clicking on empty part of file view" msgstr "Permitir alterar para &pasta-mãe com duplo clique em área vazia da vista de ficheiro" #: tfrmoptionsfilesviews.cbdelayloadingtabs.caption msgid "Do&n't load file list until a tab is activated" msgstr "&Não carregar lista de ficheiros até um separador estar activo" #: tfrmoptionsfilesviews.cbdirbrackets.caption msgid "S&how square brackets around directories" msgstr "Mostrar pastas entre parênteses rectos" #: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption msgid "Hi&ghlight new and updated files" msgstr "Rea&lçar ficheiros novos e actualizados" #: tfrmoptionsfilesviews.cbinplacerename.caption msgid "Enable inplace &renaming when clicking twice on a name" msgstr "Permitir &renomear no local com duplo clique num nome" #: tfrmoptionsfilesviews.cblistfilesinthread.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION" msgid "Load &file list in separate thread" msgstr "Carregar lista de &ficheiros em linha separada" #: tfrmoptionsfilesviews.cbloadiconsseparately.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION" msgid "Load icons af&ter file list" msgstr "Carregar ícones depois da lis&ta de ficheiros" #: tfrmoptionsfilesviews.cbshowsystemfiles.caption msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION" msgid "Show s&ystem and hidden files" msgstr "Mostrar ficheiros ocultos e de s&istema" #: tfrmoptionsfilesviews.cbspacemovesdown.caption msgid "&When selecting files with , move down to next file (as with )" msgstr "Ao seleccionar ficheiros com a , mover para o próximo ficheiro (tal como com )" #: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)" msgstr "Filtro estilo Windows ao marcar ficheiros (\"*.*\" também selecciona ficheiros sem extensão, etc.)" #: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption msgid "Use an independent attribute filter in mask input dialog each time" msgstr "Usar filtro de atributo independente no diálogo de entrada da máscara" #: tfrmoptionsfilesviews.gbformatting.caption msgid "Formatting" msgstr "Formatação" #: tfrmoptionsfilesviews.gbmarking.caption msgid "Marking/Unmarking entries" msgstr "Marcar/Desmarcar entradas" #: tfrmoptionsfilesviews.gbsorting.caption msgid "Sorting" msgstr "Ordem" #: tfrmoptionsfilesviews.lbattributemask.caption msgid "Default attribute mask value to use:" msgstr "Valor predefinido de máscara de atributo:" #: tfrmoptionsfilesviews.lblcasesensitivity.caption msgid "Case s&ensitivity:" msgstr "S&ensibilidade a maiúsculas:" #: tfrmoptionsfilesviews.lbldatetimeexample.caption msgid "Incorrect format" msgstr "Formato incorrecto" #: tfrmoptionsfilesviews.lbldatetimeformat.caption msgid "&Date and time format:" msgstr "Formato de &data e hora:" #: tfrmoptionsfilesviews.lblfilesizeformat.caption msgid "File si&ze format:" msgstr "Formato do ta&manho de ficheiro:" #: tfrmoptionsfilesviews.lblnewfilesposition.caption msgid "&Insert new files:" msgstr "&Inserir novos ficheiros:" #: tfrmoptionsfilesviews.lblsortfoldermode.caption msgid "So&rting directories:" msgstr "A o&rdenar pastas:" #: tfrmoptionsfilesviews.lblsortmethod.caption msgid "&Sort method:" msgstr "Método de &ordenação" #: tfrmoptionsfilesviews.lblupdatedfilesposition.caption msgid "&Move updated files:" msgstr "&Mover ficheiros actualizados:" #: tfrmoptionsfiletypescolors.btnaddcategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION" msgid "A&dd" msgstr "A&dicionar" #: tfrmoptionsfiletypescolors.btnapplycategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION" msgid "A&pply" msgstr "A&plicar" #: tfrmoptionsfiletypescolors.btncategorycolor.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsfiletypescolors.btndeletecategory.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION" msgid "D&elete" msgstr "&Eliminar" #: tfrmoptionsfiletypescolors.btnsearchtemplate.hint msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT" msgid "Template..." msgstr "Modelo..." #: tfrmoptionsfiletypescolors.gbfiletypescolors.caption msgid "File types colors (sort by drag&&drop)" msgstr "Cores de tipos de ficheiros (ordenar com arrastar && largar)" #: tfrmoptionsfiletypescolors.lblcategoryattr.caption msgid "Category a&ttributes:" msgstr "A&tributos de categoria:" #: tfrmoptionsfiletypescolors.lblcategorycolor.caption msgid "Category co&lor:" msgstr "Cor de cate&goria" #: tfrmoptionsfiletypescolors.lblcategorymask.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION" msgid "Category &mask:" msgstr "&Máscara de categoria:" #: tfrmoptionsfiletypescolors.lblcategoryname.caption msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION" msgid "Category &name:" msgstr "&Nome de categoria:" #: tfrmoptionsfonts.btnpatheditfnt.caption msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnsearchresultsfnt.caption msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselconsolefnt.caption msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnseleditfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnsellogfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselmainfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselviewerbookfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselviewfnt.caption msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION" msgid "..." msgstr "..." #: tfrmoptionsfonts.lblconsolefont.caption msgid "&Console font" msgstr "Letra da &consola" #: tfrmoptionsfonts.lbleditorfont.caption msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION" msgid "&Editor font" msgstr "Letra do &editor" #: tfrmoptionsfonts.lbllogfont.caption msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION" msgid "&Log font" msgstr "Letra do &diário" #: tfrmoptionsfonts.lblmainfont.caption msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION" msgid "Main &font" msgstr "&Letra do programa" #: tfrmoptionsfonts.lblpatheditfont.caption msgid "Path font" msgstr "Letra do caminho" #: tfrmoptionsfonts.lblsearchresultsfont.caption msgid "Search results font" msgstr "Letra dos resultados" #: tfrmoptionsfonts.lblviewerbookfont.caption msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION" msgid "Viewer&Book Font" msgstr "Letra do livro do vis&ualizador" #: tfrmoptionsfonts.lblviewerfont.caption msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION" msgid "&Viewer font" msgstr "Letra do visuali&zador" #: tfrmoptionshotkeys.actaddhotkey.caption msgctxt "tfrmoptionshotkeys.actaddhotkey.caption" msgid "Add &hotkey" msgstr "Adicionar atal&ho" #: tfrmoptionshotkeys.actcopy.caption msgctxt "tfrmoptionshotkeys.actcopy.caption" msgid "Copy" msgstr "Copiar" #: tfrmoptionshotkeys.actdelete.caption msgctxt "tfrmoptionshotkeys.actdelete.caption" msgid "Delete" msgstr "Eliminar" #: tfrmoptionshotkeys.actdeletehotkey.caption msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption" msgid "&Delete hotkey" msgstr "&Eliminar atalho" #: tfrmoptionshotkeys.actedithotkey.caption msgctxt "tfrmoptionshotkeys.actedithotkey.caption" msgid "&Edit hotkey" msgstr "&Editar atalho" #: tfrmoptionshotkeys.actnextcategory.caption msgid "Next category" msgstr "Categoria seguinte" #: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption msgid "Make popup the file related menu" msgstr "Fazer balão do menu relacionado com o ficheiro" #: tfrmoptionshotkeys.actpreviouscategory.caption msgid "Previous category" msgstr "Categoria anterior" #: tfrmoptionshotkeys.actrename.caption msgctxt "tfrmoptionshotkeys.actrename.caption" msgid "Rename" msgstr "Renomear" #: tfrmoptionshotkeys.actrestoredefault.caption msgid "Restore DC default" msgstr "Repor predefinição do DC" #: tfrmoptionshotkeys.actsavenow.caption msgid "Save now" msgstr "Gravar agora" #: tfrmoptionshotkeys.actsortbycommand.caption msgid "Sort by command name" msgstr "Ordenar por nome do comando" #: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption msgid "Sort by hotkeys (grouped)" msgstr "Ordenar por atalhos (agrupado)" #: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption msgid "Sort by hotkeys (one per row)" msgstr "Ordenar por atalhos (um por linha)" #: tfrmoptionshotkeys.lbfilter.caption msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION" msgid "&Filter" msgstr "&Filtro" #: tfrmoptionshotkeys.lblcategories.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION" msgid "C&ategories:" msgstr "C&ategorias:" #: tfrmoptionshotkeys.lblcommands.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION" msgid "Co&mmands:" msgstr "Co&mandos:" #: tfrmoptionshotkeys.lblscfiles.caption msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION" msgid "&Shortcut files:" msgstr "Ficheiro&s de atalho:" #: tfrmoptionshotkeys.lblsortorder.caption msgid "So&rt order:" msgstr "O&rdem:" #: tfrmoptionshotkeys.micategories.caption msgid "Categories" msgstr "Categorias" #: tfrmoptionshotkeys.micommands.caption msgctxt "tfrmoptionshotkeys.micommands.caption" msgid "Command" msgstr "Comando" #: tfrmoptionshotkeys.miseparator1.caption msgctxt "tfrmoptionshotkeys.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionshotkeys.misortorder.caption msgid "Sort order" msgstr "Ordem" #: tfrmoptionsicons.cbiconsexclude.caption msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION" msgid "For the following &paths and their subdirectories:" msgstr "Para os seguintes caminhos e sub-&pastas:" #: tfrmoptionsicons.cbiconsinmenus.caption msgid "Show icons for actions in &menus" msgstr "Mostrar ícones para ações nos &menus" #: tfrmoptionsicons.cbiconsinmenussize.text msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT" msgid "16x16" msgstr "16x16" #: tfrmoptionsicons.cbiconsonbuttons.caption msgid "Show icons on buttons" msgstr "Mostrar ícones nos botões" #: tfrmoptionsicons.cbiconsshowoverlay.caption msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION" msgid "Show o&verlay icons, e.g. for links" msgstr "M&ostrar ícones sobrepostos, i.e. para ligações" #: tfrmoptionsicons.chkshowhiddendimmed.caption msgid "&Dimmed hidden files (slower)" msgstr "" #: tfrmoptionsicons.gbdisablespecialicons.caption msgid "Disable special icons" msgstr "Desactivar ícones especiais" #: tfrmoptionsicons.gbiconssize.caption msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION" msgid " Icon size " msgstr "Tamanho do ícone" #: tfrmoptionsicons.gbicontheme.caption msgid "Icon theme" msgstr "Tema de ícones" #: tfrmoptionsicons.gbshowicons.caption msgid "Show icons" msgstr "Mostrar ícones" #: tfrmoptionsicons.gbshowiconsmode.caption msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION" msgid " Show icons to the left of the filename " msgstr "Mostrar ícones à esquerda do nome de ficheiro" #: tfrmoptionsicons.lbldiskpanel.caption msgid "Disk panel:" msgstr "Painel de discos:" #: tfrmoptionsicons.lblfilepanel.caption msgid "File panel:" msgstr "Painel de ficheiros:" #: tfrmoptionsicons.rbiconsshowall.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION" msgid "A&ll" msgstr "T&udo" #: tfrmoptionsicons.rbiconsshowallandexe.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION" msgid "All associated + &EXE/LNK (slow)" msgstr "Todos os associados + &EXE/LNK (lento)" #: tfrmoptionsicons.rbiconsshownone.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION" msgid "&No icons" msgstr "Sem íco&nes" #: tfrmoptionsicons.rbiconsshowstandard.caption msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION" msgid "Only &standard icons" msgstr "Só ícone&s padrão" #: tfrmoptionsignorelist.btnaddsel.caption msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION" msgid "A&dd selected names" msgstr "A&dicionar nomes seleccionados" #: tfrmoptionsignorelist.btnaddselwithpath.caption msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION" msgid "Add selected names with &full path" msgstr "Adicionar n&omes seleccionados com caminho completo" #: tfrmoptionsignorelist.btnrelativesavein.hint msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint" msgid "Some functions to select appropriate path" msgstr "Algumas funções para escolher o caminho apropriado" #: tfrmoptionsignorelist.chkignoreenable.caption msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION" msgid "&Ignore (don't show) the following files and folders:" msgstr "&Ignorar (não mostrar) os ficheiros e pastas seguintes:" #: tfrmoptionsignorelist.lblsavein.caption msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION" msgid "&Save in:" msgstr "&Gravar em:" #: tfrmoptionskeyboard.cblynxlike.caption msgid "Le&ft, Right arrows change directory (Lynx-like movement)" msgstr "Setas es&querda e direita mudam a pasta (movimento tipo Lynx)" #: tfrmoptionskeyboard.gbtyping.caption msgid "Typing" msgstr "Dactilografia" #: tfrmoptionskeyboard.lblalt.caption msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION" msgid "Alt+L&etters:" msgstr "Alt+L&etras:" #: tfrmoptionskeyboard.lblctrlalt.caption msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION" msgid "Ctrl+Alt+Le&tters:" msgstr "Ctrl+Alt+Le&tras:" #: tfrmoptionskeyboard.lblnomodifier.caption msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION" msgid "&Letters:" msgstr "&Letras:" #: tfrmoptionslayout.cbflatdiskpanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION" msgid "&Flat buttons" msgstr "Botões p&lanos" #: tfrmoptionslayout.cbflatinterface.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION" msgid "Flat i&nterface" msgstr "Ambiente pla&no" #: tfrmoptionslayout.cbflattoolbar.caption msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION" msgid "Flat b&uttons" msgstr "B&otões planos" #: tfrmoptionslayout.cbfreespaceind.caption msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION" msgid "Show fr&ee space indicator on drive label" msgstr "Mostrar &espaço livre no rótulo da unidade" #: tfrmoptionslayout.cblogwindow.caption msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION" msgid "Show lo&g window" msgstr "Mostrar &janela de diário" #: tfrmoptionslayout.cbpanelofoperations.caption msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION" msgid "Show panel of operation in background" msgstr "Mostrar painel de operações em 2º plano" #: tfrmoptionslayout.cbproginmenubar.caption msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION" msgid "Show common progress in menu bar" msgstr "Mostrar progresso comum na barra de menu" #: tfrmoptionslayout.cbshowcmdline.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION" msgid "Show command l&ine" msgstr "Mostrar l&inha de comandos" #: tfrmoptionslayout.cbshowcurdir.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION" msgid "Show current director&y" msgstr "Mostrar pasta act&ual" #: tfrmoptionslayout.cbshowdiskpanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION" msgid "Show &drive buttons" msgstr "Mostrar botões de uni&dade" #: tfrmoptionslayout.cbshowdrivefreespace.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION" msgid "Show free s&pace label" msgstr "Mostrar rótulo de es&paço livre" #: tfrmoptionslayout.cbshowdriveslistbutton.caption msgid "Show drives list bu&tton" msgstr "Mostrar bo&tão da lista de unidades" #: tfrmoptionslayout.cbshowkeyspanel.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION" msgid "Show function &key buttons" msgstr "Mostrar botões de teclas de função" #: tfrmoptionslayout.cbshowmainmenu.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION" msgid "Show &main menu" msgstr "Mostrar &menu principal" #: tfrmoptionslayout.cbshowmaintoolbar.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION" msgid "Show tool&bar" msgstr "Mostrar &barra de ferramentas" #: tfrmoptionslayout.cbshowshortdrivefreespace.caption msgid "Show short free space &label" msgstr "Mostrar rótulo curto de espaço &livre" #: tfrmoptionslayout.cbshowstatusbar.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION" msgid "Show &status bar" msgstr "Mostrar barra de e&stado" #: tfrmoptionslayout.cbshowtabheader.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION" msgid "S&how tabstop header" msgstr "Mostrar cabeçalho de tabulação" #: tfrmoptionslayout.cbshowtabs.caption msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION" msgid "Sho&w folder tabs" msgstr "M&ostrar separadores de pasta" #: tfrmoptionslayout.cbtermwindow.caption msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION" msgid "Show te&rminal window" msgstr "Mostrar janela de te&rminal" #: tfrmoptionslayout.cbtwodiskpanels.caption msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION" msgid "Show two drive button bars (fi&xed width, above file windows)" msgstr "Mostrar duas barras de botões de unidade (largura fi&xa, acima das janelas de ficheiros)" #: tfrmoptionslayout.gbscreenlayout.caption msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION" msgid " Screen layout " msgstr "Disposição do ecrã" #: tfrmoptionslog.btnrelativelogfile.hint msgctxt "tfrmoptionslog.btnrelativelogfile.hint" msgid "Some functions to select appropriate path" msgstr "Algumas funções para escolher o caminho apropriado" #: tfrmoptionslog.btnviewlogfile.hint msgctxt "tfrmoptionslog.btnviewlogfile.hint" msgid "View log file content" msgstr "Ver conteúdo do diário" #: tfrmoptionslog.cbincludedateinlogfilename.caption msgid "Include date in log filename" msgstr "Incluir data no nome do diário" #: tfrmoptionslog.cblogarcop.caption msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION" msgid "&Pack/Unpack" msgstr "Com&primir/Descomprimir" #: tfrmoptionslog.cblogcommandlineexecution.caption msgid "External command line execution" msgstr "Execução externa da linha de comandos" #: tfrmoptionslog.cblogcpmvln.caption msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION" msgid "Cop&y/Move/Create link/symlink" msgstr "Cop&iar/Mover/Criar ligação/Ligação simbólica" #: tfrmoptionslog.cblogdelete.caption msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION" msgid "&Delete" msgstr "&Eliminar" #: tfrmoptionslog.cblogdirop.caption msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION" msgid "Crea&te/Delete directories" msgstr "Criar/Eliminar pas&tas" #: tfrmoptionslog.cblogerrors.caption msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION" msgid "Log &errors" msgstr "Diário de &erros" #: tfrmoptionslog.cblogfile.caption msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION" msgid "C&reate a log file:" msgstr "C&riar um ficheiro de diário:" #: tfrmoptionslog.cbloginfo.caption msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION" msgid "Log &information messages" msgstr "Diário de mensagens &informativas" #: tfrmoptionslog.cblogstartshutdown.caption msgid "Start/shutdown" msgstr "Iniciar/Encerrar" #: tfrmoptionslog.cblogsuccess.caption msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION" msgid "Log &successful operations" msgstr "Registar operações com &sucesso" #: tfrmoptionslog.cblogvfs.caption msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION" msgid "&File system plugins" msgstr "Extensões do sistema de &ficheiros" #: tfrmoptionslog.gblogfile.caption msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION" msgid "File operation log file" msgstr "Diário de operações de ficheiros" #: tfrmoptionslog.gblogfileop.caption msgid "Log operations" msgstr "Registar operações" #: tfrmoptionslog.gblogfilestatus.caption msgid "Operation status" msgstr "Estado da operação" #: tfrmoptionsmisc.btnoutputpathfortoolbar.caption msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption" msgid ">>" msgstr ">>" #: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint" msgid "Some functions to select appropriate path" msgstr "Algumas funções para escolher o caminho apropriado" #: tfrmoptionsmisc.btnrelativetcconfigfile.hint msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint" msgid "Some functions to select appropriate path" msgstr "Algumas funções para escolher o caminho apropriado" #: tfrmoptionsmisc.btnrelativetcexecutablefile.hint msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint" msgid "Some functions to select appropriate path" msgstr "Algumas funções para escolher o caminho apropriado" #: tfrmoptionsmisc.btnthumbcompactcache.caption msgid "&Remove thumbnails for no longer existing files" msgstr "&Remover miniaturas de ficheiros que já não existem" #: tfrmoptionsmisc.btnviewconfigfile.hint msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint" msgid "View log file content" msgstr "Ver conteúdo do diário" #: tfrmoptionsmisc.chkdesccreateunicode.caption msgid "Create new with the encoding:" msgstr "Criar novo com codificação:" #: tfrmoptionsmisc.chkgotoroot.caption msgid "Always &go to the root of a drive when changing drives" msgstr "Ir sempre para a rai&z da unidade ao mudar de unidades" #: tfrmoptionsmisc.chkshowwarningmessages.caption msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION" msgid "Show &warning messages (\"OK\" button only)" msgstr "Mostrar mensagens de a&viso (só botão \"Aceitar\")" #: tfrmoptionsmisc.chkthumbsave.caption msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION" msgid "&Save thumbnails in cache" msgstr "&Gravar miniaturas em memória" #: tfrmoptionsmisc.dblthumbnails.caption msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION" msgid "Thumbnails" msgstr "Miniaturas" #: tfrmoptionsmisc.gbfilecomments.caption msgid "File comments (descript.ion)" msgstr "Comentários (descript.ion)" #: tfrmoptionsmisc.gbtcexportimport.caption msgid "Regarding TC export/import:" msgstr "De exportação/importação TC:" #: tfrmoptionsmisc.lbldescrdefaultencoding.caption msgid "Default encoding:" msgstr "Codificação predefinida:" #: tfrmoptionsmisc.lbltcconfig.caption msgid "Configuration file:" msgstr "Ficheiro de configuração:" #: tfrmoptionsmisc.lbltcexecutable.caption msgid "TC executable:" msgstr "Executável TC:" #: tfrmoptionsmisc.lbltcpathfortool.caption msgid "Toolbar output path:" msgstr "Caminho de saída da barra:" #: tfrmoptionsmisc.lblthumbpixels.caption msgid "pixels" msgstr "pixels" #: tfrmoptionsmisc.lblthumbseparator.caption msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION" msgid "X" msgstr "X" #: tfrmoptionsmisc.lblthumbsize.caption msgid "&Thumbnail size:" msgstr "&Tamanho da miniatura:" #: tfrmoptionsmouse.cbselectionbymouse.caption msgid "&Selection by mouse" msgstr "&Selecção com o rato" #: tfrmoptionsmouse.chkmouseselectioniconclick.caption msgid "By clic&king on icon" msgstr "" #: tfrmoptionsmouse.gbscrolling.caption msgid "Scrolling" msgstr "Rolar" #: tfrmoptionsmouse.gbselection.caption msgid "Selection" msgstr "Selecção" #: tfrmoptionsmouse.lblmousemode.caption msgid "&Mode:" msgstr "&Modo:" #: tfrmoptionsmouse.rbscrolllinebyline.caption msgid "&Line by line" msgstr "&Linha a linha" #: tfrmoptionsmouse.rbscrolllinebylinecursor.caption msgid "Line by line &with cursor movement" msgstr "Linha a linha com mo&vimento do cursor" #: tfrmoptionsmouse.rbscrollpagebypage.caption msgid "&Page by page" msgstr "&Página a página" #: tfrmoptionsplugins.btnaddplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION" msgid "A&dd" msgstr "A&dicionar" #: tfrmoptionsplugins.btnconfigplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION" msgid "Con&figure" msgstr "Con&figurar" #: tfrmoptionsplugins.btnenableplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION" msgid "E&nable" msgstr "Ac&tivar" #: tfrmoptionsplugins.btnremoveplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION" msgid "&Remove" msgstr "&Remover" #: tfrmoptionsplugins.btntweakplugin.caption msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION" msgid "&Tweak" msgstr "A&finar" #: tfrmoptionsplugins.lbldsxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION" msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)" msgstr "E&xtensões de procura permitem usar algoritmos alternativos ou ferramentas externas (como \"locate\", etc.)" #: tfrmoptionsplugins.lblwcxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION" msgid "Pack&er plugins are used to work with archives" msgstr "&Extensões de compressão são usadas para trabalhar com arquivos" #: tfrmoptionsplugins.lblwdxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION" msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool" msgstr "Extensões de conteúdo permitem mostrar detalhes do ficheiro, como etiquetas mp3 ou atributos de imagens na lista de ficheiros ou usá-los nas ferramentas Procura e Multi-renomear" #: tfrmoptionsplugins.lblwfxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION" msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC." msgstr "Extensões do sistema de ficheiros permitem gerir unidades inacessíveis pelo sistema operativo ou a dispositivos externos como o Palm/PocketPC." #: tfrmoptionsplugins.lblwlxdescription.caption msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION" msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)" msgstr "Extensões de &visualização permitem mostrar formatos de ficheiros como imagens, folhas de cálculo, bases de dados, etc. no visualizador (F3, Ctrl+Q)" #: tfrmoptionsplugins.stgplugins.columns[0].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION" msgid "Active" msgstr "Activo" #: tfrmoptionsplugins.stgplugins.columns[1].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION" msgid "Plugin" msgstr "Extensão" #: tfrmoptionsplugins.stgplugins.columns[2].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION" msgid "Registered for" msgstr "Registado para" #: tfrmoptionsplugins.stgplugins.columns[3].title.caption msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION" msgid "File name" msgstr "Nome de ficheiro" #: tfrmoptionsplugins.tsdsx.caption msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION" msgid "&Search plugins (.DSX)" msgstr "Extensõe&s de procura (.DSX)" #: tfrmoptionsplugins.tswcx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION" msgid "Pac&ker plugins (.WCX)" msgstr "Extensões de &compressão (.WCX)" #: tfrmoptionsplugins.tswdx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION" msgid "Content pl&ugins (.WDX)" msgstr "Extensões de c&onteúdo (.WDX)" #: tfrmoptionsplugins.tswfx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION" msgid "F&ile system plugins (.WFX)" msgstr "Extensões do s&istema de ficheiros (.WFX)" #: tfrmoptionsplugins.tswlx.caption msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION" msgid "&Viewer plugins (.WLX)" msgstr "Extensões de &visualização (.WLX)" #: tfrmoptionsquicksearchfilter.cbexactbeginning.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION" msgid "&Beginning (name must start with first typed character)" msgstr "&Iniciar (o nome tem de começar com o primeiro carácter digitado)" #: tfrmoptionsquicksearchfilter.cbexactending.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION" msgid "En&ding (last character before a typed dot . must match)" msgstr "&Finalizar (o último carácter antes do ponto tem de coincidir)" #: tfrmoptionsquicksearchfilter.cgpoptions.caption msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION" msgid "Options" msgstr "Opções" #: tfrmoptionsquicksearchfilter.gbexactnamematch.caption msgid "Exact name match" msgstr "Correspondência exacta do nome" #: tfrmoptionsquicksearchfilter.rgpsearchcase.caption msgid "Search case" msgstr "Sensível a maiúsculas" #: tfrmoptionsquicksearchfilter.rgpsearchitems.caption msgid "Search for these items" msgstr "Procurar por estes itens" #: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption msgid "Keep renamed name when unlocking a tab" msgstr "Manter novo nome ao desbloquear separador" #: tfrmoptionstabs.cbtabsactivateonclick.caption msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION" msgid "Activate target &panel when clicking on one of its Tabs" msgstr "Activar &painel destino ao clicar num dos seus separadores" #: tfrmoptionstabs.cbtabsalwaysvisible.caption msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION" msgid "&Show tab header also when there is only one tab" msgstr "Mo&strar cabeçalho do separador mesmo que só haja um" #: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption msgid "Close duplicate tabs when closing application" msgstr "Fechar separadores duplicados ao sair do programa" #: tfrmoptionstabs.cbtabsconfirmcloseall.caption msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION" msgid "Con&firm close all tabs" msgstr "Con&firmar fecho de todos os separadores" #: tfrmoptionstabs.cbtabsconfirmcloselocked.caption msgid "Confirm close locked tabs" msgstr "Con&firmar fecho de separadores bloqueados" #: tfrmoptionstabs.cbtabslimitoption.caption msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION" msgid "&Limit tab title length to" msgstr "&Limitar comprimento do nome do separador a " #: tfrmoptionstabs.cbtabslockedasterisk.caption msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION" msgid "Show locked tabs &with an asterisk *" msgstr "Mostrar separadores blo&queados com um asterisco *" #: tfrmoptionstabs.cbtabsmultilines.caption msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION" msgid "&Tabs on multiple lines" msgstr "Separadores em múl&tiplas linhas" #: tfrmoptionstabs.cbtabsopenforeground.caption msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION" msgid "Ctrl+&Up opens new tab in foreground" msgstr "Ctrl+&Acima abre o novo separador em 1º plano" #: tfrmoptionstabs.cbtabsopennearcurrent.caption msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION" msgid "Open &new tabs near current tab" msgstr "Abrir &novos separadores ao lado do separador actual" #: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption msgid "Reuse existing tab when possible" msgstr "Reutilizar separador existente" #: tfrmoptionstabs.cbtabsshowclosebutton.caption msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION" msgid "Show ta&b close button" msgstr "Mostrar &botão de fecho do separador" #: tfrmoptionstabs.cbtabsshowdriveletter.caption msgid "Always show drive letter in tab title" msgstr "Mostrar sempre letra da unidade no título" #: tfrmoptionstabs.gbtabs.caption msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION" msgid "Folder tabs headers" msgstr "Cabeçalhos dos separadores de pastas" #: tfrmoptionstabs.lblchar.caption msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION" msgid "characters" msgstr "caracteres" #: tfrmoptionstabs.lbltabsactionondoubleclick.caption msgid "Action to do when double click on a tab:" msgstr "Acção do duplo clique num separador:" #: tfrmoptionstabs.lbltabsposition.caption msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION" msgid "Ta&bs position" msgstr "Posição dos s&eparadores" #: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text" msgid "None" msgstr "Nada" #: tfrmoptionstabsextra.cbdefaultsavedirhistory.text msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text" msgid "No" msgstr "Não" #: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text" msgid "Left" msgstr "Esquerda" #: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text" msgid "Right" msgstr "Direita" #: tfrmoptionstabsextra.cbgotoconfigafterresave.caption msgid "Goto to Favorite Tabs Configuration after resaving" msgstr "Abrir configuração de separadores favorita após gravar" #: tfrmoptionstabsextra.cbgotoconfigaftersave.caption msgid "Goto to Favorite Tabs Configuration after saving a new one" msgstr "Abrir configuração de separadores favorita após gravar uma nova" #: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)" msgstr "Activar opções extra nos separadores favoritos (escolher lado ao restaurar, etc.)" #: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption msgid "Default extra settings when saving new Favorite Tabs:" msgstr "Definições extra predefinidas ao gravar novos favoritos:" #: tfrmoptionstabsextra.gbtabs.caption msgid "Folder tabs headers extra" msgstr "Pasta de separadores" #: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption msgid "When restoring tab, existing tabs to keep:" msgstr "Ao restaurar, separadores existentes a manter:" #: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption msgid "Tabs saved on left will be restored to:" msgstr "Separadores gravados à esquerda restauram-se para:" #: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption msgid "Tabs saved on right will be restored to:" msgstr "Separadores gravados à direita restauram-se para:" #: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption" msgid "Keep saving dir history with Favorite Tabs:" msgstr "Manter histórico de pastas com separadores favoritos:" #: tfrmoptionstabsextra.rgwheretoadd.caption msgid "Default position in menu when saving a new Favorite Tabs:" msgstr "Posição no menu ao gravar novos separadores favoritos:" #: tfrmoptionsterminal.edrunintermcloseparams.hint msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{comando} deveria estar aqui presente para reflectir o comando a executar no terminal" #: tfrmoptionsterminal.edrunintermstayopenparams.hint msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{comando} deveria estar aqui presente para reflectir o comando a executar no terminal" #: tfrmoptionsterminal.edruntermparams.hint msgctxt "tfrmoptionsterminal.edruntermparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "{comando} deveria estar aqui presente para reflectir o comando a executar no terminal" #: tfrmoptionsterminal.gbjustrunterminal.caption msgid "Command for just running terminal:" msgstr "Comando para executar no terminal:" #: tfrmoptionsterminal.gbruninterminalclose.caption msgid "Command for running a command in terminal and close after:" msgstr "Comando para executar um comando no terminal e fechar a seguir:" #: tfrmoptionsterminal.gbruninterminalstayopen.caption msgid "Command for running a command in terminal and stay open:" msgstr "Comando para executar um comando no terminal e ficar aberto:" #: tfrmoptionsterminal.lbrunintermclosecmd.caption msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption" msgid "Command:" msgstr "Comando:" #: tfrmoptionsterminal.lbrunintermcloseparams.caption msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption" msgid "Parameters:" msgstr "Parâmetros:" #: tfrmoptionsterminal.lbrunintermstayopencmd.caption msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption" msgid "Command:" msgstr "Comando:" #: tfrmoptionsterminal.lbrunintermstayopenparams.caption msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption" msgid "Parameters:" msgstr "Parâmetros:" #: tfrmoptionsterminal.lbruntermcmd.caption msgctxt "tfrmoptionsterminal.lbruntermcmd.caption" msgid "Command:" msgstr "Comando:" #: tfrmoptionsterminal.lbruntermparams.caption msgctxt "tfrmoptionsterminal.lbruntermparams.caption" msgid "Parameters:" msgstr "Parâmetros:" #: tfrmoptionstoolbar.btnclonebutton.caption msgid "C&lone button" msgstr "C&lonar botão" #: tfrmoptionstoolbar.btndeletebutton.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION" msgid "&Delete" msgstr "&Eliminar" #: tfrmoptionstoolbar.btnedithotkey.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION" msgid "Edit hot&key" msgstr "Editar atal&ho" #: tfrmoptionstoolbar.btninsertbutton.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION" msgid "&Insert new button" msgstr "&Inserir novo botão" #: tfrmoptionstoolbar.btnopencmddlg.caption msgid "Select" msgstr "Seleccionar" #: tfrmoptionstoolbar.btnopenfile.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstoolbar.btnother.caption msgctxt "tfrmoptionstoolbar.btnother.caption" msgid "Other..." msgstr "Outro..." #: tfrmoptionstoolbar.btnremovehotkey.caption msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION" msgid "Remove hotke&y" msgstr "Remo&ver atalho" #: tfrmoptionstoolbar.btnstartpath.caption msgctxt "tfrmoptionstoolbar.btnstartpath.caption" msgid ">>" msgstr ">>" #: tfrmoptionstoolbar.btnsuggestiontooltip.caption msgid "Suggest" msgstr "Sugerir" #: tfrmoptionstoolbar.btnsuggestiontooltip.hint msgid "Have DC suggest the tooltip based on button type, command and parameters" msgstr "Deixar o DC sugerir a dica baseado no tipo de botão, comando e parâmetros" #: tfrmoptionstoolbar.cbflatbuttons.caption msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption" msgid "&Flat buttons" msgstr "Botões p&lanos" #: tfrmoptionstoolbar.cbreporterrorwithcommands.caption msgid "Report errors with commands" msgstr "Reportar erros com comandos" #: tfrmoptionstoolbar.edtinternalparameters.hint msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters." msgstr "Inserir parâmetros de comandos, cada um em sua linha. Prima F1 para ajuda dos parâmetros" #: tfrmoptionstoolbar.gbgroupbox.caption msgid "Appearance" msgstr "Aparência" #: tfrmoptionstoolbar.lblbarsize.caption msgid "&Bar size:" msgstr "Tamanho da &barra:" #: tfrmoptionstoolbar.lblexternalcommand.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION" msgid "Comman&d:" msgstr "Coman&do:" #: tfrmoptionstoolbar.lblexternalparameters.caption msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION" msgid "Parameter&s:" msgstr "Parâmetro&s:" #: tfrmoptionstoolbar.lblhelponinternalcommand.caption msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption" msgid "Help" msgstr "Ajuda" #: tfrmoptionstoolbar.lblhotkey.caption msgid "Hot key:" msgstr "Atalho:" #: tfrmoptionstoolbar.lbliconfile.caption msgid "Ico&n:" msgstr "Íco&ne" #: tfrmoptionstoolbar.lbliconsize.caption msgid "Icon si&ze:" msgstr "Tamanho do í&cone:" #: tfrmoptionstoolbar.lblinternalcommand.caption msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption" msgid "Co&mmand:" msgstr "Co&mando:" #: tfrmoptionstoolbar.lblinternalparameters.caption msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption" msgid "&Parameters:" msgstr "&Parâmetros:" #: tfrmoptionstoolbar.lblstartpath.caption msgctxt "tfrmoptionstoolbar.lblstartpath.caption" msgid "Start pat&h:" msgstr "Camin&ho inicial:" #: tfrmoptionstoolbar.lbltooltip.caption msgid "&Tooltip:" msgstr "Su&gestão:" #: tfrmoptionstoolbar.miaddallcmds.caption msgid "Add toolbar with ALL DC commands" msgstr "Adicionar barra com TODOS os comandos" #: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption msgid "for an external command" msgstr "para um comando externo" #: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption msgid "for an internal command" msgstr "para um comando interno" #: tfrmoptionstoolbar.miaddseparatorsubmenu.caption msgid "for a separator" msgstr "para um separador" #: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption msgid "for a sub-tool bar" msgstr "para uma sub-barra" #: tfrmoptionstoolbar.mibackup.caption msgctxt "tfrmoptionstoolbar.mibackup.caption" msgid "Backup..." msgstr "Seguranças..." #: tfrmoptionstoolbar.miexport.caption msgctxt "tfrmoptionstoolbar.miexport.caption" msgid "Export..." msgstr "Exportar..." #: tfrmoptionstoolbar.miexportcurrent.caption msgid "Current toolbar..." msgstr "Barra actual..." #: tfrmoptionstoolbar.miexportcurrenttodcbar.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption" msgid "to a Toolbar File (.toolbar)" msgstr "para um ficheiro de barra (.toolbar)" #: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption" msgid "to a TC .BAR file (keep existing)" msgstr "para um ficheiro .BAR do TC (manter existente)" #: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption" msgid "to a TC .BAR file (erase existing)" msgstr "para um ficheiro .BAR do TC (eliminar existente)" #: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "para um \"wincmd.ini\" do TC (manter existente)" #: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "para um \"wincmd.ini\" do TC (eliminar existente)" #: tfrmoptionstoolbar.miexportseparator1.caption msgctxt "tfrmoptionstoolbar.miexportseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator2.caption msgctxt "tfrmoptionstoolbar.miexportseparator2.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator3.caption msgctxt "tfrmoptionstoolbar.miexportseparator3.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator4.caption msgctxt "tfrmoptionstoolbar.miexportseparator4.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexporttop.caption msgid "Top toolbar..." msgstr "Barra de topo..." #: tfrmoptionstoolbar.miexporttoptobackup.caption msgid "Save a backup of Toolbar" msgstr "Gravar segurança da barra" #: tfrmoptionstoolbar.miexporttoptodcbar.caption msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption" msgid "to a Toolbar File (.toolbar)" msgstr "para um ficheiro de barra (.toolbar)" #: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption" msgid "to a TC .BAR file (keep existing)" msgstr "para um ficheiro .BAR do TC (manter existente)" #: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption" msgid "to a TC .BAR file (erase existing)" msgstr "para um ficheiro .BAR do TC (eliminar existente)" #: tfrmoptionstoolbar.miexporttoptotcinikeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "para um \"wincmd.ini\" do TC (manter existente)" #: tfrmoptionstoolbar.miexporttoptotcininokeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "para um \"wincmd.ini\" do TC (eliminar existente)" #: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption" msgid "just after current selection" msgstr "logo após a selecção actual" #: tfrmoptionstoolbar.miexternalcommandfirstelement.caption msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption" msgid "as first element" msgstr "como 1º elemento" #: tfrmoptionstoolbar.miexternalcommandlastelement.caption msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption" msgid "as last element" msgstr "como último elemento" #: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption" msgid "just prior current selection" msgstr "logo antes da selecção actual" #: tfrmoptionstoolbar.miimport.caption msgctxt "tfrmoptionstoolbar.miimport.caption" msgid "Import..." msgstr "Importar..." #: tfrmoptionstoolbar.miimportbackup.caption msgid "Restore a backup of Toolbar" msgstr "Restaurar uma segurança da barra" #: tfrmoptionstoolbar.miimportbackupaddcurrent.caption msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption" msgid "to add to current toolbar" msgstr "para adicionar à barra actual" #: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "para adicionar a uma nova barra da barra actual" #: tfrmoptionstoolbar.miimportbackupaddmenutop.caption msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "para adicionar a uma nova barra da barra de topo" #: tfrmoptionstoolbar.miimportbackupaddtop.caption msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption" msgid "to add to top toolbar" msgstr "para adicionar à barra de topo" #: tfrmoptionstoolbar.miimportbackupreplacetop.caption msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption" msgid "to replace top toolbar" msgstr "para substituir a barra de topo" #: tfrmoptionstoolbar.miimportdcbar.caption msgid "from a Toolbar File (.toolbar)" msgstr "de um ficheiro de barra (.toolbar)" #: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption" msgid "to add to current toolbar" msgstr "para adicionar à barra actual" #: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "para adicionar a uma nova barra da barra actual" #: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "para adicionar a uma nova barra da barra de topo" #: tfrmoptionstoolbar.miimportdcbaraddtop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption" msgid "to add to top toolbar" msgstr "para adicionar à barra de topo" #: tfrmoptionstoolbar.miimportdcbarreplacetop.caption msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption" msgid "to replace top toolbar" msgstr "para substituir a barra de topo" #: tfrmoptionstoolbar.miimportseparator.caption msgctxt "tfrmoptionstoolbar.miimportseparator.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miimporttcbar.caption msgid "from a single TC .BAR file" msgstr "de um ficheiro TC .BAR único" #: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption" msgid "to add to current toolbar" msgstr "para adicionar à barra actual" #: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "para adicionar a uma nova barra da barra actual" #: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "para adicionar a uma nova barra da barra de topo" #: tfrmoptionstoolbar.miimporttcbaraddtop.caption msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption" msgid "to add to top toolbar" msgstr "para adicionar à barra de topo" #: tfrmoptionstoolbar.miimporttcbarreplacetop.caption msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption" msgid "to replace top toolbar" msgstr "para substituir a barra de topo" #: tfrmoptionstoolbar.miimporttcini.caption msgid "from \"wincmd.ini\" of TC..." msgstr "de \"wincmd.ini\" do TC..." #: tfrmoptionstoolbar.miimporttciniaddcurrent.caption msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption" msgid "to add to current toolbar" msgstr "para adicionar à barra actual" #: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "para adicionar a uma nova barra da barra actual" #: tfrmoptionstoolbar.miimporttciniaddmenutop.caption msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "para adicionar a uma nova barra da barra de topo" #: tfrmoptionstoolbar.miimporttciniaddtop.caption msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption" msgid "to add to top toolbar" msgstr "para adicionar à barra de topo" #: tfrmoptionstoolbar.miimporttcinireplacetop.caption msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption" msgid "to replace top toolbar" msgstr "para substituir a barra de topo" #: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption" msgid "just after current selection" msgstr "logo após a selecção actual" #: tfrmoptionstoolbar.miinternalcommandfirstelement.caption msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption" msgid "as first element" msgstr "como 1º elemento" #: tfrmoptionstoolbar.miinternalcommandlastelement.caption msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption" msgid "as last element" msgstr "como último elemento" #: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption" msgid "just prior current selection" msgstr "logo antes da selecção actual" #: tfrmoptionstoolbar.misearchandreplace.caption msgctxt "tfrmoptionstoolbar.misearchandreplace.caption" msgid "Search and replace..." msgstr "Procurar e substituir..." #: tfrmoptionstoolbar.miseparator1.caption msgctxt "tfrmoptionstoolbar.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator10.caption msgctxt "tfrmoptionstoolbar.miseparator10.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator11.caption msgctxt "tfrmoptionstoolbar.miseparator11.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator13.caption msgctxt "tfrmoptionstoolbar.miseparator13.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator14.caption msgctxt "tfrmoptionstoolbar.miseparator14.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator2.caption msgctxt "tfrmoptionstoolbar.miseparator2.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator6.caption msgctxt "tfrmoptionstoolbar.miseparator6.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator7.caption msgctxt "tfrmoptionstoolbar.miseparator7.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator8.caption msgctxt "tfrmoptionstoolbar.miseparator8.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator9.caption msgctxt "tfrmoptionstoolbar.miseparator9.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparatoraftercurrent.caption msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption" msgid "just after current selection" msgstr "logo após a selecção actual" #: tfrmoptionstoolbar.miseparatorfirstitem.caption msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption" msgid "as first element" msgstr "como 1º elemento" #: tfrmoptionstoolbar.miseparatorlastelement.caption msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption" msgid "as last element" msgstr "como último elemento" #: tfrmoptionstoolbar.miseparatorpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption" msgid "just prior current selection" msgstr "logo antes da selecção actual" #: tfrmoptionstoolbar.misrcrplallofall.caption msgid "in all of all the above..." msgstr "em todos dos acima..." #: tfrmoptionstoolbar.misrcrplclickseparator.caption msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.misrcrplcommands.caption msgid "in all commands..." msgstr "em todos os comandos..." #: tfrmoptionstoolbar.misrcrpliconnames.caption msgid "in all icon names..." msgstr "em todos os nomes de ícones..." #: tfrmoptionstoolbar.misrcrplparameters.caption msgid "in all parameters..." msgstr "em odos os parâmetros..." #: tfrmoptionstoolbar.misrcrplstartpath.caption msgid "in all start path..." msgstr "em todos os caminhos iniciais..." #: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption" msgid "just after current selection" msgstr "logo após a selecção actual" #: tfrmoptionstoolbar.misubtoolbarfirstelement.caption msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption" msgid "as first element" msgstr "como 1º elemento" #: tfrmoptionstoolbar.misubtoolbarlastelement.caption msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption" msgid "as last element" msgstr "como último elemento" #: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption" msgid "just prior current selection" msgstr "logo antes da selecção actual" #: tfrmoptionstoolbar.rgtoolitemtype.caption msgid "Button type" msgstr "Tipo de botão" #: tfrmoptionstoolbase.btnrelativetoolpath.hint msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint" msgid "Some functions to select appropriate path" msgstr "Algumas funções para escolher o caminho apropriado" #: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption msgid "&Keep terminal window open after executing program" msgstr "Manter a janela do terminal aberta após executar o programa" #: tfrmoptionstoolbase.cbtoolsruninterminal.caption msgid "&Execute in terminal" msgstr "&Executar no terminal" #: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption msgid "&Use external program" msgstr "&Usar programa externo" #: tfrmoptionstoolbase.lbltoolsparameters.caption msgid "A&dditional parameters" msgstr "Parâmetros a&dicionais" #: tfrmoptionstoolbase.lbltoolspath.caption msgid "&Path to program to execute" msgstr "Caminho do &programa a executar" #: tfrmoptionstooltips.btnaddfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION" msgid "A&dd" msgstr "A&dicionar" #: tfrmoptionstooltips.btnapplyfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION" msgid "A&pply" msgstr "A&plicar" #: tfrmoptionstooltips.btndeletefields.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION" msgid "D&elete" msgstr "&Eliminar" #: tfrmoptionstooltips.btnfieldslist.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstooltips.btnfieldssearchtemplate.hint msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT" msgid "Template..." msgstr "Modelo..." #: tfrmoptionstooltips.chkshowtooltip.caption msgctxt "tfrmoptionstooltips.chkshowtooltip.caption" msgid "&Show tooltip for files in the file panel" msgstr "Mostrar sugestão para ficheiros no painel" #: tfrmoptionstooltips.gbcustomfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION" msgid "Custom fields by file type" msgstr "Campos personalizados por tipo de ficheiro" #: tfrmoptionstooltips.lblfieldslist.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION" msgid "Category &hint:" msgstr "Dica da cate&goria:" #: tfrmoptionstooltips.lblfieldsmask.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION" msgid "Category &mask:" msgstr "&Máscara da categoria:" #: tfrmoptionstooltips.lblfieldsname.caption msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION" msgid "Category &name:" msgstr "&Nome da categoria:" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption msgid "With double-click on the bar on top of a file panel" msgstr "Com duplo clique na barra ao cimo do painel de ficheiros" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption" msgid "With the menu and internal command" msgstr "Com o menu e comando interno" #: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption msgid "Double click in tree select and exit" msgstr "Duplo clique na árvore selecciona e sai" #: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption" msgid "With the menu and internal command" msgstr "Com o menu e comando interno" #: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption msgid "With double-click on a tab (if configured for it)" msgstr "Com duplo clique num separador (se configurado para tal)" #: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption msgid "When using the keyboard shortcut, it will exit the window returning the current choice" msgstr "Ao usar o atalho de teclado, sai da janela devolvendo a escolha actual" #: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption msgid "Single mouse click in tree select and exit" msgstr "Clique único na árvore selecciona e sai" #: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption msgid "Use it for Command Line History" msgstr "Usar para histórico da linha de comandos" #: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption msgid "Use it for the Dir History" msgstr "Usar para histórico de Dir" #: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption msgid "Use it for the View History (Visited paths for active view)" msgstr "Usar para histórico de vistas (caminhos visitados na vista actual)" #: tfrmoptionstreeviewmenu.gbbehavior.caption msgid "Behavior regarding selection:" msgstr "Comportamento relativo à selecção:" #: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption msgid "Tree View Menus related options:" msgstr "Opções relativas a menus da árvore:" #: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption msgid "Where to use Tree View Menus:" msgstr "Onde usar menus da árvore:" #: tfrmoptionstreeviewmenu.lblnote.caption msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another." msgstr "*NOTA: em relação a opções como a sensibilidade a maiúsculas, ignorar ou não os acentos, estas são gravadas e restauradas individualmente para cada contexto de uma utilização e sessão para outra." #: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption msgid "With Directory Hotlist:" msgstr "Com a lista de pastas quentes:" #: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption msgid "With Favorite Tabs:" msgstr "Com separadores favoritos:" #: tfrmoptionstreeviewmenu.lblusewithhistory.caption msgid "With History:" msgstr "Com histórico:" #: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btncursorcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption msgid "Use and display keyboard shortcut for choosing items" msgstr "Usar e mostrar atalho de teclado para escolher itens" #: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption msgid "Layout and colors options:" msgstr "Opções de disposição e cores:" #: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption msgid "Background color:" msgstr "Cor de fundo:" #: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption msgid "Cursor color:" msgstr "Cor do cursor:" #: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption msgid "Found text color:" msgstr "Cor do texto encontrado:" #: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption msgid "Found text under cursor:" msgstr "Texto encontrado sob o cursor:" #: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption msgid "Normal text color:" msgstr "Cor do texto normal:" #: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption msgid "Normal text under cursor:" msgstr "Texto normal sob o cursor:" #: tfrmoptionstreeviewmenucolor.lblpreview.caption msgid "Tree View Menu Preview:" msgstr "Antevisão do menu da árvore:" #: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption msgid "Secondary text color:" msgstr "Cor de texto secundário:" #: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption msgid "Secondary text under cursor:" msgstr "Texto secundário sob o cursor:" #: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption msgid "Shortcut color:" msgstr "Cor do atalho:" #: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption msgid "Shortcut under cursor:" msgstr "Atalho sob o cursor:" #: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption msgid "Unselectable text color:" msgstr "Cor de texto não seleccionável:" #: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption msgid "Unselectable under cursor:" msgstr "Texto não seleccionável sob o cursor:" #: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample." msgstr "Altere uma cor à esquerda e verá uma antevisão dos menus de árvore neste exemplo." #: tfrmoptionsviewer.btnbackviewercolor.caption msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsviewer.btnfontviewercolor.caption msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionsviewer.gbviewerbookmode.caption msgid "Viewer Book Mode" msgstr "Modo Livro de visualização" #: tfrmoptionsviewer.gbviewerexample.caption msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION" msgid "Example" msgstr "Exemplo" #: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption msgid "&Background color in book viewer" msgstr "Cor de &fundo do livro" #: tfrmoptionsviewer.lblfontcolorviewerbook.caption msgid "&Font color in book viewer" msgstr "Cor de te&xto do livro" #: tfrmoptionsviewer.lblnumbercolumnsviewer.caption msgid "&Number of columns in book viewer" msgstr "&Nº de colunas do livro" #: tfrmpackdlg.btnconfig.caption msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION" msgid "Con&figure" msgstr "Con&figurar" #: tfrmpackdlg.caption msgctxt "TFRMPACKDLG.CAPTION" msgid "Pack files" msgstr "Comprimir ficheiros" #: tfrmpackdlg.cbcreateseparatearchives.caption msgid "C&reate separate archives, one per selected file/dir" msgstr "Criar arquivos separados, um por cada ficheiro/pasta seleccionado" #: tfrmpackdlg.cbcreatesfx.caption msgid "Create self e&xtracting archive" msgstr "Criar arquivo de extracção automática" #: tfrmpackdlg.cbencrypt.caption msgid "Encr&ypt" msgstr "Encr&iptar" #: tfrmpackdlg.cbmovetoarchive.caption msgid "Mo&ve to archive" msgstr "Mo&ver para arquivo" #: tfrmpackdlg.cbmultivolume.caption msgid "&Multiple disk archive" msgstr "Arquivo de discos &múltiplos" #: tfrmpackdlg.cbotherplugins.caption msgid "=>" msgstr "=>" #: tfrmpackdlg.cbputintarfirst.caption msgid "P&ut in the TAR archive first" msgstr "Pôr no arq&uivo TAR primeiro" #: tfrmpackdlg.cbstoredir.caption msgid "Also &pack path names (only recursed)" msgstr "Com&primir também nomes de caminhos (só recursivo)" #: tfrmpackdlg.lblprompt.caption msgid "Pack file(s) to the file:" msgstr "Comprimir ficheiro(s) no ficheiro:" #: tfrmpackdlg.rgpacker.caption msgid "Packer" msgstr "Compressor" #: tfrmpackinfodlg.btnclose.caption msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Fe&char" #: tfrmpackinfodlg.btnunpackallandexec.caption msgid "Unpack &all and execute" msgstr "Descomprimir todos e execut&ar" #: tfrmpackinfodlg.btnunpackandexec.caption msgid "&Unpack and execute" msgstr "Descomprimir e exec&utar" #: tfrmpackinfodlg.caption msgctxt "TFRMPACKINFODLG.CAPTION" msgid "Properties of packed file" msgstr "Propriedades do ficheiro comprimido" #: tfrmpackinfodlg.lblattributes.caption msgid "Attributes:" msgstr "Atributos:" #: tfrmpackinfodlg.lblcompressionratio.caption msgid "Compression ratio:" msgstr "Taxa de compressão:" #: tfrmpackinfodlg.lbldate.caption msgid "Date:" msgstr "Data:" #: tfrmpackinfodlg.lblmethod.caption msgid "Method:" msgstr "Método:" #: tfrmpackinfodlg.lbloriginalsize.caption msgid "Original size:" msgstr "Tamanho original:" #: tfrmpackinfodlg.lblpackedfile.caption msgid "File:" msgstr "Ficheiro:" #: tfrmpackinfodlg.lblpackedsize.caption msgid "Packed size:" msgstr "Tamanho comprimido:" #: tfrmpackinfodlg.lblpacker.caption msgid "Packer:" msgstr "Compressor:" #: tfrmpackinfodlg.lbltime.caption msgid "Time:" msgstr "Hora:" #: tfrmquicksearch.btncancel.caption msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION" msgid "X" msgstr "X" #: tfrmquicksearch.btncancel.hint msgid "Close filter panel" msgstr "Fechar painel de filtragem" #: tfrmquicksearch.edtsearch.hint msgid "Enter text to search for or filter by" msgstr "Insira o texto de filtragem ou filtre por" #: tfrmquicksearch.sbcasesensitive.caption msgid "Aa" msgstr "Aa" #: tfrmquicksearch.sbcasesensitive.hint msgid "Case Sensitive" msgstr "Sensível a maiúsculas" #: tfrmquicksearch.sbdirectories.caption msgid "D" msgstr "P" #: tfrmquicksearch.sbdirectories.hint msgctxt "tfrmquicksearch.sbdirectories.hint" msgid "Directories" msgstr "Pastas" #: tfrmquicksearch.sbfiles.caption msgid "F" msgstr "F" #: tfrmquicksearch.sbfiles.hint msgctxt "tfrmquicksearch.sbfiles.hint" msgid "Files" msgstr "Ficheiros" #: tfrmquicksearch.sbmatchbeginning.caption msgid "{" msgstr "{" #: tfrmquicksearch.sbmatchbeginning.hint msgid "Match Beginning" msgstr "Comparar início" #: tfrmquicksearch.sbmatchending.caption msgid "}" msgstr "}" #: tfrmquicksearch.sbmatchending.hint msgid "Match Ending" msgstr "Comparar final" #: tfrmquicksearch.tglfilter.caption msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION" msgid "Filter" msgstr "Filtro" #: tfrmquicksearch.tglfilter.hint msgid "Toggle between search or filter" msgstr "Alternar entre procurar e filtrar" #: tfrmsearchplugin.btnadd.caption msgid "&More rules" msgstr "&Mais regras" #: tfrmsearchplugin.btndelete.caption msgid "L&ess rules" msgstr "M&enos regras" #: tfrmsearchplugin.chkuseplugins.caption msgid "Use &content plugins, combine with:" msgstr "Usar extensões de &conteúdo, combinar com:" #: tfrmsearchplugin.headercontrol.sections[0].text msgctxt "tfrmsearchplugin.headercontrol.sections[0].text" msgid "Plugin" msgstr "Extensão" #: tfrmsearchplugin.headercontrol.sections[1].text msgid "Field" msgstr "Campo" #: tfrmsearchplugin.headercontrol.sections[2].text msgid "Operator" msgstr "Operador" #: tfrmsearchplugin.headercontrol.sections[3].text msgctxt "tfrmsearchplugin.headercontrol.sections[3].text" msgid "Value" msgstr "Valor" #: tfrmsearchplugin.rband.caption msgid "&AND (all match)" msgstr "&E (tudo verdadeiro)" #: tfrmsearchplugin.rbor.caption msgid "&OR (any match)" msgstr "&OU (qualquer verdadeiro)" #: tfrmselecttextrange.btppanel.cancelbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION" msgid "Cancel" msgstr "Cancelar" #: tfrmselecttextrange.btppanel.closebutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION" msgid "&Close" msgstr "Fe&char" #: tfrmselecttextrange.btppanel.helpbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION" msgid "&Help" msgstr "A&juda" #: tfrmselecttextrange.btppanel.okbutton.caption msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmselecttextrange.lblselecttext.caption msgid "&Select the characters to insert:" msgstr "&Seleccionar os caracteres a inserir:" #: tfrmsetfileproperties.btncancel.caption msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmsetfileproperties.btnok.caption msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmsetfileproperties.caption msgctxt "TFRMSETFILEPROPERTIES.CAPTION" msgid "Change attributes" msgstr "Alterar atributos" #: tfrmsetfileproperties.cbsgid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmsetfileproperties.cbsticky.caption msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Pegajoso" #: tfrmsetfileproperties.cbsuid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmsetfileproperties.chkarchive.caption msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION" msgid "Archive" msgstr "Arquivo" #: tfrmsetfileproperties.chkcreationtime.caption msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION" msgid "Created:" msgstr "Criado:" #: tfrmsetfileproperties.chkhidden.caption msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION" msgid "Hidden" msgstr "Oculto" #: tfrmsetfileproperties.chklastaccesstime.caption msgid "Accessed:" msgstr "Acedido:" #: tfrmsetfileproperties.chklastwritetime.caption msgid "Modified:" msgstr "Modificado:" #: tfrmsetfileproperties.chkreadonly.caption msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION" msgid "Read only" msgstr "Só de leitura" #: tfrmsetfileproperties.chkrecursive.caption msgid "Including subfolders" msgstr "Incluindo sub-pastas" #: tfrmsetfileproperties.chksystem.caption msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION" msgid "System" msgstr "Sistema" #: tfrmsetfileproperties.gbtimesamp.caption msgid "Timestamp properties" msgstr "Propriedades do carimbo" #: tfrmsetfileproperties.gbunixattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Atributos" #: tfrmsetfileproperties.gbwinattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Atributos" #: tfrmsetfileproperties.lblattrbitsstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bits:" #: tfrmsetfileproperties.lblattrgroupstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Grupo" #: tfrmsetfileproperties.lblattrinfo.caption msgctxt "tfrmsetfileproperties.lblattrinfo.caption" msgid "(gray field means unchanged value)" msgstr "(campo cinzento significa valor inalterado)" #: tfrmsetfileproperties.lblattrotherstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Outro" #: tfrmsetfileproperties.lblattrownerstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Proprietário" #: tfrmsetfileproperties.lblattrtext.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "-----------" #: tfrmsetfileproperties.lblattrtextstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "Texto:" #: tfrmsetfileproperties.lblexec.caption msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "Executar" #: tfrmsetfileproperties.lblmodeinfo.caption msgctxt "tfrmsetfileproperties.lblmodeinfo.caption" msgid "(gray field means unchanged value)" msgstr "(campo cinzento significa valor inalterado)" #: tfrmsetfileproperties.lbloctal.caption msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "Octal:" #: tfrmsetfileproperties.lblread.caption msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "Ler" #: tfrmsetfileproperties.lblwrite.caption msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "Escrever" #: tfrmsplitter.btncancel.caption msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmsplitter.btnftchoice.caption msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION" msgid "..." msgstr "..." #: tfrmsplitter.btnok.caption msgctxt "TFRMSPLITTER.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmsplitter.btnrelativeftchoice.hint msgctxt "tfrmsplitter.btnrelativeftchoice.hint" msgid "Some functions to select appropriate path" msgstr "Algumas funções para escolher o caminho apropriado" #: tfrmsplitter.caption msgctxt "TFRMSPLITTER.CAPTION" msgid "Splitter" msgstr "Divisor" #: tfrmsplitter.cbrequireacrc32verificationfile.caption msgid "Require a CRC32 verification file" msgstr "Requerer um ficheiro de verificação CRC32" #: tfrmsplitter.cmbxsize.text msgid "1457664B - 3.5\"" msgstr "1457664B - 3.5\"" #: tfrmsplitter.grbxfile.caption msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION" msgid "File name" msgstr "Nome de ficheiro" #: tfrmsplitter.grbxsize.caption msgid "Size and number of parts" msgstr "Tamanho e nº. de partes" #: tfrmsplitter.lbdirtarget.caption msgid "Directory &target" msgstr "Pas&ta destino" #: tfrmsplitter.lbfilesource.caption msgid "File &source" msgstr "Ficheiro &origem" #: tfrmsplitter.lblnumberparts.caption msgid "&Number of parts" msgstr "&Número de partes" #: tfrmsplitter.rbtnbyte.caption msgid "&Bytes" msgstr "&Bytes" #: tfrmsplitter.rbtngigab.caption msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION" msgid "&Gigabytes" msgstr "&Gigabytes" #: tfrmsplitter.rbtnkilob.caption msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION" msgid "&Kilobytes" msgstr "&Kilobytes" #: tfrmsplitter.rbtnmegab.caption msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION" msgid "&Megabytes" msgstr "&Megabytes" #: tfrmstartingsplash.caption msgctxt "tfrmstartingsplash.caption" msgid "Double Commander" msgstr "Double Commander" #: tfrmstartingsplash.lblbuild.caption msgctxt "tfrmstartingsplash.lblbuild.caption" msgid "Build" msgstr "Compilação" #: tfrmstartingsplash.lblfreepascalver.caption msgctxt "tfrmstartingsplash.lblfreepascalver.caption" msgid "Free Pascal" msgstr "Free Pascal" #: tfrmstartingsplash.lbllazarusver.caption msgctxt "tfrmstartingsplash.lbllazarusver.caption" msgid "Lazarus" msgstr "Lazarus" #: tfrmstartingsplash.lbloperatingsystem.caption msgid "Operating System" msgstr "Sistema operativo" #: tfrmstartingsplash.lblplatform.caption msgid "Platform" msgstr "Plataforma" #: tfrmstartingsplash.lblrevision.caption msgctxt "tfrmstartingsplash.lblrevision.caption" msgid "Revision" msgstr "Revisão" #: tfrmstartingsplash.lbltitle.caption msgctxt "tfrmstartingsplash.lbltitle.caption" msgid "Double Commander" msgstr "Double Commander" #: tfrmstartingsplash.lblversion.caption msgctxt "tfrmstartingsplash.lblversion.caption" msgid "Version" msgstr "Versão" #: tfrmstartingsplash.lblwidgetsetver.caption msgid "WidgetsetVer" msgstr "WidgetsetVer" #: tfrmsymlink.btncancel.caption msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmsymlink.btnok.caption msgctxt "TFRMSYMLINK.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmsymlink.caption msgid "Create symbolic link" msgstr "Criar ligação simbólica" #: tfrmsymlink.chkuserelativepath.caption msgid "Use &relative path when possible" msgstr "" #: tfrmsymlink.lblexistingfile.caption msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "&Destino para o qual a ligação aponta" #: tfrmsymlink.lbllinktocreate.caption msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "Nome da &ligação" #: tfrmsyncdirsdlg.actselectclear.caption msgid "Remove selection" msgstr "" #: tfrmsyncdirsdlg.actselectcopydefault.caption msgid "Select for copying (default direction)" msgstr "" #: tfrmsyncdirsdlg.actselectcopylefttoright.caption msgid "Select for copying -> (left to right)" msgstr "" #: tfrmsyncdirsdlg.actselectcopyreverse.caption msgid "Reverse copy direction" msgstr "" #: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption msgid "Select for copying <- (right to left)" msgstr "" #: tfrmsyncdirsdlg.actselectdeleteright.caption msgid "Select for deleting -> (right)" msgstr "" #: tfrmsyncdirsdlg.btnclose.caption msgctxt "tfrmsyncdirsdlg.btnclose.caption" msgid "Close" msgstr "Fechar" #: tfrmsyncdirsdlg.btncompare.caption msgctxt "tfrmsyncdirsdlg.btncompare.caption" msgid "Compare" msgstr "Comparar" #: tfrmsyncdirsdlg.btnseldir1.caption msgctxt "tfrmsyncdirsdlg.btnseldir1.caption" msgid ">>" msgstr ">>" #: tfrmsyncdirsdlg.btnseldir2.caption msgctxt "tfrmsyncdirsdlg.btnseldir2.caption" msgid ">>" msgstr ">>" #: tfrmsyncdirsdlg.btnsynchronize.caption msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption" msgid "Synchronize" msgstr "Sincronizar" #: tfrmsyncdirsdlg.caption msgid "Synchronize directories" msgstr "Sincronizar pastas" #: tfrmsyncdirsdlg.cbextfilter.text msgctxt "tfrmsyncdirsdlg.cbextfilter.text" msgid "*.*" msgstr "*.*" #: tfrmsyncdirsdlg.chkasymmetric.caption msgid "asymmetric" msgstr "assimétrico" #: tfrmsyncdirsdlg.chkbycontent.caption msgid "by content" msgstr "por conteúdo" #: tfrmsyncdirsdlg.chkignoredate.caption msgid "ignore date" msgstr "ignorar data" #: tfrmsyncdirsdlg.chkonlyselected.caption msgid "only selected" msgstr "só seleccionados" #: tfrmsyncdirsdlg.chksubdirs.caption msgid "Subdirs" msgstr "Sub-pastas" #: tfrmsyncdirsdlg.groupbox1.caption msgid "Show:" msgstr "Mostrar:" #: tfrmsyncdirsdlg.headerdg.columns[0].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption" msgid "Name" msgstr "Nome" #: tfrmsyncdirsdlg.headerdg.columns[1].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption" msgid "Size" msgstr "Tamanho" #: tfrmsyncdirsdlg.headerdg.columns[2].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption" msgid "Date" msgstr "Data" #: tfrmsyncdirsdlg.headerdg.columns[3].title.caption msgid "<=>" msgstr "<=>" #: tfrmsyncdirsdlg.headerdg.columns[4].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption" msgid "Date" msgstr "Data" #: tfrmsyncdirsdlg.headerdg.columns[5].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption" msgid "Size" msgstr "Tamanho" #: tfrmsyncdirsdlg.headerdg.columns[6].title.caption msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption" msgid "Name" msgstr "Nome" #: tfrmsyncdirsdlg.label1.caption msgid "(in main window)" msgstr "(na janela principal)" #: tfrmsyncdirsdlg.menuitemcompare.caption msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption" msgid "Compare" msgstr "Comparar" #: tfrmsyncdirsdlg.menuitemviewleft.caption msgid "View left" msgstr "Ver esquerdo" #: tfrmsyncdirsdlg.menuitemviewright.caption msgid "View right" msgstr "Ver direito" #: tfrmsyncdirsdlg.sbcopyleft.caption msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption" msgid "<" msgstr "<" #: tfrmsyncdirsdlg.sbcopyright.caption msgctxt "tfrmsyncdirsdlg.sbcopyright.caption" msgid ">" msgstr ">" #: tfrmsyncdirsdlg.sbduplicates.caption msgid "duplicates" msgstr "duplicados" #: tfrmsyncdirsdlg.sbequal.caption msgid "=" msgstr "=" #: tfrmsyncdirsdlg.sbnotequal.caption msgid "!=" msgstr "!=" #: tfrmsyncdirsdlg.sbsingles.caption msgid "singles" msgstr "únicos" #: tfrmsyncdirsdlg.statusbar1.panels[0].text msgid "Please press \"Compare\" to start" msgstr "Clique em \"Comparar\" para iniciar" #: tfrmsyncdirsperformdlg.caption msgctxt "tfrmsyncdirsperformdlg.caption" msgid "Synchronize" msgstr "Sincronizar" #: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption msgid "Confirm overwrites" msgstr "Confirmar sobrescrição" #: tfrmtreeviewmenu.caption msgctxt "tfrmtreeviewmenu.caption" msgid "Tree View Menu" msgstr "Menu de árvore" #: tfrmtreeviewmenu.lblsearchingentry.caption msgid "Select your hot directory:" msgstr "Seleccione a sua pasta quente:" #: tfrmtreeviewmenu.pmicasesensitive.caption msgid "Search is case sensitive" msgstr "Procurar por maiúsculas" #: tfrmtreeviewmenu.pmifullcollapse.caption msgid "Full collapse" msgstr "Colapso total" #: tfrmtreeviewmenu.pmifullexpand.caption msgid "Full expand" msgstr "Expansão total" #: tfrmtreeviewmenu.pmiignoreaccents.caption msgid "Search ignore accents and ligatures" msgstr "Procura ignorando acentos e ligações" #: tfrmtreeviewmenu.pminotcasesensitive.caption msgid "Search is not case sensitive" msgstr "Procura ignorando maiúsculas" #: tfrmtreeviewmenu.pminotignoreaccents.caption msgid "Search is strict regarding accents and ligatures" msgstr "Procurar exactamente por acentos e ligações" #: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption msgid "Don't show the branch content \"just\" because the searched string is found in the branche name" msgstr "Não mostrar conteúdo do ramo \"só\" porque a cadeia procurada se encontra no nome do ramo" #: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption msgid "If searched string is found in a branch name, show the whole branch even if elements don't match" msgstr "Se a cadeia procurada se encontrar num nome de ramo, mostrar todo o ramo, mesmo que os elementos não correspondam" #: tfrmtreeviewmenu.tbcancelandquit.hint msgid "Close Tree View Menu" msgstr "Fechar menu da árvore" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint" msgid "Configuration of Tree View Menu" msgstr "Configuração do menu da árvore" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint" msgid "Configuration of Tree View Menu Colors" msgstr "Configuração das cores do menu da árvore" #: tfrmtweakplugin.btnadd.caption msgid "A&dd new" msgstr "A&dicionar novo " #: tfrmtweakplugin.btncancel.caption msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&Cancelar" #: tfrmtweakplugin.btnchange.caption msgid "C&hange" msgstr "Al&terar" #: tfrmtweakplugin.btndefault.caption msgid "De&fault" msgstr "Prede&finição" #: tfrmtweakplugin.btnok.caption msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION" msgid "&OK" msgstr "&Aceitar" #: tfrmtweakplugin.btnremove.caption msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION" msgid "&Remove" msgstr "&Remover" #: tfrmtweakplugin.caption msgctxt "TFRMTWEAKPLUGIN.CAPTION" msgid "Tweak plugin" msgstr "Extensão de afinação" #: tfrmtweakplugin.cbpk_caps_by_content.caption msgid "De&tect archive type by content" msgstr "De&tectar tipo de arquivo por conteúdo" #: tfrmtweakplugin.cbpk_caps_delete.caption msgid "Can de&lete files" msgstr "Pode eliminar fi&cheiros" #: tfrmtweakplugin.cbpk_caps_encrypt.caption msgid "Supports e&ncryption" msgstr "Suporta e&ncriptação" #: tfrmtweakplugin.cbpk_caps_hide.caption msgid "Sho&w as normal files (hide packer icon)" msgstr "Mo&strar como ficheiros normais (ocultar ícone do compressor)" #: tfrmtweakplugin.cbpk_caps_mempack.caption msgid "Supports pac&king in memory" msgstr "Suporta co&mpressão em memória" #: tfrmtweakplugin.cbpk_caps_modify.caption msgid "Can &modify existing archives" msgstr "Pode modificar arquivos existentes" #: tfrmtweakplugin.cbpk_caps_multiple.caption msgid "&Archive can contain multiple files" msgstr "O &arquivo pode conter múltiplos ficheiros" #: tfrmtweakplugin.cbpk_caps_new.caption msgid "Can create new archi&ves" msgstr "Pode criar novos arqui&vos" #: tfrmtweakplugin.cbpk_caps_options.caption msgid "S&upports the options dialogbox" msgstr "S&uporta diálogo de opções" #: tfrmtweakplugin.cbpk_caps_searchtext.caption msgid "Allow searchin&g for text in archives" msgstr "Permitir procurar texto nos ar&quivos" #: tfrmtweakplugin.lbldescription.caption msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION" msgid "&Description:" msgstr "&Descrição:" #: tfrmtweakplugin.lbldetectstr.caption msgid "D&etect string:" msgstr "D&etectar cadeia:" #: tfrmtweakplugin.lblextension.caption msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION" msgid "&Extension:" msgstr "&Extensão:" #: tfrmtweakplugin.lblflags.caption msgid "Flags:" msgstr "Bandeiras:" #: tfrmtweakplugin.lblname.caption msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION" msgid "&Name:" msgstr "&Nome:" #: tfrmtweakplugin.lblplugin.caption msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION" msgid "&Plugin:" msgstr "E&xtensão:" #: tfrmtweakplugin.lblplugin1.caption msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION" msgid "&Plugin:" msgstr "Ex&tensão:" #: tfrmviewer.actabout.caption msgctxt "TFRMVIEWER.ACTABOUT.CAPTION" msgid "About Viewer..." msgstr "Acerca do visualizador..." #: tfrmviewer.actabout.hint msgid "Displays the About message" msgstr "Mostra a mensagem Sobre" #: tfrmviewer.actchangeencoding.caption msgid "Change encoding" msgstr "Alterar codificação" #: tfrmviewer.actcopyfile.caption msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION" msgid "Copy File" msgstr "Copiar ficheiro" #: tfrmviewer.actcopyfile.hint msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT" msgid "Copy File" msgstr "Copiar ficheiro" #: tfrmviewer.actcopytoclipboard.caption msgctxt "tfrmviewer.actcopytoclipboard.caption" msgid "Copy To Clipboard" msgstr "Copiar para a memória" #: tfrmviewer.actcopytoclipboardformatted.caption msgid "Copy To Clipboard Formatted" msgstr "Copiar formatado para a memória" #: tfrmviewer.actdeletefile.caption msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION" msgid "Delete File" msgstr "Eliminar ficheiro" #: tfrmviewer.actdeletefile.hint msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT" msgid "Delete File" msgstr "Eliminar ficheiro" #: tfrmviewer.actexitviewer.caption msgctxt "tfrmviewer.actexitviewer.caption" msgid "E&xit" msgstr "&Sair" #: tfrmviewer.actfind.caption msgctxt "tfrmviewer.actfind.caption" msgid "Find" msgstr "Localizar" #: tfrmviewer.actfindnext.caption msgctxt "tfrmviewer.actfindnext.caption" msgid "Find next" msgstr "Localizar seguinte" #: tfrmviewer.actfindprev.caption msgctxt "tfrmviewer.actfindprev.caption" msgid "Find previous" msgstr "Localizar anterior" #: tfrmviewer.actfullscreen.caption msgctxt "tfrmviewer.actfullscreen.caption" msgid "Full Screen" msgstr "Ecrã completo" #: tfrmviewer.actimagecenter.caption msgctxt "tfrmviewer.actimagecenter.caption" msgid "Center" msgstr "Centrar" #: tfrmviewer.actloadnextfile.caption msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION" msgid "&Next" msgstr "Segui&nte" #: tfrmviewer.actloadnextfile.hint msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT" msgid "Load Next File" msgstr "Carregar o ficheiro seguinte" #: tfrmviewer.actloadprevfile.caption msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION" msgid "&Previous" msgstr "A&nterior" #: tfrmviewer.actloadprevfile.hint msgid "Load Previous File" msgstr "Carregar o ficheiro anterior" #: tfrmviewer.actmirrorhorz.caption msgid "Mirror Horizontally" msgstr "Espelhar na horizontal" #: tfrmviewer.actmirrorhorz.hint msgctxt "tfrmviewer.actmirrorhorz.hint" msgid "Mirror" msgstr "Espelhar" #: tfrmviewer.actmirrorvert.caption msgid "Mirror Vertically" msgstr "Espelhar na vertical" #: tfrmviewer.actmovefile.caption msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION" msgid "Move File" msgstr "Mover ficheiro" #: tfrmviewer.actmovefile.hint msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT" msgid "Move File" msgstr "Mover ficheiro" #: tfrmviewer.actpreview.caption msgctxt "tfrmviewer.actpreview.caption" msgid "Preview" msgstr "Antever" #: tfrmviewer.actreload.caption msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION" msgid "Reload" msgstr "Recarregar" #: tfrmviewer.actreload.hint msgid "Reload current file" msgstr "Recarregar o ficheiro actual" #: tfrmviewer.actrotate180.caption msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION" msgid "+ 180" msgstr "+ 180" #: tfrmviewer.actrotate180.hint msgctxt "TFRMVIEWER.ACTROTATE180.HINT" msgid "Rotate 180 degrees" msgstr "Rodar 180 graus" #: tfrmviewer.actrotate270.caption msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION" msgid "- 90" msgstr "- 90" #: tfrmviewer.actrotate270.hint msgctxt "TFRMVIEWER.ACTROTATE270.HINT" msgid "Rotate -90 degrees" msgstr "Rodar -90 graus" #: tfrmviewer.actrotate90.caption msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION" msgid "+ 90" msgstr "+ 90" #: tfrmviewer.actrotate90.hint msgctxt "TFRMVIEWER.ACTROTATE90.HINT" msgid "Rotate +90 degrees" msgstr "Rodar 90 graus" #: tfrmviewer.actsave.caption msgctxt "tfrmviewer.actsave.caption" msgid "Save" msgstr "Gravar" #: tfrmviewer.actsaveas.caption msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION" msgid "Save As..." msgstr "Gravar como..." #: tfrmviewer.actsaveas.hint msgid "Save File As..." msgstr "Gravar ficheiro como..." #: tfrmviewer.actscreenshot.caption msgctxt "tfrmviewer.actscreenshot.caption" msgid "Screenshot" msgstr "Captura de ecrã" #: tfrmviewer.actscreenshotdelay3sec.caption msgid "Delay 3 sec" msgstr "Atrasar 3 seg" #: tfrmviewer.actscreenshotdelay5sec.caption msgid "Delay 5 sec" msgstr "Atrasar 5 seg" #: tfrmviewer.actselectall.caption msgctxt "tfrmviewer.actselectall.caption" msgid "Select All" msgstr "Seleccionar tudo" #: tfrmviewer.actshowasbin.caption msgctxt "tfrmviewer.actshowasbin.caption" msgid "Show as &Bin" msgstr "Mostrar como &bin" #: tfrmviewer.actshowasbook.caption msgctxt "tfrmviewer.actshowasbook.caption" msgid "Show as B&ook" msgstr "Mostrar como livr&o" #: tfrmviewer.actshowasdec.caption msgid "Show as &Dec" msgstr "Mostrar como &dec" #: tfrmviewer.actshowashex.caption msgctxt "tfrmviewer.actshowashex.caption" msgid "Show as &Hex" msgstr "Mostrar como &hex" #: tfrmviewer.actshowastext.caption msgctxt "tfrmviewer.actshowastext.caption" msgid "Show as &Text" msgstr "Mostrar como &texto" #: tfrmviewer.actshowaswraptext.caption msgctxt "tfrmviewer.actshowaswraptext.caption" msgid "Show as &Wrap text" msgstr "Mostrar como texto aj&ustado" #: tfrmviewer.actshowgraphics.caption msgctxt "tfrmviewer.actshowgraphics.caption" msgid "Graphics" msgstr "Gráficos" #: tfrmviewer.actshowplugins.caption msgctxt "tfrmviewer.actshowplugins.caption" msgid "Plugins" msgstr "Extensões" #: tfrmviewer.actstretchimage.caption msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION" msgid "Stretch" msgstr "Esticar" #: tfrmviewer.actstretchimage.hint msgid "Stretch Image" msgstr "Esticar a imagem" #: tfrmviewer.actstretchonlylarge.caption msgctxt "tfrmviewer.actstretchonlylarge.caption" msgid "Stretch only large" msgstr "Esticar só grandes" #: tfrmviewer.actzoom.caption msgid "Zoom" msgstr "Ampliação" #: tfrmviewer.actzoomin.caption msgctxt "tfrmviewer.actzoomin.caption" msgid "Zoom In" msgstr "Ampliar" #: tfrmviewer.actzoomout.caption msgctxt "tfrmviewer.actzoomout.caption" msgid "Zoom Out" msgstr "Reduzir" #: tfrmviewer.btncopyfile.hint msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT" msgid "Copy" msgstr "Copiar" #: tfrmviewer.btncopyfile1.hint msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT" msgid "Copy" msgstr "Copiar" #: tfrmviewer.btncuttuimage.hint msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT" msgid "Crop" msgstr "Recortar" #: tfrmviewer.btndeletefile.hint msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT" msgid "Delete" msgstr "Eliminar" #: tfrmviewer.btndeletefile1.hint msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT" msgid "Delete" msgstr "Eliminar" #: tfrmviewer.btnfullscreen.hint msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT" msgid "Full Screen" msgstr "Ecrã completo" #: tfrmviewer.btngifmove.caption msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION" msgid "||" msgstr "||" #: tfrmviewer.btngiftobmp.caption msgid "S" msgstr "S" #: tfrmviewer.btnhightlight.hint msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT" msgid "Highlight" msgstr "Realçar" #: tfrmviewer.btnmovefile.hint msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT" msgid "Move" msgstr "Mover" #: tfrmviewer.btnmovefile1.hint msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT" msgid "Move" msgstr "Mover" #: tfrmviewer.btnnextgifframe.caption msgid "||>" msgstr "||>" #: tfrmviewer.btnpaint.hint msgctxt "TFRMVIEWER.BTNPAINT.HINT" msgid "Paint" msgstr "Pintar" #: tfrmviewer.btnprevgifframe.caption msgid "<||" msgstr "<||" #: tfrmviewer.btnredeye.hint msgid "Red Eyes" msgstr "Olhos vermelhos" #: tfrmviewer.btnresize.hint msgctxt "TFRMVIEWER.BTNRESIZE.HINT" msgid "Resize" msgstr "Redimensionar" #: tfrmviewer.btnundo.hint msgctxt "TFRMVIEWER.BTNUNDO.HINT" msgid "Undo" msgstr "Desfazer" #: tfrmviewer.caption msgctxt "TFRMVIEWER.CAPTION" msgid "Viewer" msgstr "Visualizador" #: tfrmviewer.cbslideshow.caption msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "Diaporama" #: tfrmviewer.comboboxpaint.text msgid "Pen" msgstr "Caneta" #: tfrmviewer.comboboxwidth.text msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT" msgid "1" msgstr "1" #: tfrmviewer.gboxhightlight.caption msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION" msgid "Highlight" msgstr "Realçar" #: tfrmviewer.gboxpaint.caption msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION" msgid "Paint" msgstr "Pintar" #: tfrmviewer.gboxslideshow.caption msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "Diaporama" #: tfrmviewer.gboxview.caption msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION" msgid "View" msgstr "Ver" #: tfrmviewer.lblhightlight.caption msgid "0x0" msgstr "0x0" #: tfrmviewer.miabout.caption msgctxt "TFRMVIEWER.MIABOUT.CAPTION" msgid "About" msgstr "Sobre" #: tfrmviewer.midiv1.caption msgctxt "TFRMVIEWER.MIDIV1.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv2.caption msgctxt "TFRMVIEWER.MIDIV2.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv3.caption msgctxt "TFRMVIEWER.MIDIV3.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv4.caption msgctxt "TFRMVIEWER.MIDIV4.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv5.caption msgctxt "TFRMVIEWER.MIDIV5.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.miedit.caption msgctxt "TFRMVIEWER.MIEDIT.CAPTION" msgid "&Edit" msgstr "&Editar" #: tfrmviewer.miencoding.caption msgctxt "TFRMVIEWER.MIENCODING.CAPTION" msgid "En&coding" msgstr "&Codificar" #: tfrmviewer.mifile.caption msgctxt "TFRMVIEWER.MIFILE.CAPTION" msgid "&File" msgstr "&Ficheiro" #: tfrmviewer.miimage.caption msgid "&Image" msgstr "&Imagem" #: tfrmviewer.miprint.caption msgid "Print..." msgstr "Imprimir..." #: tfrmviewer.mirotate.caption msgctxt "TFRMVIEWER.MIROTATE.CAPTION" msgid "Rotate" msgstr "Rodar" #: tfrmviewer.miscreenshot.caption msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION" msgid "Screenshot" msgstr "Captura de ecrã" #: tfrmviewer.miseparator.caption msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.miview.caption msgctxt "TFRMVIEWER.MIVIEW.CAPTION" msgid "&View" msgstr "&Ver" #: tfrmviewer.pmiselectall.caption msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION" msgid "Select All" msgstr "Seleccionar tudo" #: tfrmviewoperations.btnstartpause.caption #, fuzzy msgctxt "tfrmviewoperations.btnstartpause.caption" msgid "&Start" msgstr "&Iniciar" #: tfrmviewoperations.btnstop.caption msgid "S&top" msgstr "" #: tfrmviewoperations.caption #, fuzzy msgctxt "tfrmviewoperations.caption" msgid "File operations" msgstr "Operações de ficheiros" #: tfrmviewoperations.cbalwaysontop.caption msgid "Always on top" msgstr "" #: tfrmviewoperations.lblusedragdrop.caption msgid "&Use \"drag && drop\" to move operations between queues" msgstr "" #: tfrmviewoperations.mnucanceloperation.caption #, fuzzy msgctxt "tfrmviewoperations.mnucanceloperation.caption" msgid "Cancel" msgstr "Cancelar" #: tfrmviewoperations.mnucancelqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnucancelqueue.caption" msgid "Cancel" msgstr "Cancelar" #: tfrmviewoperations.mnunewqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnunewqueue.caption" msgid "New queue" msgstr "Nova fila" #: tfrmviewoperations.mnuoperationshowdetached.caption msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption" msgid "Show in detached window" msgstr "" #: tfrmviewoperations.mnuputfirstinqueue.caption msgid "Put first in queue" msgstr "" #: tfrmviewoperations.mnuputlastinqueue.caption msgid "Put last in queue" msgstr "" #: tfrmviewoperations.mnuqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue.caption" msgid "Queue" msgstr "Fila" #: tfrmviewoperations.mnuqueue0.caption msgid "Out of queue" msgstr "" #: tfrmviewoperations.mnuqueue1.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue1.caption" msgid "Queue 1" msgstr "Fila 1" #: tfrmviewoperations.mnuqueue2.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue2.caption" msgid "Queue 2" msgstr "Fila 2" #: tfrmviewoperations.mnuqueue3.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue3.caption" msgid "Queue 3" msgstr "Fila 3" #: tfrmviewoperations.mnuqueue4.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue4.caption" msgid "Queue 4" msgstr "Fila 4" #: tfrmviewoperations.mnuqueue5.caption #, fuzzy msgctxt "tfrmviewoperations.mnuqueue5.caption" msgid "Queue 5" msgstr "Fila 5" #: tfrmviewoperations.mnuqueueshowdetached.caption msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption" msgid "Show in detached window" msgstr "" #: tfrmviewoperations.tbpauseall.caption msgid "&Pause all" msgstr "" #: tmultiarchivecopyoperationoptionsui.lblfileexists.caption msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "Quando o ficheiro existir" #: twcxarchivecopyoperationoptionsui.lblfileexists.caption msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "Quando o ficheiro existir" #: twfxplugincopymoveoperationoptionsui.cbcopytime.caption msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "Copiar d&ata/hora" #: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption msgid "Work in background (separate connection)" msgstr "Trabalhar em 2º plano (ligação separada)" #: twfxplugincopymoveoperationoptionsui.lblfileexists.caption msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "Quando o ficheiro existir" #: uexifreader.rsdatetimeoriginal msgid "Date taken" msgstr "Data" #: uexifreader.rsimageheight msgctxt "uexifreader.rsimageheight" msgid "Height" msgstr "Altura" #: uexifreader.rsimagewidth msgctxt "uexifreader.rsimagewidth" msgid "Width" msgstr "Largura" #: uexifreader.rsmake msgid "Manufacturer" msgstr "Fabricante" #: uexifreader.rsmodel msgid "Camera model" msgstr "Modelo da câmara" #: uexifreader.rsorientation msgid "Orientation" msgstr "Orientação" #: ulng.msgtrytolocatecrcfile msgid "" "This file cannot be found and could help to validate final combination of files:\n" "%s\n" "\n" "Could you make it available and press \"OK\" when ready,\n" "or press \"CANCEL\" to continue without it?\n" msgstr "" "Impossível encontrar o ficheiro que poderia ajudar a validar a combinação final:\n" "%s\n" "\n" "Pode disponibilizá-lo e clicar em \"Aceitar\", por favor?\n" "Ou clique em \"Cancelar\" para continuar.\n" #: ulng.rscancelfilter msgid "Cancel Quick Filter" msgstr "Cancelar filtro rápido" #: ulng.rscanceloperation msgid "Cancel Current Operation" msgstr "Cancelar operação actual" #: ulng.rscaptionforaskingfilename msgid "Enter filename, with extension, for dropped text" msgstr "Insira o nome do ficheiro com extensão, para texto largado" #: ulng.rscaptionfortextformattoimport msgid "Text format to import" msgstr "Formato de teto a importar" #: ulng.rschecksumverifybroken msgid "Broken:" msgstr "Qebrado:" #: ulng.rschecksumverifygeneral msgid "General:" msgstr "Geral:" #: ulng.rschecksumverifymissing msgid "Missing:" msgstr "Em falta:" #: ulng.rschecksumverifyreaderror msgid "Read error:" msgstr "Erro de leitura:" #: ulng.rschecksumverifysuccess msgid "Success:" msgstr "Sucesso:" #: ulng.rschecksumverifytext msgid "Enter checksum and select algorithm:" msgstr "Insira a checksum e escolha o algoritmo:" #: ulng.rschecksumverifytitle msgid "Verify checksum" msgstr "Verificar checksum" #: ulng.rschecksumverifytotal msgid "Total:" msgstr "Total:" #: ulng.rsclearfiltersornot msgid "Do you want to clear filters for this new search?" msgstr "Quer limpar os filtros para esta nova procura?" #: ulng.rsclipboardcontainsinvalidtoolbardata msgid "Clipboard doesn't contain any valid toolbar data." msgstr "Área de transferência sem dados de barra de ferramentas válidos." #: ulng.rscmdcategorylistinorder msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log" msgstr "Tudo;Painel activo;Painel esquerdo;Painel direito;Operações de ficheiro;Configuração;Rede;Diversos;Porta paralela;Imprimir;Marcar;Segurança;Área de transferência;FTP;Navegação;Ajuda;Janela;Linha de comandos;Ferramentas;Ver;Utilizador;Separadores;Ordenar;Diário" #: ulng.rscmdkindofsort msgid "Legacy sorted;A-Z sorted" msgstr "Ordem antiga;A -> Z" #: ulng.rscolattr msgid "Attr" msgstr "Atr" #: ulng.rscoldate msgctxt "ulng.rscoldate" msgid "Date" msgstr "Data" #: ulng.rscolext msgid "Ext" msgstr "Ext" #: ulng.rscolname msgctxt "ulng.rscolname" msgid "Name" msgstr "Nome" #: ulng.rscolsize msgctxt "ulng.rscolsize" msgid "Size" msgstr "Tamanho" #: ulng.rsconfcolalign msgid "Align" msgstr "Alinhar" #: ulng.rsconfcolcaption msgid "Caption" msgstr "Legenda" #: ulng.rsconfcoldelete msgctxt "ulng.rsconfcoldelete" msgid "Delete" msgstr "Eliminar" #: ulng.rsconfcolfieldcont msgid "Field contents" msgstr "Conteúdo do campo" #: ulng.rsconfcolmove msgctxt "ulng.rsconfcolmove" msgid "Move" msgstr "Mover" #: ulng.rsconfcolwidth msgctxt "ulng.rsconfcolwidth" msgid "Width" msgstr "Largura" #: ulng.rsconfcustheader msgid "Customize column" msgstr "Personalizar coluna" #: ulng.rsconfigurationfileassociation msgid "Configure file association" msgstr "Configurar associação de ficheiro" #: ulng.rsconfirmexecution msgid "Confirming command line and parameters" msgstr "A comfirmar comando e parâmetros" #: ulng.rscopynametemplate msgid "Copy (%d) %s" msgstr "Copiar (%d) %s" #: ulng.rsdefaultimporteddctoolbarhint msgid "Imported DC toolbar" msgstr "Barra DC importada" #: ulng.rsdefaultimportedtctoolbarhint msgid "Imported TC toolbar" msgstr "Barra TC importada" #: ulng.rsdefaultsuffixdroppedtext msgid "_DroppedText" msgstr "_TextoLargado" #: ulng.rsdefaultsuffixdroppedtexthtmlfilename msgid "_DroppedHTMLtext" msgstr "_TextoHTMLLargado" #: ulng.rsdefaultsuffixdroppedtextrichtextfilename msgid "_DroppedRichtext" msgstr "_RichTextLargado" #: ulng.rsdefaultsuffixdroppedtextsimplefilename msgid "_DroppedSimpleText" msgstr "_TextoSimplesLargado" #: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename msgid "_DroppedUnicodeUTF16text" msgstr "_TextoUTF16Largado" #: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename msgid "_DroppedUnicodeUTF8text" msgstr "_TextoUTF8Largado" #: ulng.rsdiffadds msgid " Adds: " msgstr "Adiciona: " #: ulng.rsdiffdeletes msgid " Deletes: " msgstr "Elimina: " #: ulng.rsdifffilesidentical msgid "The two files are identical!" msgstr "Os ficheiros são idênticos!" #: ulng.rsdiffmatches msgid " Matches: " msgstr "Compara: " #: ulng.rsdiffmodifies msgid " Modifies: " msgstr "Modifica: " #: ulng.rsdlgbuttonabort msgid "Ab&ort" msgstr "Ab&ortar" #: ulng.rsdlgbuttonall msgctxt "ulng.rsdlgbuttonall" msgid "A&ll" msgstr "T&udo" #: ulng.rsdlgbuttonappend msgid "A&ppend" msgstr "Jun&tar" #: ulng.rsdlgbuttonautorenamesource msgid "A&uto-rename source files" msgstr "A&uto-renomear ficheiros fonte" #: ulng.rsdlgbuttoncancel msgctxt "ulng.rsdlgbuttoncancel" msgid "&Cancel" msgstr "&Cancelar" #: ulng.rsdlgbuttoncompare msgid "Compare &by content" msgstr "" #: ulng.rsdlgbuttoncontinue msgid "&Continue" msgstr "&Continuar" #: ulng.rsdlgbuttoncopyinto msgid "&Merge" msgstr "&Unir" #: ulng.rsdlgbuttoncopyintoall msgid "Mer&ge All" msgstr "U&nir todos" #: ulng.rsdlgbuttonexitprogram msgid "E&xit program" msgstr "&Sair do programa" #: ulng.rsdlgbuttonignore msgid "Ig&nore" msgstr "Ig&norar" #: ulng.rsdlgbuttonignoreall msgid "I&gnore All" msgstr "I&gnorar todos" #: ulng.rsdlgbuttonno msgid "&No" msgstr "&Não" #: ulng.rsdlgbuttonnone msgid "Non&e" msgstr "N&enhum" #: ulng.rsdlgbuttonok msgctxt "ulng.rsdlgbuttonok" msgid "&OK" msgstr "&Aceitar" #: ulng.rsdlgbuttonother msgid "Ot&her" msgstr "&Outro" #: ulng.rsdlgbuttonoverwrite msgid "&Overwrite" msgstr "S&obrescrever" #: ulng.rsdlgbuttonoverwriteall msgid "Overwrite &All" msgstr "&Sobrescrever todos" #: ulng.rsdlgbuttonoverwritelarger msgid "Overwrite All &Larger" msgstr "Sobrescrever os &maiores" #: ulng.rsdlgbuttonoverwriteolder msgid "Overwrite All Ol&der" msgstr "Sobrescrever mais an&tigos" #: ulng.rsdlgbuttonoverwritesmaller msgid "Overwrite All S&maller" msgstr "Sobrescrever m&enores" #: ulng.rsdlgbuttonrename msgctxt "ulng.rsdlgbuttonrename" msgid "R&ename" msgstr "R&enomear" #: ulng.rsdlgbuttonresume msgid "&Resume" msgstr "&Recomeçar" #: ulng.rsdlgbuttonretry msgid "Re&try" msgstr "Repe&tir" #: ulng.rsdlgbuttonretryadmin msgid "As Ad&ministrator" msgstr "Como ad&ministrador" #: ulng.rsdlgbuttonskip msgid "&Skip" msgstr "&Saltar" #: ulng.rsdlgbuttonskipall msgid "S&kip All" msgstr "Sa<ar todos" #: ulng.rsdlgbuttonyes msgid "&Yes" msgstr "S&im" #: ulng.rsdlgcp msgctxt "ulng.rsdlgcp" msgid "Copy file(s)" msgstr "Copiar ficheiro(s)" #: ulng.rsdlgmv msgid "Move file(s)" msgstr "Mover ficheiro(s)" #: ulng.rsdlgoppause msgctxt "ulng.rsdlgoppause" msgid "Pau&se" msgstr "Pau&sa" #: ulng.rsdlgopstart msgctxt "ulng.rsdlgopstart" msgid "&Start" msgstr "&Iniciar" #: ulng.rsdlgqueue msgctxt "ulng.rsdlgqueue" msgid "Queue" msgstr "Fila" #: ulng.rsdlgspeed msgid "Speed %s/s" msgstr "Velocidade %s/s" #: ulng.rsdlgspeedtime msgid "Speed %s/s, time remaining %s" msgstr "Velocidade %s/s, falta %s" #: ulng.rsdraganddroptextformat msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format" msgstr "Rich Text Format;Formato HTML;Formato Unicode;Formato de texto simples" #: ulng.rsdrivenolabel msgid "" msgstr "" #: ulng.rsdrivenomedia msgid "" msgstr "" #: ulng.rseditabouttext msgid "Internal Editor of Double Commander." msgstr "Editor interno do Double Commander." #: ulng.rseditgotolinequery msgid "Goto line:" msgstr "Ir para linha:" #: ulng.rseditgotolinetitle msgid "Goto Line" msgstr "Ir para linha" #: ulng.rseditnewfile msgid "new.txt" msgstr "novo.txt" #: ulng.rseditnewfilename msgid "Filename:" msgstr "Nome de ficheiro:" #: ulng.rseditnewopen msgid "Open file" msgstr "Abrir ficheiro" #: ulng.rseditsearchback msgid "&Backward" msgstr "&Recuar" #: ulng.rseditsearchcaption msgctxt "ulng.rseditsearchcaption" msgid "Search" msgstr "Procurar" #: ulng.rseditsearchfrw msgid "&Forward" msgstr "&Avançar" #: ulng.rseditsearchreplace msgctxt "ulng.rseditsearchreplace" msgid "Replace" msgstr "Substituir" #: ulng.rseditwithexternaleditor msgid "with external editor" msgstr "com editor externo" #: ulng.rseditwithinternaleditor msgid "with internal editor" msgstr "com editor interno" #: ulng.rsexecuteviashell msgctxt "ulng.rsexecuteviashell" msgid "Execute via shell" msgstr "Executar via shell" #: ulng.rsexecuteviaterminalclose msgctxt "ulng.rsexecuteviaterminalclose" msgid "Execute via terminal and close" msgstr "Executar via terminal e fechar" #: ulng.rsexecuteviaterminalstayopen msgctxt "ulng.rsexecuteviaterminalstayopen" msgid "Execute via terminal and stay open" msgstr "Executar via terminal e manter aberto" #: ulng.rsfavtabspanelsideselection msgid "Left;Right;Active;Inactive;Both;None" msgstr "Esquerdo;Direito;Activo;Inactivo;Ambos;Nenhum" #: ulng.rsfavtabssavedirhistory msgid "No;Yes" msgstr "Não;Sim" #: ulng.rsfilenameexportedtcbarprefix msgid "Exported_from_DC" msgstr "Exportado_Do_DC" #: ulng.rsfileopdirectoryexistsoptions msgid "Ask;Merge;Skip" msgstr "Perguntar;Unir;Saltar" #: ulng.rsfileopfileexistsoptions msgid "Ask;Overwrite;Overwrite Older;Skip" msgstr "Perguntar;Sobrescrever;Sobrescrever mais antigos;Saltar" #: ulng.rsfileopsetpropertyerroroptions msgctxt "ulng.rsfileopsetpropertyerroroptions" msgid "Ask;Don't set anymore;Ignore errors" msgstr "Perguntar;Não definir mais;Ignorar erros" #: ulng.rsfilterstatus msgid "FILTER" msgstr "FILTRO" #: ulng.rsfinddefinetemplate msgid "Define template" msgstr "Definir modelo" #: ulng.rsfinddepth msgid "%s level(s)" msgstr "%s nível(is)" #: ulng.rsfinddepthall msgid "all (unlimited depth)" msgstr "todos (profundidade ilimitada)" #: ulng.rsfinddepthcurdir msgid "current dir only" msgstr "só pasta actual" #: ulng.rsfinddirnoex msgid "Directory %s does not exist!" msgstr "A pasta %s não existe!" #: ulng.rsfindfound msgctxt "ulng.rsfindfound" msgid "Found: %d" msgstr "Encontrados: %d" #: ulng.rsfindsavetemplatecaption msgid "Save search template" msgstr "Gravar modelo de procura" #: ulng.rsfindsavetemplatetitle msgid "Template name:" msgstr "Nome do modelo:" #: ulng.rsfindscanned msgctxt "ulng.rsfindscanned" msgid "Scanned: %d" msgstr "Pesquisado: %d" #: ulng.rsfindscanning msgid "Scanning" msgstr "A pesquisar" #: ulng.rsfindsearchfiles msgctxt "ulng.rsfindsearchfiles" msgid "Find files" msgstr "Localizar ficheiros" #: ulng.rsfindtimeofscan msgid "Time of scan: " msgstr "Hora da digitalização: " #: ulng.rsfindwherebeg msgid "Begin at" msgstr "Iniciar em" #: ulng.rsfreemsg msgid "Free %s from %s bytes" msgstr "Livres %s de %s bytes" #: ulng.rsfreemsgshort msgid "%s bytes free" msgstr "%s bytes livres" #: ulng.rsfuncatime msgid "Access date/time" msgstr "Aceder a data/hora" #: ulng.rsfuncattr msgctxt "ulng.rsfuncattr" msgid "Attributes" msgstr "Atributos" #: ulng.rsfunccomment msgctxt "ulng.rsfunccomment" msgid "Comment" msgstr "Comentário" #: ulng.rsfunccompressedsize msgid "Compressed size" msgstr "Tamanho comprimido" #: ulng.rsfuncctime msgid "Creation date/time" msgstr "Data/hora de criação" #: ulng.rsfuncext msgid "Extension" msgstr "Extensão" #: ulng.rsfuncgroup msgctxt "ulng.rsfuncgroup" msgid "Group" msgstr "Grupo" #: ulng.rsfunchtime msgid "Change date/time" msgstr "Alterar data/hora" #: ulng.rsfunclinkto msgid "Link to" msgstr "Ligar a" #: ulng.rsfuncmtime msgid "Modification date/time" msgstr "Data/hora de modificação" #: ulng.rsfuncname msgctxt "ulng.rsfuncname" msgid "Name" msgstr "Nome" #: ulng.rsfuncnamenoext msgid "Name without extension" msgstr "Nome sem extensão" #: ulng.rsfuncowner msgctxt "ulng.rsfuncowner" msgid "Owner" msgstr "Proprietário" #: ulng.rsfuncpath msgctxt "ulng.rsfuncpath" msgid "Path" msgstr "Caminho" #: ulng.rsfuncsize msgctxt "ulng.rsfuncsize" msgid "Size" msgstr "Tamanho" #: ulng.rsfunctype msgid "Type" msgstr "Tipo" #: ulng.rsharderrcreate msgid "Error creating hardlink." msgstr "Erro ao criar ligação física" #: ulng.rshotdirforcesortingorderchoices msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9" msgstr "Nenhuma;Nome, a-z;Nome, z-a;Ext, a-z;Ext, z-a;Tam 9-0;Tam 0-9;Data 9-0;Data 0-9" #: ulng.rshotdirwarningabortrestorebackup msgid "" "Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n" "\n" "Are you sure you want to proceed?\n" msgstr "" "Aviso! Ao restaurar uma segurança .hotlist, a lista existente será apagada pela importada.\n" "\n" "Tem a certeza que quer continuar?\n" #: ulng.rshotkeycategorycopymovedialog msgid "Copy/Move Dialog" msgstr "Diálogo Copiar/Mover" #: ulng.rshotkeycategorydiffer msgctxt "ulng.rshotkeycategorydiffer" msgid "Differ" msgstr "Diferenciar" #: ulng.rshotkeycategoryeditcommentdialog msgid "Edit Comment Dialog" msgstr "Diálogo Editar comentário" #: ulng.rshotkeycategoryeditor msgctxt "ulng.rshotkeycategoryeditor" msgid "Editor" msgstr "Editor" #: ulng.rshotkeycategoryfindfiles msgctxt "ulng.rshotkeycategoryfindfiles" msgid "Find files" msgstr "Localizar ficheiros" #: ulng.rshotkeycategorymain msgid "Main" msgstr "Principal" #: ulng.rshotkeycategorysyncdirs msgid "Synchronize Directories" msgstr "" #: ulng.rshotkeycategoryviewer msgctxt "ulng.rshotkeycategoryviewer" msgid "Viewer" msgstr "Visualizador" #: ulng.rshotkeyfilealreadyexists msgid "" "A setup with that name already exists.\n" "Do you want to overwrite it?\n" msgstr "" "Já existe uma configuração com esse nome.\n" "Deseja sobrescrevê-la?\n" #: ulng.rshotkeyfileconfirmdefault msgid "Are you sure you want to restore default?" msgstr "Tem a certeza de que deseja repor a predefinição?" #: ulng.rshotkeyfileconfirmerasure msgid "Are you sure you want to erase setup \"%s\"?" msgstr "Tem a certeza de que deseja apagar a configuração \"%s\"?" #: ulng.rshotkeyfilecopyof msgid "Copy of %s" msgstr "Cópia de %s" #: ulng.rshotkeyfileinputnewname msgid "Input your new name" msgstr "Insira o seu novo nome" #: ulng.rshotkeyfilemustkeepone msgid "You must keep at least one shortcut file." msgstr "Tem de ter pelo menos um ficheiro de atalhos." #: ulng.rshotkeyfilenewname msgid "New name" msgstr "Novo nome" #: ulng.rshotkeyfilesavemodified msgid "" "\"%s\" setup has been modified.\n" "Do you want to save it now?\n" msgstr "" "A configuração \"%s\" foi modificada.\n" "Deseja gravá-la agora?\n" #: ulng.rshotkeynoscenter msgid "No shortcut with \"ENTER\"" msgstr "Sem atalho com \"ENTER\"" #: ulng.rshotkeysortorder msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)" msgstr "Por nome de comando;Por tecla de atalho (agrupado);Por tecla de atalho (um por linha)" #: ulng.rsimporttoolbarproblem msgid "Cannot find reference to default bar file" msgstr "Impossível encontrar referências ao ficheiro predefinido" #: ulng.rslistoffindfileswindows msgid "List of \"Find files\" windows" msgstr "Lista de janelas \"Localizar ficheiros\"" #: ulng.rsmarkminus msgid "Unselect mask" msgstr "Desseleccionar máscara" #: ulng.rsmarkplus msgid "Select mask" msgstr "Seleccionar máscara" #: ulng.rsmaskinput msgid "Input mask:" msgstr "Máscara de entrada:" #: ulng.rsmenuconfigurecolumnsalreadyexists msgid "A columns view with that name already exists." msgstr "Já existe uma vista em colunas com esse nome." #: ulng.rsmenuconfigurecolumnssavetochange msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one" msgstr "Para alterar edição da vista em colunas actual, GRAVE, COPIE ou ELIMINE a edição actual" #: ulng.rsmenuconfigurecustomcolumns msgid "Configure custom columns" msgstr "Configurar colunas personalizadas" #: ulng.rsmenuconfigureentercustomcolumnname msgid "Enter new custom columns name" msgstr "Insira o novo nome das colunas" #: ulng.rsmnuactions msgctxt "ulng.rsmnuactions" msgid "Actions" msgstr "Acções" #: ulng.rsmnucontentdefault msgid "" msgstr "" #: ulng.rsmnucontentoctal msgid "Octal" msgstr "" #: ulng.rsmnucopynetnamestoclip msgid "Copy names with UNC path" msgstr "Copiar nomes com caminho UNC" #: ulng.rsmnudisconnectnetworkdrive msgid "Disconnect Network Drive..." msgstr "Desligar unidade de rede..." #: ulng.rsmnuedit msgctxt "ulng.rsmnuedit" msgid "Edit" msgstr "Editar" #: ulng.rsmnueject msgid "Eject" msgstr "Ejectar" #: ulng.rsmnuextracthere msgid "Extract here..." msgstr "Extrair aqui..." #: ulng.rsmnumapnetworkdrive msgid "Map Network Drive..." msgstr "Mapear unidade de rede..." #: ulng.rsmnumount msgid "Mount" msgstr "Montar" #: ulng.rsmnunew msgctxt "ulng.rsmnunew" msgid "New" msgstr "Novo" #: ulng.rsmnunomedia msgid "No media available" msgstr "Sem suporte disponível" #: ulng.rsmnuopen msgctxt "ulng.rsmnuopen" msgid "Open" msgstr "Abrir" #: ulng.rsmnuopenwith msgid "Open with" msgstr "Abrir com" #: ulng.rsmnuopenwithother msgctxt "ulng.rsmnuopenwithother" msgid "Other..." msgstr "Outro..." #: ulng.rsmnupackhere msgid "Pack here..." msgstr "Comprimir aqui..." #: ulng.rsmnusortby msgid "Sort by" msgstr "Ordenar por" #: ulng.rsmnuumount msgid "Unmount" msgstr "Desmontar" #: ulng.rsmnuview msgctxt "ulng.rsmnuview" msgid "View" msgstr "Ver" #: ulng.rsmsgaccount msgid "Account:" msgstr "Conta:" #: ulng.rsmsgalldcintcmds msgid "All Double Commander internal commands" msgstr "Todos os comandos internos do Double Commander" #: ulng.rsmsgarchivercustomparams msgid "Additional parameters for archiver command-line:" msgstr "Parâmetros adicionais da linha de comandos do arquivador:" #: ulng.rsmsgaskquoteornot msgid "Do you want to enclose between quotes?" msgstr "Deseja pôr entre aspas?" #: ulng.rsmsgbadcrc32 msgid "" "Bad CRC32 for resulting file:\n" "\"%s\"\n" "\n" "Do you want to keep the resulting corrupted file anyway?\n" msgstr "" "CRC32 errado no ficheiro resultante:\n" "\"%s\"\n" "\n" "Quer manter o ficheiro resultante corrompido?\n" #: ulng.rsmsgcannotcopymoveitself msgid "You can not copy/move a file \"%s\" to itself!" msgstr "Não pode copiar/mover um ficheiro \"%s\" para si próprio!" #: ulng.rsmsgcannotdeletedirectory msgid "Cannot delete directory %s" msgstr "Impossível eliminar a pasta %s" #: ulng.rsmsgcannotoverwritedirectory msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\"" msgstr "Impossível sobrescrever a pasta \"%s\" com a não-pasta \"%s\"" #: ulng.rsmsgchdirfailed msgid "ChDir to [%s] failed!" msgstr "ChDir para [%s] falhou!" #: ulng.rsmsgcloseallinactivetabs msgid "Remove all inactive tabs?" msgstr "Remover os separadores inactivos?" #: ulng.rsmsgcloselockedtab msgid "This tab (%s) is locked! Close anyway?" msgstr "Este separador (%s) está bloqueado! Fechar mesmo assim?" #: ulng.rsmsgcofirmuserparam msgid "Confirmation of parameter" msgstr "Confirmação do parâmetro" #: ulng.rsmsgconfirmquit msgid "Are you sure you want to quit?" msgstr "Tem a certeza que quer sair?" #: ulng.rsmsgcopybackward msgid "The file %s has changed. Do you want to copy it backward?" msgstr "O ficheiro %s foi alterado. Quer repor a cópia anterior?" #: ulng.rsmsgcouldnotcopybackward msgid "Could not copy backward - do you want to keep the changed file?" msgstr "Impossível repor a cópia anterior - quer manter o ficheiro alterado?" #: ulng.rsmsgcpfldr msgid "Copy %d selected files/directories?" msgstr "Copiar %d ficheiros/pastas seleccionados?" #: ulng.rsmsgcpsel msgid "Copy selected \"%s\"?" msgstr "Copiar \"%s\" seleccionados?" #: ulng.rsmsgcreateanewfiletype msgid "< Create a new file type \"%s files\" >" msgstr "< Criar novo tipo de ficheiro \"ficheiros %s\" >" #: ulng.rsmsgdctoolbarwheretosave msgid "Enter location and filename where to save a DC Toolbar file" msgstr "Insira caminho e nome do ficheiro para gravar a barra do DC" #: ulng.rsmsgdefaultcustomactionname msgid "Custom action" msgstr "Acção personalizada" #: ulng.rsmsgdeletepartiallycopied msgid "Delete the partially copied file ?" msgstr "Eliminar o ficheiro parcialmente copiado?" #: ulng.rsmsgdelfldr msgid "Delete %d selected files/directories?" msgstr "Eliminar %d ficheiros/pastas seleccionados?" #: ulng.rsmsgdelfldrt msgid "Delete %d selected files/directories into trash can?" msgstr "Eliminar %d ficheiros/pastas seleccionados para o lixo?" #: ulng.rsmsgdelsel msgid "Delete selected \"%s\"?" msgstr "Eliminar \"%s\" seleccionado?" #: ulng.rsmsgdelselt msgid "Delete selected \"%s\" into trash can?" msgstr "Eliminar \"%s\" seleccionados para o lixo?" #: ulng.rsmsgdeltotrashforce msgid "Can not delete \"%s\" to trash! Delete directly?" msgstr "Impossível mover \"%s\" para o lixo! Eliminar directamente?" #: ulng.rsmsgdisknotavail msgid "Disk is not available" msgstr "O disco não está disponível" #: ulng.rsmsgentercustomaction msgid "Enter custom action name:" msgstr "Insira o nome da acção:" #: ulng.rsmsgenterfileext msgid "Enter file extension:" msgstr "Insira a extensão do ficheiro:" #: ulng.rsmsgentername msgid "Enter name:" msgstr "Insira o nome:" #: ulng.rsmsgenternewfiletypename msgid "Enter name of new file type to create for extension \"%s\"" msgstr "Insira o nome do novo tipo de ficheiro para a extensão \"%s\"" #: ulng.rsmsgerrbadarchive msgid "CRC error in archive data" msgstr "Erro CRC nos dados arquivados" #: ulng.rsmsgerrbaddata msgid "Data is bad" msgstr "Os dados estão mal" #: ulng.rsmsgerrcannotconnect msgid "Can not connect to server: \"%s\"" msgstr "Impossível ligar ao servidor: \"%s\"" #: ulng.rsmsgerrcannotcopyfile msgid "Cannot copy file %s to %s" msgstr "Impossível copiar o ficheiro %s para %s" #: ulng.rsmsgerrcreatefiledirectoryexists msgid "There already exists a directory named \"%s\"." msgstr "Já existe uma pasta chamada \"%s\"." #: ulng.rsmsgerrdatenotsupported msgid "Date %s is not supported" msgstr "Data %s não é suportada" #: ulng.rsmsgerrdirexists msgid "Directory %s exists!" msgstr "A pasta %s já existe!" #: ulng.rsmsgerreaborted msgid "Function aborted by user" msgstr "Função abortada pelo utilizador" #: ulng.rsmsgerreclose msgid "Error closing file" msgstr "Erro ao fechar o ficheiro" #: ulng.rsmsgerrecreate msgid "Cannot create file" msgstr "Impossível criar o ficheiro" #: ulng.rsmsgerrendarchive msgid "No more files in archive" msgstr "Não há mais ficheiros no arquivo" #: ulng.rsmsgerreopen msgid "Cannot open existing file" msgstr "Impossível abrir ficheiro existente" #: ulng.rsmsgerreread msgid "Error reading from file" msgstr "Erro ao ler o ficheiro" #: ulng.rsmsgerrewrite msgid "Error writing to file" msgstr "Erro ao escrever o ficheiro" #: ulng.rsmsgerrforcedir msgid "Can not create directory %s!" msgstr "Impossível criar a pasta %s!" #: ulng.rsmsgerrinvalidlink msgid "Invalid link" msgstr "Ligação inválida" #: ulng.rsmsgerrnofiles msgid "No files found" msgstr "Ficheiros não encontrados" #: ulng.rsmsgerrnomemory msgid "Not enough memory" msgstr "Memória insuficiente" #: ulng.rsmsgerrnotsupported msgid "Function not supported!" msgstr "Função não suportada!" #: ulng.rsmsgerrorincontextmenucommand msgid "Error in context menu command" msgstr "Erro no comando do menu contextual" #: ulng.rsmsgerrorloadingconfiguration msgid "Error when loading configuration" msgstr "Erro ao carregar a configuração" #: ulng.rsmsgerrregexpsyntax msgid "Syntax error in regular expression!" msgstr "Erro de sintaxe na expressão regular!" #: ulng.rsmsgerrrename msgid "Cannot rename file %s to %s" msgstr "Impossível renomear o ficheiro %s para %s" #: ulng.rsmsgerrsaveassociation msgid "Can not save association!" msgstr "Impossível gravar associação!" #: ulng.rsmsgerrsavefile msgid "Cannot save file" msgstr "Impossível gravar o ficheiro" #: ulng.rsmsgerrsetattribute msgid "Can not set attributes for \"%s\"" msgstr "Impossível definir atributos para \"%s\"" #: ulng.rsmsgerrsetdatetime msgid "Can not set date/time for \"%s\"" msgstr "Impossível definir data/hora para \"%s\"" #: ulng.rsmsgerrsetownership msgid "Can not set owner/group for \"%s\"" msgstr "Impossível definir proprietário/grupo para \"%s\"" #: ulng.rsmsgerrsetpermissions msgid "Can not set permissions for \"%s\"" msgstr "Impossível definir permissões para \"%s\"" #: ulng.rsmsgerrsmallbuf msgid "Buffer too small" msgstr "Buffer demasiado pequeno" #: ulng.rsmsgerrtoomanyfiles msgid "Too many files to pack" msgstr "Demasiados ficheiros para empacotar" #: ulng.rsmsgerrunknownformat msgid "Archive format unknown" msgstr "Formato de arquivo desconhecido" #: ulng.rsmsgfavoritetabsdeleteallentries msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)" msgstr "Tem a certeza qie quer remover todas as entradas dos seus separadores favoritos? Não poderá desfazer a acção!" #: ulng.rsmsgfavoritetabsdraghereentry msgid "Drag here other entries" msgstr "Arraste para aqui outras entradas" #: ulng.rsmsgfavoritetabsentername msgid "Enter a name this Favorite Tabs entry" msgstr "Insira um nome para esta entrada" #: ulng.rsmsgfavoritetabsenternametitle msgid "Saving a new Favorite Tabs entry" msgstr "A gravar a nova entrada nos favoritos" #: ulng.rsmsgfavoritetabsexportedsuccessfully msgid "Number of Favorite Tabs exported successfully: %d on %d" msgstr "Nº de separadores favoritos exportados com êxito: %d de %d" #: ulng.rsmsgfavoritetabsextramode msgid "Default extra setting for save dir history for new Favorite Tabs:" msgstr "Predefinição extra para gravar histórico nos novos separadores favoritos:" #: ulng.rsmsgfavoritetabsimportedsuccessfully msgid "Number of file(s) imported successfully: %d on %d" msgstr "Número de ficheiros importados com êxito: %d de %d" #: ulng.rsmsgfavoritetabsimportsubmenuname msgid "Legacy tabs imported" msgstr "Separadores antigos importados" #: ulng.rsmsgfavoritetabsimporttitle msgid "Select .tab file(s) to import (could be more than one at the time!)" msgstr "Escolha o ficheiro .tab a importar (podem ser vários em simultâneo)!" #: ulng.rsmsgfavoritetabsmodifiednoimport msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?" msgstr "A última modificação aos favoritos ainda não foi gravada. Quer gravá-la antes de continuar?" #: ulng.rsmsgfavoritetabssimplemode msgctxt "ulng.rsmsgfavoritetabssimplemode" msgid "Keep saving dir history with Favorite Tabs:" msgstr "Continuar a gravar o histórico com os favoritos:" #: ulng.rsmsgfavoritetabssubmenuname msgctxt "ulng.rsmsgfavoritetabssubmenuname" msgid "Submenu name" msgstr "Nome do sub-menu" #: ulng.rsmsgfavoritetabsthiswillloadfavtabs msgid "This will load the Favorite Tabs: \"%s\"" msgstr "Assim vai carregar o favorito: \"%s\"" #: ulng.rsmsgfavortietabssaveoverexisting msgid "Save current tabs over existing Favorite Tabs entry" msgstr "Gravar separadores actuais sobre uma entrada de favoritos existente" #: ulng.rsmsgfilechangedsave msgid "File %s changed, save?" msgstr "O ficheiro %s foi alterado! Gravar?" #: ulng.rsmsgfileexistsfileinfo msgid "%s bytes, %s" msgstr "%s bytes, %s" #: ulng.rsmsgfileexistsoverwrite msgid "Overwrite:" msgstr "Sobrescrever:" #: ulng.rsmsgfileexistsrwrt msgid "File %s exists, overwrite?" msgstr "O ficheiro %s já existe! Sobrescrever?" #: ulng.rsmsgfileexistswithfile msgid "With file:" msgstr "Pelo ficheiro:" #: ulng.rsmsgfilenotfound msgid "File \"%s\" not found." msgstr "Ficheiro \"%s\" não encontrado" #: ulng.rsmsgfileoperationsactive msgid "File operations active" msgstr "Operações de ficheiro activas" #: ulng.rsmsgfileoperationsactivelong msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss." msgstr "Há algumas operações de ficheiro por terminar. Fechar o Double Commander pode resultar em perda de dados." #: ulng.rsmsgfilepathovermaxpath msgid "" "The target name length (%d) is more than %d characters!\n" "%s\n" "Most programs will not be able to access a file/directory with such a long name!\n" msgstr "" "O tamanho no nome destino (%d) tem mais de %d caracteres!\n" "%s\n" "A maioria dos programas não poderá aceder a ficheiros/pastas com nomes tao grandes!\n" #: ulng.rsmsgfilereadonly msgid "File %s is marked as read-only/hidden/system. Delete it?" msgstr "O ficheiro %s é só de leitura(oculto/de sistema. Eliminá-lo?" #: ulng.rsmsgfilereloadwarning msgid "Are you sure you want to reload the current file and lose the changes?" msgstr "" #: ulng.rsmsgfilesizetoobig msgid "The file size of \"%s\" is too big for destination file system!" msgstr "O tamanho de \"%s\" é demasiado grande para o sistema de ficheiros destino!" #: ulng.rsmsgfolderexistsrwrt msgid "Folder %s exists, merge?" msgstr "A pasta %s já existe! Unir?" #: ulng.rsmsgfollowsymlink msgid "Follow symlink \"%s\"?" msgstr "Seguir ligação simbólica \"%s\"?" #: ulng.rsmsgfortextformattoimport msgid "Select the text format to import" msgstr "Seleccione o formato de texto a importar" #: ulng.rsmsghotdiraddselecteddirectories msgid "Add %d selected dirs" msgstr "Adicionar %d pastas seleccionadas" #: ulng.rsmsghotdiraddselecteddirectory msgid "Add selected dir: " msgstr "Adicionar pasta seleccionada: " #: ulng.rsmsghotdiraddthisdirectory msgid "Add current dir: " msgstr "Adicionar pasta atual: " #: ulng.rsmsghotdircommandname msgid "Do command" msgstr "Comando" #: ulng.rsmsghotdircommandsample msgid "cm_somthing" msgstr "cm_algo" #: ulng.rsmsghotdirconfighotlist msgctxt "ulng.rsmsghotdirconfighotlist" msgid "Configuration of Directory Hotlist" msgstr "Configuração da lista de pastas" #: ulng.rsmsghotdirdeleteallentries msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)" msgstr "Tem a certeza que quer remover todas as entradas da sua lista de pastas? Não poderá desfazer a acção!" #: ulng.rsmsghotdirdemocommand msgid "This will execute the following command:" msgstr "Assim vai executar o seguinte comando:" #: ulng.rsmsghotdirdemoname msgid "This is hot dir named " msgstr "Esta é a pasta chamada " #: ulng.rsmsghotdirdemopath msgid "This will change active frame to the following path:" msgstr "Assim vai alterar o painel activo para o seguinte caminho:" #: ulng.rsmsghotdirdemotarget msgid "And inactive frame would change to the following path:" msgstr "E o painel inactivo mudará para o seguinte caminho:" #: ulng.rsmsghotdirerrorbackuping msgid "Error backuping entries..." msgstr "Erro na segurança das entradas..." #: ulng.rsmsghotdirerrorexporting msgid "Error exporting entries..." msgstr "Erro ao exportar entradas..." #: ulng.rsmsghotdirexportall msgid "Export all!" msgstr "Exportar tudo!" #: ulng.rsmsghotdirexporthotlist msgid "Export Directory Hotlist - Select the entries you want to export" msgstr "Exportar lista de pastas - escolha as entradas que quer exportar" #: ulng.rsmsghotdirexportsel msgid "Export selected" msgstr "Exportar escolhidas" #: ulng.rsmsghotdirimportall msgctxt "ulng.rsmsghotdirimportall" msgid "Import all!" msgstr "Importar tudo!" #: ulng.rsmsghotdirimporthotlist msgid "Import Directory Hotlist - Select the entries you want to import" msgstr "Importar lista de pastas - escolha as entradas que quer importar" #: ulng.rsmsghotdirimportsel msgctxt "ulng.rsmsghotdirimportsel" msgid "Import selected" msgstr "Importar escolhidas" #: ulng.rsmsghotdirjustpath msgctxt "ulng.rsmsghotdirjustpath" msgid "&Path:" msgstr "Caminho" #: ulng.rsmsghotdirlocatehotlistfile msgid "Locate \".hotlist\" file to import" msgstr "Localizar ficheiro .hotlist a importar" #: ulng.rsmsghotdirname msgid "Hotdir name" msgstr "Noma da lista" #: ulng.rsmsghotdirnbnewentries msgid "Number of new entries: %d" msgstr "Nº de novas entradas : %d" #: ulng.rsmsghotdirnothingtoexport msgid "Nothing selected to export!" msgstr "Nada escolhido para exportar!" #: ulng.rsmsghotdirpath msgid "Hotdir path" msgstr "Caminho da lista" #: ulng.rsmsghotdirreaddselecteddirectory msgid "Re-Add selected dir: " msgstr "Adicionar de novo a pasta escolhida: " #: ulng.rsmsghotdirreaddthisdirectory msgid "Re-Add current dir: " msgstr "Adicionar de novo a pasta actual: " #: ulng.rsmsghotdirrestorewhat msgid "Enter location and filename of Directory Hotlist to restore" msgstr "Insira a localização e nome da lista de pastas a restaurar" #: ulng.rsmsghotdirsimplecommand msgctxt "ulng.rsmsghotdirsimplecommand" msgid "Command:" msgstr "Comando:" #: ulng.rsmsghotdirsimpleendofmenu msgctxt "ulng.rsmsghotdirsimpleendofmenu" msgid "(end of sub menu)" msgstr "(fim do sub-menu)" #: ulng.rsmsghotdirsimplemenu msgctxt "ulng.rsmsghotdirsimplemenu" msgid "Menu &name:" msgstr "Nome do menu:" #: ulng.rsmsghotdirsimplename msgctxt "ulng.rsmsghotdirsimplename" msgid "&Name:" msgstr "Nome:" #: ulng.rsmsghotdirsimpleseparator msgctxt "ulng.rsmsghotdirsimpleseparator" msgid "(separator)" msgstr "(separador)" #: ulng.rsmsghotdirsubmenuname msgctxt "ulng.rsmsghotdirsubmenuname" msgid "Submenu name" msgstr "Nome do sub-menu" #: ulng.rsmsghotdirtarget msgid "Hotdir target" msgstr "Alvo da lista de pastas" #: ulng.rsmsghotdirtiporderpath msgid "Determine if you want the active frame to be sorted in a specified order after changing directory" msgstr "Determine se quer que o painel activo seja ordenado de forma especificada após alterar a pasta" #: ulng.rsmsghotdirtipordertarget msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory" msgstr "Determine se quer que o painel inactivo seja ordenado de forma especificada após alterar a pasta" #: ulng.rsmsghotdirtipspecialdirbut msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc." msgstr "Algumas funções para seleccionar caminho relativo, absoluto, pastas especiais, etc." #: ulng.rsmsghotdirtotalbackuped msgid "" "Total entries saved: %d\n" "\n" "Backup filename: %s\n" msgstr "" "Nº de entradas gravadas: %d\n" "\n" "Nome da segurança: %s\n" #: ulng.rsmsghotdirtotalexported msgid "Total entries exported: " msgstr "Nº de entradas exportadas: " #: ulng.rsmsghotdirwhattodelete msgid "" "Do you want to delete all elements inside the sub-menu [%s]?\n" "Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n" msgstr "" "Quer eliminar todos os elementos do sub-menu [%s]?\n" "Responder NÃO elimina só os delimitadores de menu e mantém os elementos no sub-menu.\n" #: ulng.rsmsghotdirwheretosave msgid "Enter location and filename where to save a Directory Hotlist file" msgstr "Insira a localização e nome da lista de pastas a gravar" #: ulng.rsmsgincorrectfilelength msgid "Incorrect resulting filelength for file : \"%s\"" msgstr "Tamanho do ficheiro \"%s\" resultante incorrecto" #: ulng.rsmsginsertnextdisk msgid "" "Please insert next disk or something similar.\n" "\n" "It is to allow writing this file:\n" "\"%s\"\n" "\n" "Number of bytes still to write: %d\n" msgstr "" "Por favor, insira o volume seguinte.\n" "\n" "É para permitir escrever este ficheiro:\n" "\"%s\"\n" "\n" "Nº de bytes ainda por escrever: %d\n" #: ulng.rsmsginvalidcommandline msgid "Error in command line" msgstr "Erro na linha de comandos" #: ulng.rsmsginvalidfilename msgid "Invalid filename" msgstr "Nome de ficheiro inválido" #: ulng.rsmsginvalidformatofconfigurationfile msgid "Invalid format of configuration file" msgstr "Formato do ficheiro de configuração inválido" #: ulng.rsmsginvalidhexnumber msgid "Invalid hexadecimal number: \"%s\"" msgstr "" #: ulng.rsmsginvalidpath msgid "Invalid path" msgstr "Caminho inválido" #: ulng.rsmsginvalidpathlong msgid "Path %s contains forbidden characters." msgstr "O caminho %s contém caracteres proibidos." #: ulng.rsmsginvalidplugin msgid "This is not a valid plugin!" msgstr "Esta não é uma extensão válida!" #: ulng.rsmsginvalidpluginarchitecture msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!" msgstr "Esta extensão é feita para o Double Commander para %s.%s, não pode trabalhar com o Double Commander para %s!" #: ulng.rsmsginvalidquoting msgid "Invalid quoting" msgstr "Aspas inválidas" #: ulng.rsmsginvalidselection msgid "Invalid selection." msgstr "Selecção inválida." #: ulng.rsmsgloadingfilelist msgid "Loading file list..." msgstr "A carregar lista de ficheiros..." #: ulng.rsmsglocatetcconfiguation msgid "Locate TC configuration file (wincmd.ini)" msgstr "Localizar ficheiro do TC (wincmd.ini)" #: ulng.rsmsglocatetcexecutable msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)" msgstr "Localizar executável do TC (totalcmd.exe ou totalcmd64.exe)" #: ulng.rsmsglogcopy msgid "Copy file %s" msgstr "Copiar ficheiro %s" #: ulng.rsmsglogdelete msgid "Delete file %s" msgstr "Eliminar ficheiro %s" #: ulng.rsmsglogerror msgid "Error: " msgstr "Erro: " #: ulng.rsmsglogextcmdlaunch msgid "Launch external" msgstr "Iniciar externo" #: ulng.rsmsglogextcmdresult msgid "Result external" msgstr "Resultado externo" #: ulng.rsmsglogextract msgid "Extract file %s" msgstr "Extrair ficheiro %s" #: ulng.rsmsgloginfo msgid "Info: " msgstr "Informação:" #: ulng.rsmsgloglink msgid "Create link %s" msgstr "Criar ligação %s" #: ulng.rsmsglogmkdir msgid "Create directory %s" msgstr "Criar pasta %s" #: ulng.rsmsglogmove msgid "Move file %s" msgstr "Mover ficheiro %s" #: ulng.rsmsglogpack msgid "Pack to file %s" msgstr "Comprimir para ficheiro %s" #: ulng.rsmsglogrmdir msgid "Remove directory %s" msgstr "Remover pasta %s" #: ulng.rsmsglogsuccess msgid "Done: " msgstr "Feito:" #: ulng.rsmsglogsymlink msgid "Create symlink %s" msgstr "Criar ligação simbólica %s" #: ulng.rsmsglogtest msgid "Test file integrity %s" msgstr "Testar integridade do ficheiro %s" #: ulng.rsmsglogwipe msgid "Wipe file %s" msgstr "Limpar ficheiro %s" #: ulng.rsmsglogwipedir msgid "Wipe directory %s" msgstr "Limpar pasta %s" #: ulng.rsmsgmasterpassword msgid "Master Password" msgstr "Senha mestra" #: ulng.rsmsgmasterpasswordenter msgid "Please enter the master password:" msgstr "Por favor insira a senha mestra:" #: ulng.rsmsgnewfile msgid "New file" msgstr "Novo ficheiro" #: ulng.rsmsgnextvolunpack msgid "Next volume will be unpacked" msgstr "O próximo volume será descomprimido" #: ulng.rsmsgnofiles msgid "No files" msgstr "Sem ficheiros" #: ulng.rsmsgnofilesselected msgid "No files selected." msgstr "Sem ficheiros seleccionados" #: ulng.rsmsgnofreespacecont msgid "No enough free space on target drive, Continue?" msgstr "Não há espaço suficiente no destino! Continuar?" #: ulng.rsmsgnofreespaceretry msgid "No enough free space on target drive, Retry?" msgstr "Não há espaço suficiente no destino! Tentar novamente?" #: ulng.rsmsgnotdelete msgid "Can not delete file %s" msgstr "Impossível eliminar o ficheiro %s" #: ulng.rsmsgnotimplemented msgid "Not implemented." msgstr "Não implementado." #: ulng.rsmsgobjectnotexists msgid "Object does not exist!" msgstr "O objecto não existe!" #: ulng.rsmsgpanelpreview msgctxt "ulng.rsmsgpanelpreview" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "Abaixo está uma antevisão. Mova o cursor e seleccione ficheiros para ver imediatament o aspecto das várias definições." #: ulng.rsmsgpassword msgid "Password:" msgstr "Senha:" #: ulng.rsmsgpassworddiff msgid "Passwords are different!" msgstr "As senhas são diferentes!" #: ulng.rsmsgpasswordenter msgid "Please enter the password:" msgstr "Por favor, insira a senha:" #: ulng.rsmsgpasswordfirewall msgid "Password (Firewall):" msgstr "Senha (Firewall):" #: ulng.rsmsgpasswordverify msgid "Please re-enter the password for verification:" msgstr "Por favor reinsira a senha para verificação:" #: ulng.rsmsgpopuphotdelete msgid "&Delete %s" msgstr "&Eliminar %s" #: ulng.rsmsgpresetalreadyexists msgid "Preset \"%s\" already exists. Overwrite?" msgstr "Predefinição \"%s\" já existe! Substituir?" #: ulng.rsmsgproblemexecutingcommand msgid "Problem executing command (%s)" msgstr "Problema ao executar o comando (%s)" #: ulng.rsmsgpromptaskingfilename msgid "Filename for dropped text:" msgstr "Nome de ficheiro para o texto:" #: ulng.rsmsgprovidethisfile msgid "Please, make this file available. Retry?" msgstr "Por favor, disponibilize este ficheiro. Tentar novamente?" #: ulng.rsmsgrenamefavtabs msgid "Enter new friendly name for this Favorite Tabs" msgstr "Insira novo nome amigável para estes favoritos" #: ulng.rsmsgrenamefavtabsmenu msgid "Enter new name for this menu" msgstr "Insira novo nome para este menu" #: ulng.rsmsgrenfldr msgid "Rename/move %d selected files/directories?" msgstr "Renomear/Mover %d ficheiros/pastas seleccionados?" #: ulng.rsmsgrensel msgid "Rename/move selected \"%s\"?" msgstr "Renomear/Mover \"%s\" seleccionados?" #: ulng.rsmsgrestartforapplychanges msgid "Please, restart Double Commander in order to apply changes" msgstr "Por favor, reinicie o Double Commander para aplicar as alterações" #: ulng.rsmsgsekectfiletype msgid "Select to which file type to add extension \"%s\"" msgstr "Seleccione a que tipo de ficheiro adicionar a extensão \"%s\"" #: ulng.rsmsgselectedinfo msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d" msgstr "Seleccionados: %s de %s, ficheiros: %d de %d, pastas: %d de %d" #: ulng.rsmsgselectexecutablefile msgid "Select executable file for" msgstr "Seleccione executável para" #: ulng.rsmsgselectonlychecksumfiles msgid "Please select only checksum files!" msgstr "Por favor, seleccione só ficheiros checksum" #: ulng.rsmsgsellocnextvol msgid "Please select location of next volume" msgstr "Por favor, seleccione a localização do próximo volume" #: ulng.rsmsgsetvolumelabel msgid "Set volume label" msgstr "Definir rótulo do volume" #: ulng.rsmsgspecialdir msgid "Special Dirs" msgstr "Pastas especiais" #: ulng.rsmsgspecialdiraddacti msgid "Add path from active frame" msgstr "Adicionar caminho do painel activo" #: ulng.rsmsgspecialdiraddnonacti msgid "Add path from inactive frame" msgstr "Adicionar caminho do painel inactivo" #: ulng.rsmsgspecialdirbrowssel msgid "Browse and use selected path" msgstr "Procurar e usar caminho seleccionado" #: ulng.rsmsgspecialdirenvvar msgid "Use environment variable..." msgstr "Usar variável de ambiente..." #: ulng.rsmsgspecialdirgotodc msgid "Go to Double Commander special path..." msgstr "Ir para caminho especial do Double Commander..." #: ulng.rsmsgspecialdirgotoenvvar msgid "Go to environment variable..." msgstr "Ir para variável de ambiente..." #: ulng.rsmsgspecialdirgotoother msgid "Go to other Windows special folder..." msgstr "Ir para outra pasta especial do Windows..." #: ulng.rsmsgspecialdirgototc msgid "Go to Windows special folder (TC)..." msgstr "Ir para pasta especial do Windows (TC)..." #: ulng.rsmsgspecialdirmakereltohotdir msgid "Make relative to hotdir path" msgstr "Tornar relativa ao caminho da lista" #: ulng.rsmsgspecialdirmkabso msgid "Make path absolute" msgstr "Tornar caminho absoluto" #: ulng.rsmsgspecialdirmkdcrel msgid "Make relative to Double Commander special path..." msgstr "Tornar relativo ao caminho especial do Double Commander..." #: ulng.rsmsgspecialdirmkenvrel msgid "Make relative to environment variable..." msgstr "Tornar relativo a variável de ambiente..." #: ulng.rsmsgspecialdirmktctel msgid "Make relative to Windows special folder (TC)..." msgstr "Tornar relativo a pasta especial do Windows (TC)..." #: ulng.rsmsgspecialdirmkwnrel msgid "Make relative to other Windows special folder..." msgstr "Tornar relativo a outra pasta especial do Windows..." #: ulng.rsmsgspecialdirusedc msgid "Use Double Commander special path..." msgstr "Usar caminho especial do Double Commander..." #: ulng.rsmsgspecialdirusehotdir msgid "Use hotdir path" msgstr "Usar caminho da lista" #: ulng.rsmsgspecialdiruseother msgid "Use other Windows special folder..." msgstr "Usar outra pasta especial do Windows..." #: ulng.rsmsgspecialdirusetc msgid "Use Windows special folder (TC)..." msgstr "Usar pasta especial do Windows (TC)..." #: ulng.rsmsgtabforopeninginnewtab msgid "This tab (%s) is locked! Open directory in another tab?" msgstr "Este separador (%s) está bloqueado! Abrir pasta noutro separador?" #: ulng.rsmsgtabrenamecaption msgid "Rename tab" msgstr "Renomear separador" #: ulng.rsmsgtabrenameprompt msgid "New tab name:" msgstr "Novo nome do separador:" #: ulng.rsmsgtargetdir msgid "Target path:" msgstr "Caminho destino:" #: ulng.rsmsgtcconfignotfound msgid "" "Error! Cannot find the TC configuration file:\n" "%s\n" msgstr "" "Erro! impossível modificar a pasta de configuração do TC:\n" "%s\n" #: ulng.rsmsgtcexecutablenotfound msgid "" "Error! Cannot find the TC configuration executable:\n" "%s\n" msgstr "" "Erro! impossível encontrar o executável de configuração do TC:\n" "%s\n" #: ulng.rsmsgtcisrunning msgid "" "Error! TC is still running but it should be closed for this operation.\n" "Close it and press OK or press CANCEL to abort.\n" msgstr "" "Erro! O TC ainda está em execução mas tem de ser fechado para esta operação.\n" "Feche-o e clique em Aceitar ou clique em Cancelar.\n" #: ulng.rsmsgtctoolbarnotfound msgid "" "Error! Cannot find the desired wanted TC toolbar output folder:\n" "%s\n" msgstr "" "Erro! impossível encontrar a pasta de saída da barra do TC:\n" "%s\n" #: ulng.rsmsgtctoolbarwheretosave msgid "Enter location and filename where to save a TC Toolbar file" msgstr "Insira localização e nome do ficheiro onde gravar a barra do TC" #: ulng.rsmsgthisisnowinclipboard msgid "\"%s\" is now in the clipboard" msgstr "\"%s\" está agora na área de transferência" #: ulng.rsmsgtitleextnotinfiletype msgid "Extension of selected file is not in any recognized file types" msgstr "A extensão do ficheiro seleccionado não é de tipo reconhecido" #: ulng.rsmsgtoolbarlocatedctoolbarfile msgid "Locate \".toolbar\" file to import" msgstr "Localize o ficheiro \".toolbar\" a importar" #: ulng.rsmsgtoolbarlocatetctoolbarfile msgid "Locate \".BAR\" file to import" msgstr "Localize o ficheiro \".BAR\" a importar" #: ulng.rsmsgtoolbarrestorewhat msgid "Enter location and filename of Toolbar to restore" msgstr "Insira localização e nome do ficheiro a restaurar" #: ulng.rsmsgtoolbarsaved msgid "" "Saved!\n" "Toolbar filename: %s\n" msgstr "" "Gravado!\n" "Nome do ficheiro: %s\n" #: ulng.rsmsgtoomanyfilesselected msgid "Too many files selected." msgstr "Demasiados ficheiros seleccionados." #: ulng.rsmsgundeterminednumberoffile msgid "Undetermined" msgstr "Indeterminado" #: ulng.rsmsgunexpectedusagetreeviewmenu msgid "ERROR: Unexpected Tree View Menu usage!" msgstr "ERRO: utilização de menu de árvore inesperada!" #: ulng.rsmsgurl msgid "URL:" msgstr "URL:" #: ulng.rsmsguserdidnotsetextension msgid "" msgstr "" #: ulng.rsmsguserdidnotsetname msgid "" msgstr ">SEM NOME>" #: ulng.rsmsgusername msgid "User name:" msgstr "Utilizador:" #: ulng.rsmsgusernamefirewall msgid "User name (Firewall):" msgstr "Utilizador (Firewall):" #: ulng.rsmsgverify msgid "VERIFICATION:" msgstr "" #: ulng.rsmsgverifywrong msgid "The target file is corrupted, checksum mismatch!" msgstr "" #: ulng.rsmsgvolumelabel msgid "Volume label:" msgstr "Rótulo do volume:" #: ulng.rsmsgvolumesizeenter msgid "Please enter the volume size:" msgstr "Por favor, insira o tamanho do volume:" #: ulng.rsmsgwipefldr msgid "Wipe %d selected files/directories?" msgstr "Limpar %d ficheiros/pastas seleccionados?" #: ulng.rsmsgwipesel msgid "Wipe selected \"%s\"?" msgstr "Limpar \"%s\" seleccionados?" #: ulng.rsmsgwithactionwith msgid "with" msgstr "com" #: ulng.rsmsgwrongpasswordtryagain msgid "" "Wrong password!\n" "Please try again!\n" msgstr "" #: ulng.rsmulrenautorename msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?" msgstr "Renomear automaticamente \"nome (1).ext\", \"nome (2).ext\" etc.?" #: ulng.rsmulrenfilenamestylelist msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;" msgstr "Sem alteração;MAIÚSCULAS;minúsculas;Primeira maiúscula;Primeira De Todas As Palavras Maiúscula;" #: ulng.rsmulrenwarningduplicate msgid "Warning, duplicate names!" msgstr "Aviso, nomes duplicados!" #: ulng.rsmulrenwronglinesnumber msgid "File contains wrong number of lines: %d, should be %d!" msgstr "Nº de linhas errado no ficheiro: %d, deveria ser %d!" #: ulng.rsnewsearchclearfilteroptions msgid "Keep;Clear;Prompt" msgstr "Manter;Limpar;Perguntar" #: ulng.rsnoequivalentinternalcommand msgid "No internal equivalent command" msgstr "Sem comando interno equivalente" #: ulng.rsnofindfileswindowyet msgid "Sorry, no \"Find files\" window yet..." msgstr "Desculpe, ainda não há \"Localizar ficheiros\"..." #: ulng.rsnootherfindfileswindowtoclose msgid "Sorry, no other \"Find files\" window to close and free from memory..." msgstr "Desculpe, não há mais \"Localizar ficheiros\" para fechar e libertar memória..." #: ulng.rsopenwithdevelopment msgid "Development" msgstr "" #: ulng.rsopenwitheducation msgid "Education" msgstr "" #: ulng.rsopenwithgames msgid "Games" msgstr "" #: ulng.rsopenwithgraphics #, fuzzy msgctxt "ulng.rsopenwithgraphics" msgid "Graphics" msgstr "Gráficos" #: ulng.rsopenwithmultimedia msgid "Multimedia" msgstr "" #: ulng.rsopenwithnetwork #, fuzzy msgctxt "ulng.rsopenwithnetwork" msgid "Network" msgstr "Rede" #: ulng.rsopenwithoffice msgid "Office" msgstr "" #: ulng.rsopenwithother #, fuzzy msgctxt "ulng.rsopenwithother" msgid "Other" msgstr "Outro" #: ulng.rsopenwithscience msgid "Science" msgstr "" #: ulng.rsopenwithsettings msgid "Settings" msgstr "" #: ulng.rsopenwithsystem #, fuzzy msgctxt "ulng.rsopenwithsystem" msgid "System" msgstr "Sistema" #: ulng.rsopenwithutility msgid "Accessories" msgstr "" #: ulng.rsoperaborted msgid "Aborted" msgstr "Abortado" #: ulng.rsopercalculatingchecksum msgid "Calculating checksum" msgstr "A calcular a checksum" #: ulng.rsopercalculatingchecksumin msgid "Calculating checksum in \"%s\"" msgstr "A calcular a checksum em \"%s\"" #: ulng.rsopercalculatingchecksumof msgid "Calculating checksum of \"%s\"" msgstr "A calcular a checksum de \"%s\"" #: ulng.rsopercalculatingstatictics msgctxt "ulng.rsopercalculatingstatictics" msgid "Calculating" msgstr "A calcular" #: ulng.rsopercalculatingstatisticsin msgid "Calculating \"%s\"" msgstr "A calcular \"%s\"" #: ulng.rsopercombining msgid "Joining" msgstr "A juntar" #: ulng.rsopercombiningfromto msgid "Joining files in \"%s\" to \"%s\"" msgstr "A juntar ficheiros em \"%s\" para \"%s\"" #: ulng.rsopercopying msgid "Copying" msgstr "A copiar" #: ulng.rsopercopyingfromto msgid "Copying from \"%s\" to \"%s\"" msgstr "A copiar de \"%s\" para \"%s\"" #: ulng.rsopercopyingsomethingto msgid "Copying \"%s\" to \"%s\"" msgstr "copiar \"%s\" para \"%s\"" #: ulng.rsopercreatingdirectory msgid "Creating directory" msgstr "A criar pasta" #: ulng.rsopercreatingsomedirectory msgid "Creating directory \"%s\"" msgstr "A criar pasta \"%s\"" #: ulng.rsoperdeleting msgctxt "ulng.rsoperdeleting" msgid "Deleting" msgstr "A eliminar" #: ulng.rsoperdeletingin msgid "Deleting in \"%s\"" msgstr "A eliminar em \"%s\"" #: ulng.rsoperdeletingsomething msgid "Deleting \"%s\"" msgstr "Eliminar \"%s\"" #: ulng.rsoperexecuting msgid "Executing" msgstr "A executar" #: ulng.rsoperexecutingsomething msgid "Executing \"%s\"" msgstr "A executar \"%s\"" #: ulng.rsoperextracting msgid "Extracting" msgstr "A extrair" #: ulng.rsoperextractingfromto msgid "Extracting from \"%s\" to \"%s\"" msgstr "A extrair de \"%s\" para \"%s\"" #: ulng.rsoperfinished msgid "Finished" msgstr "Terminado" #: ulng.rsoperlisting msgid "Listing" msgstr "A listar" #: ulng.rsoperlistingin msgid "Listing \"%s\"" msgstr "A listar \"%s\"" #: ulng.rsopermoving msgid "Moving" msgstr "A mover" #: ulng.rsopermovingfromto msgid "Moving from \"%s\" to \"%s\"" msgstr "A mover de \"%s\" para \"%s\"" #: ulng.rsopermovingsomethingto msgid "Moving \"%s\" to \"%s\"" msgstr "A mover \"%s\" para \"%s\"" #: ulng.rsopernotstarted msgid "Not started" msgstr "Não iniciado" #: ulng.rsoperpacking msgid "Packing" msgstr "A comprimir" #: ulng.rsoperpackingfromto msgid "Packing from \"%s\" to \"%s\"" msgstr "A comprimir de \"%s\" para \"%s\"" #: ulng.rsoperpackingsomethingto msgid "Packing \"%s\" to \"%s\"" msgstr "A comprimir \"%s\" para \"%s\"" #: ulng.rsoperpaused msgid "Paused" msgstr "Pausado" #: ulng.rsoperpausing msgid "Pausing" msgstr "A pausar" #: ulng.rsoperrunning msgid "Running" msgstr "A executar" #: ulng.rsopersettingproperty msgid "Setting property" msgstr "Definir propriedade" #: ulng.rsopersettingpropertyin msgid "Setting property in \"%s\"" msgstr "Definir propriedade em \"%s\"" #: ulng.rsopersettingpropertyof msgid "Setting property of \"%s\"" msgstr "Definir propriedade de \"%s\"" #: ulng.rsopersplitting msgid "Splitting" msgstr "A dividir" #: ulng.rsopersplittingfromto msgid "Splitting \"%s\" to \"%s\"" msgstr "A dividir \"%s\" para \"%s\"" #: ulng.rsoperstarting msgid "Starting" msgstr "A iniciar" #: ulng.rsoperstopped msgid "Stopped" msgstr "Parado" #: ulng.rsoperstopping msgid "Stopping" msgstr "A parar" #: ulng.rsopertesting msgid "Testing" msgstr "A testar" #: ulng.rsopertestingin msgid "Testing in \"%s\"" msgstr "A testar em \"%s\"" #: ulng.rsopertestingsomething msgid "Testing \"%s\"" msgstr "A testar \"%s\"" #: ulng.rsoperverifyingchecksum msgid "Verifying checksum" msgstr "A verificar a checksum" #: ulng.rsoperverifyingchecksumin msgid "Verifying checksum in \"%s\"" msgstr "A verificar a checksum em \"%s\"" #: ulng.rsoperverifyingchecksumof msgid "Verifying checksum of \"%s\"" msgstr "A verificar a checksum de \"%s\"" #: ulng.rsoperwaitingforconnection msgid "Waiting for access to file source" msgstr "A aguardar acesso à origem do ficheiro" #: ulng.rsoperwaitingforfeedback msgid "Waiting for user response" msgstr "A aguardar resposta do utilizador" #: ulng.rsoperwiping msgid "Wiping" msgstr "A limpar" #: ulng.rsoperwipingin msgid "Wiping in \"%s\"" msgstr "A limpar em \"%s\"" #: ulng.rsoperwipingsomething msgid "Wiping \"%s\"" msgstr "A limpar \"%s\"" #: ulng.rsoperworking msgid "Working" msgstr "A trabalhar" #: ulng.rsoptaddfrommainpanel msgid "Add at &beginning;Add at the end;Smart add" msgstr "Adicionar no início;Adicionar no fim;Adicionar inteligente" #: ulng.rsoptarchiveconfiguresavetochange msgid "To change current editing archive configuration, either APPLY or DELETE current editing one" msgstr "" #: ulng.rsoptarchiveradditonalcmd msgid "Mode dependent, additional command" msgstr "" #: ulng.rsoptarchiveraddonlynotempty msgid "Add if it is non-empty" msgstr "" #: ulng.rsoptarchiverarchivel msgid "Archive File (long name)" msgstr "" #: ulng.rsoptarchiverarchiver msgid "Select archiver executable" msgstr "" #: ulng.rsoptarchiverarchives msgid "Archive file (short name)" msgstr "" #: ulng.rsoptarchiverchangeencoding msgid "Change Archiver Listing Encoding" msgstr "" #: ulng.rsoptarchiverconfirmdelete msgid "Are you sure you want to delete: %s" msgstr "" #: ulng.rsoptarchiverdefaultexportfilename msgid "Exported Archiver Configuration" msgstr "" #: ulng.rsoptarchivererrorlevel msgid "errorlevel" msgstr "" #: ulng.rsoptarchiverexportcaption msgid "Export archiver configuration" msgstr "" #: ulng.rsoptarchiverexportdone msgid "Exportation of %d elements to file \"%s\" completed." msgstr "" #: ulng.rsoptarchiverexportprompt msgid "Select the one(s) you want to export" msgstr "" #: ulng.rsoptarchiverfilelistl msgid "Filelist (long names)" msgstr "" #: ulng.rsoptarchiverfilelists msgid "Filelist (short names)" msgstr "" #: ulng.rsoptarchiverimportcaption msgid "Import archiver configuration" msgstr "" #: ulng.rsoptarchiverimportdone msgid "Importation of %d elements from file \"%s\" completed." msgstr "" #: ulng.rsoptarchiverimportfile msgid "Select the file to import archiver configuration(s)" msgstr "" #: ulng.rsoptarchiverimportprompt msgid "Select the one(s) you want to import" msgstr "" #: ulng.rsoptarchiverjustname msgid "Use name only, without path" msgstr "" #: ulng.rsoptarchiverjustpath msgid "Use path only, without name" msgstr "" #: ulng.rsoptarchiverprograml msgid "Archive Program (long name)" msgstr "" #: ulng.rsoptarchiverprograms msgid "Archive Program (short name)" msgstr "" #: ulng.rsoptarchiverquoteall msgid "Quote all names" msgstr "" #: ulng.rsoptarchiverquotewithspace msgid "Quote names with spaces" msgstr "" #: ulng.rsoptarchiversinglefprocess msgid "Single filename to process" msgstr "" #: ulng.rsoptarchivertargetsubdir msgid "Target subdirecory" msgstr "" #: ulng.rsoptarchiveruseansi msgid "Use ANSI encoding" msgstr "" #: ulng.rsoptarchiveruseutf8 msgid "Use UTF8 encoding" msgstr "" #: ulng.rsoptarchiverwheretosave msgid "Enter location and filename where to save archiver configuration" msgstr "" #: ulng.rsoptarchivetypename msgid "Archive type name:" msgstr "Nome do tipo de arquivo:" #: ulng.rsoptassocpluginwith msgid "Associate plugin \"%s\" with:" msgstr "Associar suplemento \"%s\" com:" #: ulng.rsoptautosizecolumn msgid "First;Last;" msgstr "Primeiro;Último;" #: ulng.rsoptconfigsortorder msgid "Classic, legacy order;Alphabetic order (but language still first)" msgstr "Clássica, ordem antiga;Ordem alfabética (idioma sempre primeiro)" #: ulng.rsoptdifferframeposition msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right" msgstr "Painel activo à esquerda, inactivo à direita (antigo);Painel esquerdo à esquerda, direito à direita" #: ulng.rsoptdisable msgid "Disable" msgstr "Desactivar" #: ulng.rsoptenable msgctxt "ulng.rsoptenable" msgid "Enable" msgstr "Activar" #: ulng.rsoptenterext msgid "Enter extension" msgstr "Insira extensão" #: ulng.rsoptfavoritetabswheretoaddinlist msgid "Add at beginning;Add at the end;Alphabetical sort" msgstr "Adicionar no início;Adicionar no fim;ordem alfabética" #: ulng.rsoptfileoperationsprogresskind msgid "separate window;minimized separate window;operations panel" msgstr "Janela separada;Janela separada minimizada;Painel de operações" #: ulng.rsoptfilesizeformat msgid "float;B;K;M;G" msgstr "Flutuante;B;K;M;G" #: ulng.rsopthotkeysadddeleteshortcutlong msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting." msgstr "Atalho %s para cm_Delete será registado, pelo que poderá ser usado para reverter esta definição." #: ulng.rsopthotkeysaddhotkey msgid "Add hotkey for %s" msgstr "Adicionar atalho para %s" #: ulng.rsopthotkeysaddshortcutbutton msgid "Add shortcut" msgstr "Adicionar atalho" #: ulng.rsopthotkeyscannotsetshortcut msgid "Cannot set shortcut" msgstr "Impossível definir atalho" #: ulng.rsopthotkeyschangeshortcut msgid "Change shortcut" msgstr "Alterar atalho" #: ulng.rsopthotkeyscommand msgctxt "ulng.rsopthotkeyscommand" msgid "Command" msgstr "Comando" #: ulng.rsopthotkeysdeletetrashcanoverrides msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides" msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?" msgstr "Atalho %s para cm_Delete tem um parâmetro que se sobrepõe a esta definição. Quer alterar o parâmetro para usar a definição global?" #: ulng.rsopthotkeysdeletetrashcanparameterexists msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists" msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?" msgstr "Atalho %s para cm_Delete tem de ter um parâmetro alterado para corresponder ao atalho %s. Quer alterá-lo?" #: ulng.rsopthotkeysdescription msgctxt "ulng.rsopthotkeysdescription" msgid "Description" msgstr "Descrição" #: ulng.rsopthotkeysedithotkey msgid "Edit hotkey for %s" msgstr "Editar atalho para %s" #: ulng.rsopthotkeysfixparameter msgid "Fix parameter" msgstr "Fixar parâmetro" #: ulng.rsopthotkeyshotkey msgctxt "ulng.rsopthotkeyshotkey" msgid "Hotkey" msgstr "Atalho" #: ulng.rsopthotkeyshotkeys msgctxt "ulng.rsopthotkeyshotkeys" msgid "Hotkeys" msgstr "Atalhos" #: ulng.rsopthotkeysnohotkey msgid "" msgstr "" #: ulng.rsopthotkeysparameters msgctxt "ulng.rsopthotkeysparameters" msgid "Parameters" msgstr "Parâmetros" #: ulng.rsopthotkeyssetdeleteshortcut msgid "Set shortcut to delete file" msgstr "Definir atalho para eliminar ficheiro" #: ulng.rsopthotkeysshortcutfordeletealreadyassigned msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?" msgstr "Para esta definição funcionar com o atalho %s, o atalho %s tem de ser atribuído a cm_Delete, mas já está atribuído a %s. Quer alterá-lo?" #: ulng.rsopthotkeysshortcutfordeleteissequence msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work." msgstr "Atalho %s para cm_Delete é uma sequência para a qual uma tecla de atalho com Shift revertido não pode ser atribuída. Esta definição pode não funcionar." #: ulng.rsopthotkeysshortcutused msgid "Shortcut in use" msgstr "Atalho em uso" #: ulng.rsopthotkeysshortcutusedtext1 msgid "Shortcut %s is already used." msgstr "Atalho %s já está em uso." #: ulng.rsopthotkeysshortcutusedtext2 msgid "Change it to %s?" msgstr "Alterar para %s?" #: ulng.rsopthotkeysusedby msgid "used for %s in %s" msgstr "usado para %s em %s" #: ulng.rsopthotkeysusedwithdifferentparams msgid "used for this command but with different parameters" msgstr "usado por este comando mas com parâmetros diferentes" #: ulng.rsoptionseditorarchivers msgctxt "ulng.rsoptionseditorarchivers" msgid "Archivers" msgstr "Arquivadores" #: ulng.rsoptionseditorautorefresh msgctxt "ulng.rsoptionseditorautorefresh" msgid "Auto refresh" msgstr "Actualizar automaticamente" #: ulng.rsoptionseditorbehavior msgctxt "ulng.rsoptionseditorbehavior" msgid "Behaviors" msgstr "Comportamentos" #: ulng.rsoptionseditorbriefview msgctxt "ulng.rsoptionseditorbriefview" msgid "Brief" msgstr "Breve" #: ulng.rsoptionseditorcolors msgctxt "ulng.rsoptionseditorcolors" msgid "Colors" msgstr "Cores" #: ulng.rsoptionseditorcolumnsview msgid "Columns" msgstr "Colunas" #: ulng.rsoptionseditorconfiguration msgctxt "ulng.rsoptionseditorconfiguration" msgid "Configuration" msgstr "Configuração" #: ulng.rsoptionseditorcustomcolumns msgid "Custom columns" msgstr "Personalizar colunas" #: ulng.rsoptionseditordirectoryhotlist msgctxt "ulng.rsoptionseditordirectoryhotlist" msgid "Directory Hotlist" msgstr "Lista de pastas" #: ulng.rsoptionseditordraganddrop msgid "Drag & drop" msgstr "Arrastar & Largar" #: ulng.rsoptionseditordriveslistbutton msgid "Drives list button" msgstr "Botão da lista de unidades" #: ulng.rsoptionseditorfavoritetabs msgid "Favorite Tabs" msgstr "Separadores favoritos" #: ulng.rsoptionseditorfileassicextra msgid "File associations extra" msgstr "Associações extra de ficheiros" #: ulng.rsoptionseditorfileassoc msgctxt "ulng.rsoptionseditorfileassoc" msgid "File associations" msgstr "Associações de ficheiros" #: ulng.rsoptionseditorfilenewfiletypes msgctxt "ulng.rsoptionseditorfilenewfiletypes" msgid "New" msgstr "Novo" #: ulng.rsoptionseditorfileoperations msgctxt "ulng.rsoptionseditorfileoperations" msgid "File operations" msgstr "Operações de ficheiros" #: ulng.rsoptionseditorfilepanels msgctxt "ulng.rsoptionseditorfilepanels" msgid "File panels" msgstr "Painéis de ficheiros" #: ulng.rsoptionseditorfilesearch msgctxt "ulng.rsoptionseditorfilesearch" msgid "File search" msgstr "Procurar ficheiro" #: ulng.rsoptionseditorfilesviews msgid "Files views" msgstr "Vistas de ficheiros" #: ulng.rsoptionseditorfiletypes msgctxt "ulng.rsoptionseditorfiletypes" msgid "File types" msgstr "Tipos de ficheiros" #: ulng.rsoptionseditorfoldertabs msgctxt "ulng.rsoptionseditorfoldertabs" msgid "Folder tabs" msgstr "Separadores de pastas" #: ulng.rsoptionseditorfoldertabsextra msgid "Folder tabs extra" msgstr "Separadores extra de pastas" #: ulng.rsoptionseditorfonts msgctxt "ulng.rsoptionseditorfonts" msgid "Fonts" msgstr "Letras" #: ulng.rsoptionseditorhighlighters msgid "Highlighters" msgstr "Realces" #: ulng.rsoptionseditorhotkeys msgctxt "ulng.rsoptionseditorhotkeys" msgid "Hot keys" msgstr "Atalhos" #: ulng.rsoptionseditoricons msgctxt "ulng.rsoptionseditoricons" msgid "Icons" msgstr "Ícones" #: ulng.rsoptionseditorignorelist msgctxt "ulng.rsoptionseditorignorelist" msgid "Ignore list" msgstr "Lista Ignorar" #: ulng.rsoptionseditorkeyboard msgid "Keys" msgstr "Teclas" #: ulng.rsoptionseditorlanguage msgctxt "ulng.rsoptionseditorlanguage" msgid "Language" msgstr "Idioma" #: ulng.rsoptionseditorlayout msgctxt "ulng.rsoptionseditorlayout" msgid "Layout" msgstr "Disposição" #: ulng.rsoptionseditorlog msgctxt "ulng.rsoptionseditorlog" msgid "Log" msgstr "Diário" #: ulng.rsoptionseditormiscellaneous msgctxt "ulng.rsoptionseditormiscellaneous" msgid "Miscellaneous" msgstr "Vários" #: ulng.rsoptionseditormouse msgid "Mouse" msgstr "Rato" #: ulng.rsoptionseditoroptionschanged msgid "" "Options have changed in \"%s\"\n" "\n" "Do you want to save modifications?\n" msgstr "" "As opções em \"%s\" foram alteradas.\n" "\n" "Deseja gravar as alterações?\n" #: ulng.rsoptionseditorplugins msgctxt "ulng.rsoptionseditorplugins" msgid "Plugins" msgstr "Extensões" #: ulng.rsoptionseditorquicksearch msgctxt "ulng.rsoptionseditorquicksearch" msgid "Quick search/filter" msgstr "Procura/Filtragem rápida" #: ulng.rsoptionseditorterminal msgctxt "ulng.rsoptionseditorterminal" msgid "Terminal" msgstr "Terminal" #: ulng.rsoptionseditortoolbar msgid "Toolbar" msgstr "Barra de ferramentas" #: ulng.rsoptionseditortools msgctxt "ulng.rsoptionseditortools" msgid "Tools" msgstr "Ferramentas" #: ulng.rsoptionseditortooltips msgctxt "ulng.rsoptionseditortooltips" msgid "Tooltips" msgstr "Sugestões" #: ulng.rsoptionseditortreeviewmenu msgctxt "ulng.rsoptionseditortreeviewmenu" msgid "Tree View Menu" msgstr "Menu de árvore" #: ulng.rsoptionseditortreeviewmenucolors msgid "Tree View Menu Colors" msgstr "Cores do menu de árvore" #: ulng.rsoptletters msgid "None;Command Line;Quick Search;Quick Filter" msgstr "Nenhuma;Linha de comandos;Procura rápida;Filtragem rápida" #: ulng.rsoptmouseselectionbutton msgid "Left button;Right button;" msgstr "Botão esquerdo;Botão direito;" #: ulng.rsoptnewfilesposition msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list" msgstr "Ao cimo da lista de ficheiros;Após as pastas (se as pastas estão ordenadas antes dos ficheiros);Na posição ordenada;No final da lista de ficheiros" #: ulng.rsoptpluginalreadyassigned msgid "Plugin %s is already assigned for the following extensions:" msgstr "A extensão %s já está atribuída às seguintes extensões:" #: ulng.rsoptpluginsactive msgctxt "ulng.rsoptpluginsactive" msgid "Active" msgstr "Activo" #: ulng.rsoptpluginsfilename msgctxt "ulng.rsoptpluginsfilename" msgid "File name" msgstr "Nome de ficheiro" #: ulng.rsoptpluginsname msgctxt "ulng.rsoptpluginsname" msgid "Name" msgstr "Nome" #: ulng.rsoptpluginsregisteredfor msgctxt "ulng.rsoptpluginsregisteredfor" msgid "Registered for" msgstr "Registado para" #: ulng.rsoptsearchcase msgid "&Sensitive;&Insensitive" msgstr "&Sensível;&Insensível" #: ulng.rsoptsearchitems msgid "&Files;Di&rectories;Files a&nd Directories" msgstr "&Ficheiros;Pa&stas;Ficheiros e &pastas" #: ulng.rsoptsearchopt msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session" msgstr "Ocultar painel de filtra&gem quando sem foco;Manter modificações de definições para a sessão seguinte" #: ulng.rsoptsortcasesens msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)" msgstr "Não sensível a maiúsculas;De acordo com definições regionais (aAbBcC);Primeiro maiúsculas, depois minúsculas (ABCabc)" #: ulng.rsoptsortfoldermode msgid "sort by name and show first;sort like files and show first;sort like files" msgstr "Ordenar por nome e mostrar o primeiro;Ordenar como ficheiros e mostrar o primeiro;Ordenar como ficheiros" #: ulng.rsoptsortmethod msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers" msgstr "Alfabética, considerando acentos;Ordem natural;Alfabética e números" #: ulng.rsopttabsposition msgid "Top;Bottom;" msgstr "Cimo;Fundo;" #: ulng.rsopttoolbarbuttontype msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u" msgstr "S&eparador;Comando inte&rno;Comando e&xterno;Men&u" #: ulng.rsopttypeofduplicatedrename msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext" msgstr "DC clássico - Copiar (x) nome_fich.ext;Windows - nome_fich (x).ext;Outros - nome_fich(x).ext" #: ulng.rsoptupdatedfilesposition msgid "don't change position;use the same setting as for new files;to sorted position" msgstr "Não alterar posição;Usar a definição para novos ficheiros;Para a posição ordenada" #: ulng.rspropscontains msgid "Files: %d, folders: %d" msgstr "Ficheiros: %d, pastas: %d" #: ulng.rspropserrchmod msgid "Can not change access rights for \"%s\"" msgstr "Impossível alterar direitos de acesso a \"%s\"" #: ulng.rspropserrchown msgid "Can not change owner for \"%s\"" msgstr "Impossível alterar proprietário de \"%s\"" #: ulng.rspropsfile msgctxt "ulng.rspropsfile" msgid "File" msgstr "Ficheiro" #: ulng.rspropsfolder msgctxt "ulng.rspropsfolder" msgid "Directory" msgstr "Pasta" #: ulng.rspropsnmdpipe msgid "Named pipe" msgstr "Linha nomeada" #: ulng.rspropssocket msgid "Socket" msgstr "Socket" #: ulng.rspropsspblkdev msgid "Special block device" msgstr "Dispositivo de bloqueio especial" #: ulng.rspropsspchrdev msgid "Special character device" msgstr "Dispositivo de carácter especial" #: ulng.rspropssymlink msgid "Symbolic link" msgstr "Ligação simbólica" #: ulng.rspropsunknowntype msgid "Unknown type" msgstr "Tipo desconhecido" #: ulng.rssearchresult msgid "Search result" msgstr "Resultado da procura" #: ulng.rssearchstatus msgid "SEARCH" msgstr "PROCURAR" #: ulng.rssearchtemplateunnamed msgid "" msgstr "" #: ulng.rssearchwithdsxplugininprogress msgid "" "A file search using DSX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" "Já está em curso uma procura de ficheiro com a extensão DSX.\n" "Temos de deixar terminar essa antes de iniciar outra nova.\n" #: ulng.rssearchwithwdxplugininprogress msgid "" "A file search using WDX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" "Já está em curso uma procura de ficheiro com a extensão WDX.\n" "Temos de deixar terminar essa antes de iniciar outra nova.\n" #: ulng.rsselectdir msgid "Select a directory" msgstr "Seleccione uma pasta" #: ulng.rsselectyoufindfileswindow msgid "Select your window" msgstr "Seleccione a sua janela" #: ulng.rsshowhelpfor msgid "&Show help for %s" msgstr "Mo&strar ajuda para %s" #: ulng.rssimplewordall msgctxt "ulng.rssimplewordall" msgid "All" msgstr "Tudo" #: ulng.rssimplewordcategory msgctxt "ulng.rssimplewordcategory" msgid "Category" msgstr "Categoria" #: ulng.rssimplewordcolumnsingular msgid "Column" msgstr "Coluna" #: ulng.rssimplewordcommand msgctxt "ulng.rssimplewordcommand" msgid "Command" msgstr "Comando" #: ulng.rssimplewordfilename msgid "Filename" msgstr "Nome de ficheiro" #: ulng.rssimplewordfiles msgid "files" msgstr "ficheiros" #: ulng.rssimplewordletter msgid "Letter" msgstr "Carta" #: ulng.rssimplewordparameter msgid "Param" msgstr "Param" #: ulng.rssimplewordresult msgid "Result" msgstr "Resultado" #: ulng.rssimplewordworkdir msgid "WorkDir" msgstr "Pasta" #: ulng.rssizeunitbytes msgid "Bytes" msgstr "Bytes" #: ulng.rssizeunitgbytes msgctxt "ulng.rssizeunitgbytes" msgid "Gigabytes" msgstr "Gigabytes" #: ulng.rssizeunitkbytes msgctxt "ulng.rssizeunitkbytes" msgid "Kilobytes" msgstr "Kilobytes" #: ulng.rssizeunitmbytes msgctxt "ulng.rssizeunitmbytes" msgid "Megabytes" msgstr "Megabytes" #: ulng.rssizeunittbytes msgid "Terabytes" msgstr "Terabytes" #: ulng.rsspacemsg msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)" msgstr "Ficheiros: %d, pastas: %d, tamanho: %s (%s bytes)" #: ulng.rsspliterrdirectory msgid "Unable to create target directory!" msgstr "Impossível criar pasta destino!" #: ulng.rsspliterrfilesize msgid "Incorrect file size format!" msgstr "Formato de tamanho de ficheiro incorrecto!" #: ulng.rsspliterrsplitfile msgid "Unable to split the file!" msgstr "Impossível dividir o ficheiro!" #: ulng.rssplitmsgmanyparts msgid "The number of parts is more than 100! Continue?" msgstr "O número de partes é superior a 100! Continuar?" #: ulng.rssplitpredefinedsizes msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R" msgstr "Automático;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R" #: ulng.rssplitseldir msgid "Select directory:" msgstr "Pasta seleccionada:" #: ulng.rsstraccents msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ" msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ" #: ulng.rsstraccentsstripped msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE" msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE" #: ulng.rsstrpreviewjustpreview msgid "Just preview" msgstr "Só antevisão" #: ulng.rsstrpreviewothers msgid "Others" msgstr "Outros" #: ulng.rsstrpreviewsearchingletters msgid "OU" msgstr "OU" #: ulng.rsstrpreviewsidenote msgid "Side note" msgstr "Nota lateral" #: ulng.rsstrpreviewwordwithoutsearched1 msgid "Flat" msgstr "Plano" #: ulng.rsstrpreviewwordwithoutsearched2 msgid "Limited" msgstr "Limitado" #: ulng.rsstrpreviewwordwithoutsearched3 msgid "Simple" msgstr "Simples" #: ulng.rsstrpreviewwordwithsearched1 msgid "Fabulous" msgstr "Fabuloso" #: ulng.rsstrpreviewwordwithsearched2 msgid "Marvelous" msgstr "Maravilhoso" #: ulng.rsstrpreviewwordwithsearched3 msgid "Tremendous" msgstr "Tremendo" #: ulng.rsstrtvmchoosedirhistory msgid "Choose your directory from Dir History" msgstr "Escolha a sua pasta do histórico de pastas" #: ulng.rsstrtvmchoosefavoritetabs msgid "Choose you Favorite Tabs:" msgstr "Escolha os seus separadores favoritos:" #: ulng.rsstrtvmchoosefromcmdlinehistory msgid "Choose your command from Command Line History" msgstr "Escolha o seu comando do histórico de comandos" #: ulng.rsstrtvmchoosefrommainmenu msgid "Choose your action from Main Menu" msgstr "Escolha a sua acção do menu principal" #: ulng.rsstrtvmchoosefromtoolbar msgid "Choose your action from Maintool bar" msgstr "Escolha a sua acção da barra de ferramentas" #: ulng.rsstrtvmchoosehotdirectory msgid "Choose your directory from Hot Directory:" msgstr "Escolha a sua pasta da pasta quente:" #: ulng.rsstrtvmchooseviewhistory msgid "Choose your directory from File View History" msgstr "Escolha a sua pasta do histórico de ficheiros" #: ulng.rsstrtvmchooseyourfileordir msgid "Choose your file or your directory" msgstr "Escolha o seu ficheiro ou pasta" #: ulng.rssymerrcreate msgid "Error creating symlink." msgstr "Erro ao criar ligação simbólica" #: ulng.rssyndefaulttext msgctxt "ulng.rssyndefaulttext" msgid "Default text" msgstr "Texto predefinido" #: ulng.rssynlangplaintext msgctxt "ulng.rssynlangplaintext" msgid "Plain text" msgstr "Texto simples" #: ulng.rstabsactionondoubleclickchoices msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu" msgstr "Não fazer nada;Fechar separador;Aceder aos favoritos;Menu contextual" #: ulng.rstimeunitday msgctxt "ulng.rstimeunitday" msgid "Day(s)" msgstr "Dia(s)" #: ulng.rstimeunithour msgid "Hour(s)" msgstr "Hora(s)" #: ulng.rstimeunitminute msgid "Minute(s)" msgstr "Minuto(s)" #: ulng.rstimeunitmonth msgid "Month(s)" msgstr "Mês(es)" #: ulng.rstimeunitsecond msgid "Second(s)" msgstr "Segundo(s)" #: ulng.rstimeunitweek msgid "Week(s)" msgstr "Semana(s)" #: ulng.rstimeunityear msgid "Year(s)" msgstr "Ano(s)" #: ulng.rstitlerenamefavtabs msgid "Rename Favorite Tabs" msgstr "Renomear favoritos" #: ulng.rstitlerenamefavtabsmenu msgid "Rename Favorite Tabs sub-menu" msgstr "Sub-menu Renomear favoritos" #: ulng.rstooldiffer msgctxt "ulng.rstooldiffer" msgid "Differ" msgstr "Diferenciar" #: ulng.rstooleditor msgctxt "ulng.rstooleditor" msgid "Editor" msgstr "Editor" #: ulng.rstoolerroropeningdiffer msgid "Error opening differ" msgstr "Erro ao abrir Diferenciar" #: ulng.rstoolerroropeningeditor msgid "Error opening editor" msgstr "Erro ao abrir o editor" #: ulng.rstoolerroropeningterminal msgid "Error opening terminal" msgstr "Erro ao abrir o terminal" #: ulng.rstoolerroropeningviewer msgid "Error opening viewer" msgstr "Erro ao abrir o visualizador" #: ulng.rstoolterminal msgctxt "ulng.rstoolterminal" msgid "Terminal" msgstr "Terminal" #: ulng.rstoolviewer msgctxt "ulng.rstoolviewer" msgid "Viewer" msgstr "Visualizador" #: ulng.rsunhandledexceptionmessage msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program." msgstr "Por favor reporte este erro no rastreio de erros com uma descrição do que estava a fazer e o ficheiro seguinte: %sPrima %s para continuar ou %s para abortar o programa." #: ulng.rsvarbothpanelactivetoinactive msgid "Both panels, from active to inactive" msgstr "Ambos os painéis, activo -> inactivo" #: ulng.rsvarbothpanellefttoright msgid "Both panels, from left to right" msgstr "Ambos os painéis, esquerda -> direita" #: ulng.rsvarcurrentpath msgid "Path of panel" msgstr "Caminho do painel" #: ulng.rsvarencloseelement msgid "Enclose each name in brackets or what you want" msgstr "Cada nome entre parênteses ou o que quiser" #: ulng.rsvarfilenamenoext msgid "Just filename, no extension" msgstr "Só nome, sem extensão" #: ulng.rsvarfullpath msgid "Complete filename (path+filename)" msgstr "Nome completo (caminho e nome)" #: ulng.rsvarhelpwith msgid "Help with \"%\" variables" msgstr "Ajuda com variáveis \"%\"" #: ulng.rsvarinputparam msgid "Will request request user to enter a parameter with a default suggested value" msgstr "Pede ao utilizador que insira um parâmetro com um valor predefinido sugerido" #: ulng.rsvarleftpanel msgid "Left panel" msgstr "Painel esquerdo" #: ulng.rsvarlistfilename msgid "Temporary filename of list of filenames" msgstr "Nome ou lista de nomes de ficheiro temporários" #: ulng.rsvarlistfullfilename msgid "Temporary filename of list of complete filenames (path+filename)" msgstr "Nome ou lista de nomes completos de ficheiro temporários (caminho+nome)" #: ulng.rsvarlistinutf16 msgid "Filenames in list in UTF-16 with BOM" msgstr "Ficheiros na lista em UTF-16 com BOM" #: ulng.rsvarlistinutf16quoted msgid "Filenames in list in UTF-16 with BOM, inside double quotes" msgstr "Ficheiros na lista em UTF-16 com BOM, entre aspas" #: ulng.rsvarlistinutf8 msgid "Filenames in list in UTF-8" msgstr "Ficheiros na lista em UTF-8" #: ulng.rsvarlistinutf8quoted msgid "Filenames in list in UTF-8, inside double quotes" msgstr "Ficheiros na lista em UTF-8, entre aspas" #: ulng.rsvarlistrelativefilename msgid "Temporary filename of list of filenames with relative path" msgstr "Nome ou lista de nomes de ficheiro temporários com caminho relativo" #: ulng.rsvaronlyextension msgid "Only file extension" msgstr "Só extensão de ficheiro" #: ulng.rsvaronlyfilename msgid "Only filename" msgstr "Só nome de ficheiro" #: ulng.rsvarotherexamples msgid "Other example of what's possible" msgstr "Outro exemplo do que é possível" #: ulng.rsvarpath msgid "Path, without ending delimiter" msgstr "Caminho, com delimitador final" #: ulng.rsvarpercentchangetopound msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign" msgstr "Daqui até ao fim da linha, o indicador de variável percentagem é o sinal \"#\"" #: ulng.rsvarpercentsign msgid "Return the percent sign" msgstr "Devolver o sinal percentagem" #: ulng.rsvarpoundchangetopercent msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign" msgstr "Daqui até ao fim da linha, o indicador de variável percentagem é de novo o sinal \"%\"" #: ulng.rsvarprependelement msgid "Prepend each name with \"-a \" or what you want" msgstr "Prefixar cada nome com \"-a\" ou o que quiser" #: ulng.rsvarpromptuserforparam msgid "%[Prompt user for param;Default value proposed]" msgstr "%[Pedir parâmetro;Valor predefinido proposto]" #: ulng.rsvarrelativepathandfilename msgid "Filename with relative path" msgstr "Nome de ficheiro com caminho relativo" #: ulng.rsvarrightpanel msgid "Right panel" msgstr "Painel direito" #: ulng.rsvarsecondelementrightpanel msgid "Full path of second selected file in right panel" msgstr "Caminho completo do 2º ficheiro seleccionado no painel direito" #: ulng.rsvarshowcommandprior msgid "Show command prior execute" msgstr "Mostrar comando antes de executar" #: ulng.rsvarsimplemessage msgid "%[Simple message]" msgstr "%[Mensagem simples]" #: ulng.rsvarsimpleshowmessage msgid "Will show a simple message" msgstr "Mostra uma mensagem simples" #: ulng.rsvarsourcepanel msgid "Active panel (source)" msgstr "Painel activo (fonte)" #: ulng.rsvartargetpanel msgid "Inactive panel (target)" msgstr "Painel inactivo (destino)" #: ulng.rsvarwillbequoted msgid "Filenames will be quoted from here (default)" msgstr "Nomes de ficheiros entre aspas (predefinição)" #: ulng.rsvarwilldointerminal msgid "Command will be done in terminal, remaining opened at the end" msgstr "Comando executado no terminal, fica aberto quando terminar" #: ulng.rsvarwillhaveendingdelimiter msgid "Paths will have ending delimiter" msgstr "Caminhos terão delimitador final" #: ulng.rsvarwillnotbequoted msgid "Filenames will not be quoted from here" msgstr "Nomes de ficheiro sem aspas a partir daqui" #: ulng.rsvarwillnotdointerminal msgid "Command will be done in terminal, closed at the end" msgstr "Comando executado no terminal, fechado quando terminar" #: ulng.rsvarwillnothaveendingdelimiter msgid "Paths will not have ending delimiter (default)" msgstr "Caminhos não terão delimitador final (predefinição)" #: ulng.rsvfsnetwork msgctxt "ulng.rsvfsnetwork" msgid "Network" msgstr "Rede" #: ulng.rsviewabouttext msgid "Internal Viewer of Double Commander." msgstr "Visualizador interno do Double Commander." #: ulng.rsviewbadquality msgid "Bad Quality" msgstr "Má qualidade" #: ulng.rsviewencoding msgctxt "ulng.rsviewencoding" msgid "Encoding" msgstr "Codificação" #: ulng.rsviewimagetype msgid "Image Type" msgstr "Tipo de imagem" #: ulng.rsviewnewsize msgctxt "ulng.rsviewnewsize" msgid "New Size" msgstr "Novo tamanho" #: ulng.rsviewnotfound msgid "%s not found!" msgstr "%s não encontrado!" #: ulng.rsviewwithexternalviewer msgid "with external viewer" msgstr "com visualizador externo" #: ulng.rsviewwithinternalviewer msgid "with internal viewer" msgstr "com visualizador interno" #: ulng.rsxreplacements msgid "Number of replacement: %d" msgstr "Nº de substituição: %d" #: ulng.rszeroreplacement msgid "No replacement took place." msgstr "Não houve substituição."