msgid "" msgstr "" "Project-Id-Version: Double Commander 0.46 alpha\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: 2009-12-20 12:40+0300\n" "PO-Revision-Date: 2013-08-27 11:34+0100\n" "Last-Translator: Ahmet Çağlar \n" "Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=utf-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Native-Language: Türk\n" #: fsyncdirsdlg.rscomparingpercent msgid "Comparing... %d%% (ESC to cancel)" msgstr "" #: fsyncdirsdlg.rsdeleteright msgid "Right: Delete %d file(s)" msgstr "" #: fsyncdirsdlg.rsfilesfound msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)" msgstr "" #: fsyncdirsdlg.rslefttorightcopy msgid "Left to Right: Copy %d files, total size: %d bytes" msgstr "" #: fsyncdirsdlg.rsrighttoleftcopy msgid "Right to Left: Copy %d files, total size: %d bytes" msgstr "" #: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint msgid "Choose template..." msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption #, fuzzy #| msgid "Check free space" msgid "C&heck free space" msgstr "Boş alanı kontrol edin" #: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption msgid "Cop&y attributes" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption msgid "Copy o&wnership" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption msgid "Copy &permissions" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption #, fuzzy #| msgid "Correct links" msgid "Correct lin&ks" msgstr "Doğru bağlantılar" #: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption #, fuzzy #| msgid "Drop readonly flag" msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION" msgid "Drop readonly fla&g" msgstr "Salt okunur özniteliğini kaldır" #: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption msgid "E&xclude empty directories" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption #, fuzzy #| msgid "Follow links" msgid "Fo&llow links" msgstr "Bağlantıları İzle" #: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption msgid "&Reserve space" msgstr "" #: tfilesystemcopymoveoperationoptionsui.chkverify.caption msgid "&Verify" msgstr "" #: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint msgid "What to do when cannot set file time, attributes, etc." msgstr "" #: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption msgid "Use file template" msgstr "" #: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption #, fuzzy #| msgid "When directory exists" msgid "When dir&ectory exists" msgstr "Dizin mevcutsa" #: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption #, fuzzy #| msgid "When file exists" msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When &file exists" msgstr "Dosya mevcutsa" #: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption msgid "When ca&nnot set property" msgstr "" #: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption msgid "" msgstr "" #: tfrmabout.btnclose.caption msgctxt "tfrmabout.btnclose.caption" msgid "&Close" msgstr "&Kapat" #: tfrmabout.btncopytoclipboard.caption msgid "Copy to clipboard" msgstr "Panoya kopyala" #: tfrmabout.caption msgctxt "TFRMABOUT.CAPTION" msgid "About" msgstr "Hakkında" #: tfrmabout.lblbuild.caption msgctxt "tfrmabout.lblbuild.caption" msgid "Build" msgstr "Yapı" #: tfrmabout.lblfreepascalver.caption msgctxt "tfrmabout.lblfreepascalver.caption" msgid "Free Pascal" msgstr "Free Pascal Editor" #: tfrmabout.lblhomepage.caption msgid "Home Page:" msgstr "Ana Sayfa" #: tfrmabout.lblhomepageaddress.caption msgid "http://doublecmd.sourceforge.net" msgstr "http://doublecmd.sourceforge.net" #: tfrmabout.lbllazarusver.caption msgctxt "tfrmabout.lbllazarusver.caption" msgid "Lazarus" msgstr "Lazarus" #: tfrmabout.lblrevision.caption msgctxt "TFRMABOUT.LBLREVISION.CAPTION" msgid "Revision" msgstr "Gözden geçir" #: tfrmabout.lbltitle.caption msgctxt "TFRMABOUT.LBLTITLE.CAPTION" msgid "Double Commander" msgstr "Double Commander" #: tfrmabout.lblversion.caption #, fuzzy #| msgid "Version %s" msgctxt "tfrmabout.lblversion.caption" msgid "Version" msgstr "Çeviri Çağlar" #: tfrmattributesedit.btncancel.caption msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "&İptal" #: tfrmattributesedit.btnok.caption msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION" msgid "&OK" msgstr "&TAMAM" #: tfrmattributesedit.btnreset.caption msgid "&Reset" msgstr "&Baştaki konumuna getir" #: tfrmattributesedit.caption msgid "Choose attributes" msgstr "Özelliklerini seçin" #: tfrmattributesedit.cbarchive.caption #, fuzzy #| msgid "Archive" msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION" msgid "&Archive" msgstr "Kayıtlar" #: tfrmattributesedit.cbcompressed.caption #, fuzzy #| msgid "Compressed" msgid "Co&mpressed" msgstr "Sıkıştırılmış" #: tfrmattributesedit.cbdirectory.caption #, fuzzy #| msgid "Directory" msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION" msgid "&Directory" msgstr "Dizin" #: tfrmattributesedit.cbencrypted.caption #, fuzzy #| msgid "Encrypted" msgid "&Encrypted" msgstr "Şifreli" #: tfrmattributesedit.cbhidden.caption #, fuzzy #| msgid "Hidden" msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION" msgid "&Hidden" msgstr "Gizli" #: tfrmattributesedit.cbreadonly.caption #, fuzzy #| msgid "Read only" msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION" msgid "Read o&nly" msgstr "Salt okunur" #: tfrmattributesedit.cbsgid.caption msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmattributesedit.cbsparse.caption #, fuzzy #| msgid "Sparse" msgid "S&parse" msgstr "Seyrek" #: tfrmattributesedit.cbsticky.caption msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Yapışkan" #: tfrmattributesedit.cbsuid.caption msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmattributesedit.cbsymlink.caption #, fuzzy #| msgid "Symlink" msgid "&Symlink" msgstr "Sembolik link" #: tfrmattributesedit.cbsystem.caption #, fuzzy #| msgid "System" msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION" msgid "S&ystem" msgstr "Sistem" #: tfrmattributesedit.cbtemporary.caption #, fuzzy #| msgid "Temporary" msgid "&Temporary" msgstr "Geçici" #: tfrmattributesedit.gbntfsattributes.caption msgid "NTFS attributes" msgstr "NTFS öznitelikleri" #: tfrmattributesedit.gbwingeneral.caption msgid "General attributes" msgstr "Genel öznitelikler" #: tfrmattributesedit.lblattrbitsstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bit:" #: tfrmattributesedit.lblattrgroupstr.caption #, fuzzy #| msgid "Gruppe" msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Grup" #: tfrmattributesedit.lblattrotherstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Diğer" #: tfrmattributesedit.lblattrownerstr.caption msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Sahip" #: tfrmattributesedit.lblexec.caption msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION" msgid "Execute" msgstr "Çalıştır" #: tfrmattributesedit.lblread.caption msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION" msgid "Read" msgstr "Oku" #: tfrmattributesedit.lbltextattrs.caption #, fuzzy #| msgid "As text:" msgid "As te&xt:" msgstr "Metin olarak:" #: tfrmattributesedit.lblwrite.caption msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION" msgid "Write" msgstr "Yaz" #: tfrmbenchmark.caption msgid "Benchmark" msgstr "" #: tfrmbenchmark.lblbenchmarksize.caption msgid "Benchmark data size: %d MB" msgstr "" #: tfrmbenchmark.stgresult.columns[0].title.caption msgid "Hash" msgstr "" #: tfrmbenchmark.stgresult.columns[1].title.caption msgid "Time (ms)" msgstr "" #: tfrmbenchmark.stgresult.columns[2].title.caption msgid "Speed (MB/s)" msgstr "" #: tfrmchecksumcalc.caption #, fuzzy #| msgid "Calculate check sum..." msgctxt "tfrmchecksumcalc.caption" msgid "Calculate checksum..." msgstr "Sağlama toplamı hesapla..." #: tfrmchecksumcalc.cbopenafterjobiscomplete.caption msgid "Open checksum file after job is completed" msgstr "" #: tfrmchecksumcalc.cbseparatefile.caption #, fuzzy #| msgid "Create separate checksum file for each file" msgid "C&reate separate checksum file for each file" msgstr "Her dosya için ayrı bir sağlama toplamı dosyası oluştur" #: tfrmchecksumcalc.lblsaveto.caption #, fuzzy #| msgid "&Save check sum file(s) to:" msgid "&Save checksum file(s) to:" msgstr "Sağlama toplamı dosya(lar)ını kaydet:" #: tfrmchecksumverify.btnclose.caption msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION" msgid "&Close" msgstr "&Kapat" #: tfrmchecksumverify.caption #, fuzzy #| msgid "Verify check sum..." msgctxt "TFRMCHECKSUMVERIFY.CAPTION" msgid "Verify checksum..." msgstr "Sağlama toplamı doğrula..." #: tfrmconnectionmanager.btnadd.caption #, fuzzy #| msgid "Add" msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION" msgid "A&dd" msgstr "Ekle" #: tfrmconnectionmanager.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmconnectionmanager.btnconnect.caption #, fuzzy #| msgid "Connect" msgid "C&onnect" msgstr "Bağlan" #: tfrmconnectionmanager.btndelete.caption #, fuzzy #| msgid "Delete" msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION" msgid "&Delete" msgstr "Sil" #: tfrmconnectionmanager.btnedit.caption #, fuzzy #| msgid "Edit" msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION" msgid "&Edit" msgstr "Düzenle" #: tfrmconnectionmanager.caption msgid "Connection manager" msgstr "Bağlantı Yöneticisi" #: tfrmconnectionmanager.gbconnectto.caption msgid "Connect to:" msgstr "Bağlantıla:" #: tfrmcopydlg.btnaddtoqueue.caption msgid "A&dd To Queue" msgstr "" #: tfrmcopydlg.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmcopydlg.btnoptions.caption msgid "O&ptions" msgstr "Seçenekler" #: tfrmcopydlg.btnsaveoptions.caption #, fuzzy #| msgid "Save these options as default" msgid "Sa&ve these options as default" msgstr "Bu seçenekleri varsayılan olarak kaydet" #: tfrmcopydlg.caption msgctxt "TFRMCOPYDLG.CAPTION" msgid "Copy file(s)" msgstr "Dosya(lar)Kopyala" #: tfrmcopydlg.mnunewqueue.caption msgctxt "tfrmcopydlg.mnunewqueue.caption" msgid "New queue" msgstr "" #: tfrmcopydlg.mnuqueue1.caption msgctxt "tfrmcopydlg.mnuqueue1.caption" msgid "Queue 1" msgstr "" #: tfrmcopydlg.mnuqueue2.caption msgctxt "tfrmcopydlg.mnuqueue2.caption" msgid "Queue 2" msgstr "" #: tfrmcopydlg.mnuqueue3.caption msgctxt "tfrmcopydlg.mnuqueue3.caption" msgid "Queue 3" msgstr "" #: tfrmcopydlg.mnuqueue4.caption msgctxt "tfrmcopydlg.mnuqueue4.caption" msgid "Queue 4" msgstr "" #: tfrmcopydlg.mnuqueue5.caption msgctxt "tfrmcopydlg.mnuqueue5.caption" msgid "Queue 5" msgstr "" #: tfrmdescredit.actsavedescription.caption msgid "Save Description" msgstr "" #: tfrmdescredit.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmdescredit.btnok.caption msgctxt "TFRMDESCREDIT.BTNOK.CAPTION" msgid "&OK" msgstr "&TAMAM" #: tfrmdescredit.caption msgid "File/folder comment" msgstr "Dosya/klasör açıklaması" #: tfrmdescredit.lbleditcommentfor.caption #, fuzzy #| msgid "Edit comment for:" msgid "E&dit comment for:" msgstr "Açıklamayı düzenle:" #: tfrmdescredit.lblencoding.caption #, fuzzy #| msgid "Encoding:" msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION" msgid "&Encoding:" msgstr "Kodlama:" #: tfrmdescredit.lblfilename.caption msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION" msgid "???" msgstr "???" #: tfrmdiffer.actabout.caption msgctxt "TFRMDIFFER.ACTABOUT.CAPTION" msgid "About" msgstr "Hakkında" #: tfrmdiffer.actautocompare.caption msgid "Auto Compare" msgstr "Otomatik karşılaştır" #: tfrmdiffer.actbinarycompare.caption msgid "Binary Mode" msgstr "İkili mod" #: tfrmdiffer.actcancelcompare.caption msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION" msgid "Cancel" msgstr "İptal" #: tfrmdiffer.actcancelcompare.hint msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT" msgid "Cancel" msgstr "İptal" #: tfrmdiffer.actcopylefttoright.caption msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION" msgid "Copy Block Right" msgstr "Bloğu sağa kopyala" #: tfrmdiffer.actcopylefttoright.hint msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT" msgid "Copy Block Right" msgstr "Bloğu sağa kopyala" #: tfrmdiffer.actcopyrighttoleft.caption msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION" msgid "Copy Block Left" msgstr "Bloğu sola kopyala" #: tfrmdiffer.actcopyrighttoleft.hint msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT" msgid "Copy Block Left" msgstr "Bloğu sola kopyala" #: tfrmdiffer.acteditcopy.caption msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "Kopyala" #: tfrmdiffer.acteditcut.caption msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "Kes" #: tfrmdiffer.acteditdelete.caption msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "Sil" #: tfrmdiffer.acteditpaste.caption msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "Yapıştır" #: tfrmdiffer.acteditredo.caption msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "Yinele" #: tfrmdiffer.acteditselectall.caption msgid "Select &All" msgstr "Tümünü &Seç" #: tfrmdiffer.acteditundo.caption msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "Geri Al" #: tfrmdiffer.actexit.caption msgctxt "tfrmdiffer.actexit.caption" msgid "E&xit" msgstr "Ç&ıkış" #: tfrmdiffer.actfirstdifference.caption msgctxt "tfrmdiffer.actfirstdifference.caption" msgid "First Difference" msgstr "İlk fark" #: tfrmdiffer.actfirstdifference.hint msgctxt "tfrmdiffer.actfirstdifference.hint" msgid "First Difference" msgstr "İlk fark" #: tfrmdiffer.actignorecase.caption msgid "Ignore Case" msgstr "Büyük-küçük harf ayrımı yapma" #: tfrmdiffer.actignorewhitespace.caption msgid "Ignore Blanks" msgstr "Boşlukları yoksay" #: tfrmdiffer.actkeepscrolling.caption #, fuzzy #| msgid "Keep Scrolling\"Kaydırma tutma" msgid "Keep Scrolling" msgstr "Kaydırma devam" #: tfrmdiffer.actlastdifference.caption msgctxt "tfrmdiffer.actlastdifference.caption" msgid "Last Difference" msgstr "Son Fark" #: tfrmdiffer.actlastdifference.hint msgctxt "tfrmdiffer.actlastdifference.hint" msgid "Last Difference" msgstr "Son Fark" #: tfrmdiffer.actlinedifferences.caption msgid "Line Differences" msgstr "Satır farklılıkları" #: tfrmdiffer.actnextdifference.caption msgctxt "tfrmdiffer.actnextdifference.caption" msgid "Next Difference" msgstr "Sonraki Fark" #: tfrmdiffer.actnextdifference.hint msgctxt "tfrmdiffer.actnextdifference.hint" msgid "Next Difference" msgstr "Sonraki Fark" #: tfrmdiffer.actopenleft.caption msgid "Open Left..." msgstr "Sol Açık..." #: tfrmdiffer.actopenright.caption msgid "Open Right..." msgstr "Sağ Açık..." #: tfrmdiffer.actpaintbackground.caption msgid "Paint Background" msgstr "Arkaplan Rengi" #: tfrmdiffer.actprevdifference.caption msgctxt "tfrmdiffer.actprevdifference.caption" msgid "Previous Difference" msgstr "Önceki Fark" #: tfrmdiffer.actprevdifference.hint msgctxt "tfrmdiffer.actprevdifference.hint" msgid "Previous Difference" msgstr "Önceki Fark" #: tfrmdiffer.actreload.caption #, fuzzy #| msgid "Reload" msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION" msgid "&Reload" msgstr "Güncelle" #: tfrmdiffer.actreload.hint msgctxt "TFRMDIFFER.ACTRELOAD.HINT" msgid "Reload" msgstr "Güncelle" #: tfrmdiffer.actsave.caption msgctxt "TFRMDIFFER.ACTSAVE.CAPTION" msgid "Save" msgstr "Kaydet" #: tfrmdiffer.actsave.hint msgctxt "TFRMDIFFER.ACTSAVE.HINT" msgid "Save" msgstr "Kaydet" #: tfrmdiffer.actsaveas.caption msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION" msgid "Save as..." msgstr "Farklı Kaydet ..." #: tfrmdiffer.actsaveas.hint msgctxt "TFRMDIFFER.ACTSAVEAS.HINT" msgid "Save as..." msgstr "Farklı Kaydet ..." #: tfrmdiffer.actsaveleft.caption msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION" msgid "Save Left" msgstr "Sol Kaydet" #: tfrmdiffer.actsaveleft.hint msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT" msgid "Save Left" msgstr "Sol Kaydet" #: tfrmdiffer.actsaveleftas.caption msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION" msgid "Save Left As..." msgstr "Sol olarak kaydet..." #: tfrmdiffer.actsaveleftas.hint msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT" msgid "Save Left As..." msgstr "Sol olarak kaydet..." #: tfrmdiffer.actsaveright.caption msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION" msgid "Save Right" msgstr "Sağ Kaydet" #: tfrmdiffer.actsaveright.hint msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT" msgid "Save Right" msgstr "Sağ Kaydet" #: tfrmdiffer.actsaverightas.caption msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION" msgid "Save Right As..." msgstr "Sağ olarak kaydet..." #: tfrmdiffer.actsaverightas.hint msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT" msgid "Save Right As..." msgstr "Sağ olarak kaydet..." #: tfrmdiffer.actstartcompare.caption msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION" msgid "Compare" msgstr "Karşılaştır" #: tfrmdiffer.actstartcompare.hint msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT" msgid "Compare" msgstr "Karşılaştır" #: tfrmdiffer.btnleftencoding.hint msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT" msgid "Encoding" msgstr "Kodlama" #: tfrmdiffer.btnrightencoding.hint msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT" msgid "Encoding" msgstr "Kodlama" #: tfrmdiffer.caption msgctxt "tfrmdiffer.caption" msgid "Compare files" msgstr "Dosyaları karşılaştır" #: tfrmdiffer.midivider1.caption msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider10.caption msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider2.caption msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider3.caption msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider4.caption msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider5.caption msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider6.caption msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider7.caption msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider8.caption msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.midivider9.caption msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.miencodingleft.caption #, fuzzy #| msgid "Left" msgid "&Left" msgstr "Sol" #: tfrmdiffer.miencodingright.caption #, fuzzy #| msgid "Right" msgid "&Right" msgstr "Sağ" #: tfrmdiffer.miseparator1.caption msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.miseparator2.caption msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION" msgid "-" msgstr "-" #: tfrmdiffer.mnuactions.caption msgid "&Actions" msgstr "&Eylemler" #: tfrmdiffer.mnuedit.caption #, fuzzy #| msgid "Edit" msgctxt "TFRMDIFFER.MNUEDIT.CAPTION" msgid "&Edit" msgstr "Düzenle" #: tfrmdiffer.mnuencoding.caption #, fuzzy #| msgid "Encoding" msgctxt "TFRMDIFFER.MNUENCODING.CAPTION" msgid "En&coding" msgstr "Kodlama" #: tfrmdiffer.mnufile.caption #, fuzzy #| msgid "File" msgctxt "TFRMDIFFER.MNUFILE.CAPTION" msgid "&File" msgstr "Dosya" #: tfrmdiffer.mnuoptions.caption msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION" msgid "&Options" msgstr "Seçenekler" #: tfrmedithotkey.btnaddshortcut.hint msgid "Add new shortcut to sequence" msgstr "" #: tfrmedithotkey.btncancel.caption msgctxt "tfrmedithotkey.btncancel.caption" msgid "&Cancel" msgstr "&İptal" #: tfrmedithotkey.btnok.caption msgctxt "tfrmedithotkey.btnok.caption" msgid "&OK" msgstr "&TAMAM" #: tfrmedithotkey.btnremoveshortcut.hint msgid "Remove last shortcut from sequence" msgstr "" #: tfrmedithotkey.btnselectfromlist.hint msgid "Select shortcut from list of remaining free available keys" msgstr "" #: tfrmedithotkey.cghkcontrols.caption msgid "Only for these controls" msgstr "" #: tfrmedithotkey.lblparameters.caption msgid "&Parameters (each in a separate line):" msgstr "" #: tfrmedithotkey.lblshortcuts.caption msgid "Shortcuts:" msgstr "" #: tfrmeditor.actabout.caption msgctxt "TFRMEDITOR.ACTABOUT.CAPTION" msgid "About" msgstr "Hakkında" #: tfrmeditor.actabout.hint msgctxt "tfrmeditor.actabout.hint" msgid "About" msgstr "Hakkında" #: tfrmeditor.actconfhigh.caption msgid "&Configuration" msgstr "&Yapılandır" #: tfrmeditor.actconfhigh.hint msgctxt "tfrmeditor.actconfhigh.hint" msgid "Configuration" msgstr "Yapılandırma" #: tfrmeditor.acteditcopy.caption msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION" msgid "Copy" msgstr "Kopyala" #: tfrmeditor.acteditcopy.hint msgctxt "tfrmeditor.acteditcopy.hint" msgid "Copy" msgstr "Kopyala" #: tfrmeditor.acteditcut.caption msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION" msgid "Cut" msgstr "Kes" #: tfrmeditor.acteditcut.hint msgctxt "tfrmeditor.acteditcut.hint" msgid "Cut" msgstr "Kes" #: tfrmeditor.acteditdelete.caption msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION" msgid "Delete" msgstr "Sil" #: tfrmeditor.acteditdelete.hint msgctxt "tfrmeditor.acteditdelete.hint" msgid "Delete" msgstr "&Sil" #: tfrmeditor.acteditfind.caption #, fuzzy #| msgid "&Find " msgctxt "tfrmeditor.acteditfind.caption" msgid "&Find" msgstr "&Bul" #: tfrmeditor.acteditfind.hint msgctxt "tfrmeditor.acteditfind.hint" msgid "Find" msgstr "Bul" #: tfrmeditor.acteditfindnext.caption msgctxt "tfrmeditor.acteditfindnext.caption" msgid "Find next" msgstr "Sonrakini Bul" #: tfrmeditor.acteditfindnext.hint msgctxt "tfrmeditor.acteditfindnext.hint" msgid "Find next" msgstr "Sonrakini Bul" #: tfrmeditor.acteditfindprevious.caption msgctxt "tfrmeditor.acteditfindprevious.caption" msgid "Find previous" msgstr "" #: tfrmeditor.acteditgotoline.caption msgctxt "tfrmeditor.acteditgotoline.caption" msgid "Goto Line..." msgstr "" #: tfrmeditor.acteditlineendcr.caption msgctxt "tfrmeditor.acteditlineendcr.caption" msgid "Mac (CR)" msgstr "" #: tfrmeditor.acteditlineendcr.hint msgctxt "tfrmeditor.acteditlineendcr.hint" msgid "Mac (CR)" msgstr "" #: tfrmeditor.acteditlineendcrlf.caption msgctxt "tfrmeditor.acteditlineendcrlf.caption" msgid "Windows (CRLF)" msgstr "" #: tfrmeditor.acteditlineendcrlf.hint msgctxt "tfrmeditor.acteditlineendcrlf.hint" msgid "Windows (CRLF)" msgstr "" #: tfrmeditor.acteditlineendlf.caption msgctxt "tfrmeditor.acteditlineendlf.caption" msgid "Unix (LF)" msgstr "" #: tfrmeditor.acteditlineendlf.hint msgctxt "tfrmeditor.acteditlineendlf.hint" msgid "Unix (LF)" msgstr "" #: tfrmeditor.acteditpaste.caption msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION" msgid "Paste" msgstr "Yapıştır" #: tfrmeditor.acteditpaste.hint msgctxt "tfrmeditor.acteditpaste.hint" msgid "Paste" msgstr "Yapıştır" #: tfrmeditor.acteditredo.caption msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION" msgid "Redo" msgstr "Yenile" #: tfrmeditor.acteditredo.hint msgctxt "tfrmeditor.acteditredo.hint" msgid "Redo" msgstr "Yenile" #: tfrmeditor.acteditrplc.caption msgid "&Replace" msgstr "&Değiştir" #: tfrmeditor.acteditrplc.hint msgctxt "tfrmeditor.acteditrplc.hint" msgid "Replace" msgstr "Değiştir" #: tfrmeditor.acteditselectall.caption msgid "Select&All" msgstr "&Hepsini Seç" #: tfrmeditor.acteditselectall.hint msgctxt "tfrmeditor.acteditselectall.hint" msgid "Select All" msgstr "Tümünü Seç" #: tfrmeditor.acteditundo.caption msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION" msgid "Undo" msgstr "Geri A" #: tfrmeditor.acteditundo.hint msgctxt "tfrmeditor.acteditundo.hint" msgid "Undo" msgstr "Geri al" #: tfrmeditor.actfileclose.caption msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION" msgid "&Close" msgstr "&Kapat" #: tfrmeditor.actfileclose.hint msgctxt "tfrmeditor.actfileclose.hint" msgid "Close" msgstr "Kapat" #: tfrmeditor.actfileexit.caption msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION" msgid "E&xit" msgstr "&Çıkış" #: tfrmeditor.actfileexit.hint msgctxt "tfrmeditor.actfileexit.hint" msgid "Exit" msgstr "Çıkış F10" #: tfrmeditor.actfilenew.caption msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION" msgid "&New" msgstr "&Yeni" #: tfrmeditor.actfilenew.hint msgctxt "tfrmeditor.actfilenew.hint" msgid "New" msgstr "Yeni" #: tfrmeditor.actfileopen.caption msgid "&Open" msgstr "&Açık" #: tfrmeditor.actfileopen.hint msgctxt "tfrmeditor.actfileopen.hint" msgid "Open" msgstr "Açık" #: tfrmeditor.actfilereload.caption #, fuzzy msgctxt "tfrmeditor.actfilereload.caption" msgid "Reload" msgstr "Güncelle" #: tfrmeditor.actfilesave.caption msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION" msgid "&Save" msgstr "&Kaydet" #: tfrmeditor.actfilesave.hint msgctxt "tfrmeditor.actfilesave.hint" msgid "Save" msgstr "Kaydet" #: tfrmeditor.actfilesaveas.caption #, fuzzy #| msgid "Save &As.." msgid "Save &As..." msgstr "Farklı &Kaydet..." #: tfrmeditor.actfilesaveas.hint msgid "Save As" msgstr "Farklı Kaydet..." #: tfrmeditor.actsaveall.caption msgid "Sa&ve All" msgstr "&Tümünü Kaydet" #: tfrmeditor.actsaveall.hint msgid "Save All" msgstr "" #: tfrmeditor.caption msgctxt "TFRMEDITOR.CAPTION" msgid "Editor" msgstr "Düzenleyici" #: tfrmeditor.help1.caption msgctxt "TFRMEDITOR.HELP1.CAPTION" msgid "&Help" msgstr "&Yardım" #: tfrmeditor.miedit.caption msgctxt "TFRMEDITOR.MIEDIT.CAPTION" msgid "&Edit" msgstr "&Düzenle" #: tfrmeditor.miencoding.caption msgctxt "TFRMEDITOR.MIENCODING.CAPTION" msgid "En&coding" msgstr "&Kodlama" #: tfrmeditor.miencodingin.caption msgid "Open as" msgstr "Olarak aç..." #: tfrmeditor.miencodingout.caption msgctxt "tfrmeditor.miencodingout.caption" msgid "Save as" msgstr "Farklı Kaydet..." #: tfrmeditor.mifile.caption msgctxt "TFRMEDITOR.MIFILE.CAPTION" msgid "&File" msgstr "&Dosya" #: tfrmeditor.mihighlight.caption msgid "Syntax highlight" msgstr "Sözdizimi vurgulama" #: tfrmeditor.milineendtype.caption msgid "End Of Line" msgstr "" #: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption #, fuzzy #| msgid "Cancel" msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption" msgid "&Cancel" msgstr "İptal" #: tfrmeditsearchreplace.buttonpanel.okbutton.caption #, fuzzy msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption" msgid "&OK" msgstr "&TAMAM" #: tfrmeditsearchreplace.cbsearchcasesensitive.caption msgid "C&ase sensitivity" msgstr "Büyük/küçük harf duyarlılığı" #: tfrmeditsearchreplace.cbsearchfromcursor.caption #, fuzzy #| msgid "Search from &caret" msgid "S&earch from caret" msgstr "Şapka &imi ara" #: tfrmeditsearchreplace.cbsearchregexp.caption msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION" msgid "&Regular expressions" msgstr "&Kısaltılmış metin karekterleri" #: tfrmeditsearchreplace.cbsearchselectedonly.caption msgid "Selected &text only" msgstr "Sadece &seçili metin" #: tfrmeditsearchreplace.cbsearchwholewords.caption msgid "&Whole words only" msgstr "&Sadece tüm kelimeler" #: tfrmeditsearchreplace.gbsearchoptions.caption msgid "Option" msgstr "Seçenek" #: tfrmeditsearchreplace.lblreplacewith.caption msgid "&Replace with:" msgstr "&İle değiştirin:" #: tfrmeditsearchreplace.lblsearchfor.caption msgid "&Search for:" msgstr "&Bulmaya çalış:" #: tfrmeditsearchreplace.rgsearchdirection.caption msgid "Direction" msgstr "Yön" #: tfrmextractdlg.caption msgctxt "tfrmextractdlg.caption" msgid "Unpack files" msgstr "Dosya(ları) aç" #: tfrmextractdlg.cbextractpath.caption msgid "&Unpack path names if stored with files" msgstr "&Eğer dosyalar kaydedilmişse sıkıştırılmış yol adlarını aç" #: tfrmextractdlg.cbfilemask.text msgctxt "tfrmextractdlg.cbfilemask.text" msgid "*.*" msgstr "*" #: tfrmextractdlg.cbinseparatefolder.caption msgid "Unpack each archive to a &separate subdir (name of the archive)" msgstr "Her bir arşivi ayrı bir alt dizine aç(arşiv adıyla)" #: tfrmextractdlg.cboverwrite.caption #, fuzzy #| msgid "&Overwrite existing files" msgid "O&verwrite existing files" msgstr "&Varolan dosya(ların) üzerine yaz" #: tfrmextractdlg.lblextractto.caption #, fuzzy #| msgid "To the directory:" msgid "To the &directory:" msgstr "Sıkıştırılmış dosya(ları) dizine aç:" #: tfrmextractdlg.lblfilemask.caption #, fuzzy #| msgid "Extract files matching file mask:" msgid "&Extract files matching file mask:" msgstr "Dosya maskesi eşleşen dosyaları ayıkla:" #: tfrmextractdlg.lblpassword.caption #, fuzzy #| msgid "Password for encrypted files:" msgid "&Password for encrypted files:" msgstr "Şifrelenmiş Dosya için şifre" #: tfrmfileexecuteyourself.btnclose.caption msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION" msgid "&Close" msgstr "&Kapat" #: tfrmfileexecuteyourself.caption msgctxt "tfrmfileexecuteyourself.caption" msgid "Wait..." msgstr "Bekle..." #: tfrmfileexecuteyourself.lblfilename.caption msgid "File name:" msgstr "Dosya Adı:" #: tfrmfileexecuteyourself.lblfrompath.caption msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION" msgid "From:" msgstr "Kaynak:" #: tfrmfileexecuteyourself.lblprompt.caption msgid "Click on Close when the temporary file can be deleted!" msgstr "Geçici dosyayı(TEMP)silmek için Kapat'ı tıklatın!" #: tfrmfileop.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmfileop.btnminimizetopanel.caption msgid "&To panel" msgstr "" #: tfrmfileop.btnviewoperations.caption msgid "&View all" msgstr "" #: tfrmfileop.lblcurrentoperation.caption msgid "Current operation:" msgstr "" #: tfrmfileop.lblfrom.caption msgctxt "TFRMFILEOP.LBLFROM.CAPTION" msgid "From:" msgstr "Tarafından:" #: tfrmfileop.lblto.caption msgid "To:" msgstr "Sonra:" #: tfrmfileproperties.btnclose.caption #, fuzzy #| msgid "Close" msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Kapat" #: tfrmfileproperties.btnsetproperties.caption msgid "&Set properties" msgstr "" #: tfrmfileproperties.btnsetpropertiestoallfiles.caption msgid "Set to &all selected files" msgstr "" #: tfrmfileproperties.btnskipfile.caption msgid "Ski&p this file" msgstr "" #: tfrmfileproperties.caption msgctxt "tfrmfileproperties.caption" msgid "Properties" msgstr "Özellikleri" #: tfrmfileproperties.cbsgid.caption msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "SGID(yürütme Grup kimliği kurun) bir dosya/klasör verilen dosya izinleri özel bir türüdür." #: tfrmfileproperties.cbsticky.caption msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Yapışkan" #: tfrmfileproperties.cbsuid.caption msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "SUID (Kullanıcı Kimliği ayarlayın) bir dosyaya verilen dosya izinleri özel bir türü" #: tfrmfileproperties.chkexecutable.caption msgid "Allow &executing file as program" msgstr "" #: tfrmfileproperties.gbowner.caption msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION" msgid "Owner" msgstr "Sahibi" #: tfrmfileproperties.lblattrbitsstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bit:" #: tfrmfileproperties.lblattrgroupstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Grup" #: tfrmfileproperties.lblattrotherstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Diğer" #: tfrmfileproperties.lblattrownerstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Diğer" #: tfrmfileproperties.lblattrtext.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "-----------" #: tfrmfileproperties.lblattrtextstr.caption msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "Metin" #: tfrmfileproperties.lblcontains.caption msgctxt "tfrmfileproperties.lblcontains.caption" msgid "???" msgstr "???" #: tfrmfileproperties.lblcontainsstr.caption msgid "Contains:" msgstr "" #: tfrmfileproperties.lblexec.caption msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "Çalıştır" #: tfrmfileproperties.lblexecutable.caption msgid "Execute:" msgstr "" #: tfrmfileproperties.lblfile.caption msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION" msgid "File name" msgstr "Dosya adı" #: tfrmfileproperties.lblfilename.caption msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblfilestr.caption msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION" msgid "File name" msgstr "Dosya adı" #: tfrmfileproperties.lblfolder.caption msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblfolderstr.caption msgctxt "tfrmfileproperties.lblfolderstr.caption" msgid "Path:" msgstr "Yol:" #: tfrmfileproperties.lblgroupstr.caption #, fuzzy #| msgid "Group" msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION" msgid "&Group" msgstr "Grup" #: tfrmfileproperties.lbllastaccess.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllastaccessstr.caption msgid "Last access:" msgstr "Son erişim" #: tfrmfileproperties.lbllastmodif.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllastmodifstr.caption msgid "Last modification:" msgstr "Son değişiklik:" #: tfrmfileproperties.lbllaststchange.caption msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbllaststchangestr.caption msgid "Last status change:" msgstr "Son durum değişikliği:" #: tfrmfileproperties.lbloctal.caption msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "Sekizli:" #: tfrmfileproperties.lblownerstr.caption #, fuzzy #| msgid "Owner" msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION" msgid "O&wner" msgstr "Sahibi" #: tfrmfileproperties.lblread.caption msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "Okuma" #: tfrmfileproperties.lblsize.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblsizestr.caption msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION" msgid "Size:" msgstr "Boyutu:" #: tfrmfileproperties.lblsymlink.caption msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lblsymlinkstr.caption msgid "Symlink to:" msgstr "Sembolik link için:" #: tfrmfileproperties.lbltype.caption msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION" msgid "???" msgstr "???" #: tfrmfileproperties.lbltypestr.caption msgid "Type:" msgstr "Tip:" #: tfrmfileproperties.lblwrite.caption msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "Yaz" #: tfrmfileproperties.sgimage.columns[0].title.caption #, fuzzy msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption" msgid "Name" msgstr "Adı" #: tfrmfileproperties.sgimage.columns[1].title.caption #, fuzzy msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption" msgid "Value" msgstr "Değer" #: tfrmfileproperties.tsattributes.caption msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Öznitelikleri" #: tfrmfileproperties.tsplugins.caption #, fuzzy msgctxt "tfrmfileproperties.tsplugins.caption" msgid "Plugins" msgstr "Eklentiler" #: tfrmfileproperties.tsproperties.caption msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION" msgid "Properties" msgstr "Özellikleri" #: tfrmfinddlg.actcancel.caption msgctxt "tfrmfinddlg.actcancel.caption" msgid "C&ancel" msgstr "İptal" #: tfrmfinddlg.actcancelclose.caption msgid "Cancel search and close window" msgstr "&Kapat" #: tfrmfinddlg.actclose.caption msgctxt "tfrmfinddlg.actclose.caption" msgid "&Close" msgstr "Kapat" #: tfrmfinddlg.actconfigfilesearchhotkeys.caption msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption" msgid "Configuration of hot keys" msgstr "" #: tfrmfinddlg.actedit.caption msgctxt "tfrmfinddlg.actedit.caption" msgid "&Edit" msgstr "&Düzenle" #: tfrmfinddlg.actfeedtolistbox.caption msgid "Feed to &listbox" msgstr "&Liste kutusunu besle" #: tfrmfinddlg.actfreefrommem.caption msgid "Cancel search, close and free from memory" msgstr "" #: tfrmfinddlg.actfreefrommemallothers.caption msgid "For all other \"Find files\", cancel, close and free from memory" msgstr "" #: tfrmfinddlg.actgotofile.caption msgid "&Go to file" msgstr "&Dosya'ya git" #: tfrmfinddlg.actintellifocus.caption msgctxt "tfrmfinddlg.actintellifocus.caption" msgid "Find Data" msgstr "Veri Bul" #: tfrmfinddlg.actlastsearch.caption msgid "&Last search" msgstr "" #: tfrmfinddlg.actnewsearch.caption msgid "&New search" msgstr "&Yeni arama" #: tfrmfinddlg.actnewsearchclearfilters.caption msgid "New search (clear filters)" msgstr "" #: tfrmfinddlg.actpageadvanced.caption msgid "Go to page \"Advanced\"" msgstr "" #: tfrmfinddlg.actpageloadsave.caption msgid "Go to page \"Load/Save\"" msgstr "" #: tfrmfinddlg.actpagenext.caption msgid "Switch to Nex&t Page" msgstr "" #: tfrmfinddlg.actpageplugins.caption msgid "Go to page \"Plugins\"" msgstr "" #: tfrmfinddlg.actpageprev.caption msgid "Switch to &Previous Page" msgstr "" #: tfrmfinddlg.actpageresults.caption msgid "Go to page \"Results\"" msgstr "" #: tfrmfinddlg.actpagestandard.caption msgid "Go to page \"Standard\"" msgstr "" #: tfrmfinddlg.actstart.caption msgctxt "tfrmfinddlg.actstart.caption" msgid "&Start" msgstr "&Başlat" #: tfrmfinddlg.actview.caption msgctxt "tfrmfinddlg.actview.caption" msgid "&View" msgstr "&Göster" #: tfrmfinddlg.btnaddattribute.caption msgctxt "tfrmfinddlg.btnaddattribute.caption" msgid "&Add" msgstr "&Ekle" #: tfrmfinddlg.btnattrshelp.caption msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION" msgid "&Help" msgstr "&Yardım" #: tfrmfinddlg.btnsavetemplate.caption #, fuzzy #| msgid "Save" msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION" msgid "&Save" msgstr "Kaydet" #: tfrmfinddlg.btnsearchdelete.caption msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION" msgid "&Delete" msgstr "&Sil" #: tfrmfinddlg.btnsearchload.caption msgid "L&oad" msgstr "&Yükle" #: tfrmfinddlg.btnsearchsave.caption msgid "S&ave" msgstr "&Kaydet" #: tfrmfinddlg.btnsearchsavewithstartingpath.caption msgid "Sa&ve with \"Start in directory\"" msgstr "" #: tfrmfinddlg.btnsearchsavewithstartingpath.hint msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory" msgstr "" #: tfrmfinddlg.btnusetemplate.caption msgid "Use template" msgstr "" #: tfrmfinddlg.caption msgctxt "tfrmfinddlg.caption" msgid "Find files" msgstr "Dosyaları bul" #: tfrmfinddlg.cbcasesens.caption msgid "Case sens&itive" msgstr "Büyük/küçük harf duyarlı" #: tfrmfinddlg.cbdatefrom.caption #, fuzzy #| msgid "Date From:" msgid "&Date from:" msgstr "Tarihinden itibaren:" #: tfrmfinddlg.cbdateto.caption #, fuzzy #| msgid "Date To:" msgid "Dat&e to:" msgstr "Bitiş tarihi:" #: tfrmfinddlg.cbfilesizefrom.caption #, fuzzy #| msgid "Size from:" msgid "S&ize from:" msgstr "Büyüklükleri:" #: tfrmfinddlg.cbfilesizeto.caption #, fuzzy #| msgid "Size to:" msgid "Si&ze to:" msgstr "En büyük dosya boyutu" #: tfrmfinddlg.cbfindinarchive.caption msgid "Search in &archives" msgstr "" #: tfrmfinddlg.cbfindtext.caption msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION" msgid "Find &text in file" msgstr "Dosyadaki metni bul" #: tfrmfinddlg.cbfollowsymlinks.caption msgid "Follow s&ymlinks" msgstr "" #: tfrmfinddlg.cbnotcontainingtext.caption msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION" msgid "Find files N&OT containing the text" msgstr "Metin içermeyen dosyaları bul" #: tfrmfinddlg.cbnotolderthan.caption #, fuzzy #| msgid "Not older than:" msgid "N&ot older than:" msgstr "Daha eski değil:" #: tfrmfinddlg.cbopenedtabs.caption msgid "Opened tabs" msgstr "" #: tfrmfinddlg.cbpartialnamesearch.caption #, fuzzy #| msgid "Search for part of file name " msgid "Searc&h for part of file name" msgstr "Dosya adının bir kısmını ara" #: tfrmfinddlg.cbregexp.caption #, fuzzy #| msgid "&Regular expressions" msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION" msgid "&Regular expression" msgstr "&Kısaltılmış metin karekterleri" #: tfrmfinddlg.cbreplacetext.caption msgid "Re&place by" msgstr "Metni Değiştir" #: tfrmfinddlg.cbselectedfiles.caption msgid "Selected directories and &files" msgstr "" #: tfrmfinddlg.cbtextregexp.caption msgid "Regular &expression" msgstr "" #: tfrmfinddlg.cbtimefrom.caption #, fuzzy #| msgid "Time from:" msgid "&Time from:" msgstr "Yeni Tarih:" #: tfrmfinddlg.cbtimeto.caption #, fuzzy #| msgid "Time to:" msgid "Ti&me to:" msgstr "Eski Tarih:" #: tfrmfinddlg.cbuseplugin.caption msgid "&Use search plugin:" msgstr "Arama eklentisi kullan" #: tfrmfinddlg.chkhex.caption msgid "Hexadecimal" msgstr "" #: tfrmfinddlg.cmbexcludedirectories.hint msgid "Enter directories names that should be excluded from search separated with \";\"" msgstr "" #: tfrmfinddlg.cmbexcludefiles.hint msgid "Enter files names that should be excluded from search separated with \";\"" msgstr "" #: tfrmfinddlg.cmbfindfilemask.hint msgid "Enter files names separated with \";\"" msgstr "" #: tfrmfinddlg.gbdirectories.caption msgctxt "tfrmfinddlg.gbdirectories.caption" msgid "Directories" msgstr "" #: tfrmfinddlg.gbfiles.caption msgctxt "tfrmfinddlg.gbfiles.caption" msgid "Files" msgstr "" #: tfrmfinddlg.gbfinddata.caption msgctxt "tfrmfinddlg.gbfinddata.caption" msgid "Find Data" msgstr "Veri Bul" #: tfrmfinddlg.lblattributes.caption msgid "Attri&butes" msgstr "" #: tfrmfinddlg.lblencoding.caption #, fuzzy #| msgid "Encoding:" msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION" msgid "Encodin&g:" msgstr "Kodlama:" #: tfrmfinddlg.lblexcludedirectories.caption msgid "E&xclude subdirectories" msgstr "" #: tfrmfinddlg.lblexcludefiles.caption msgid "&Exclude files" msgstr "" #: tfrmfinddlg.lblfindfilemask.caption msgid "&File mask" msgstr "Dosya Maskesi" #: tfrmfinddlg.lblfindpathstart.caption #, fuzzy #| msgid "&Directory" msgid "Start in &directory" msgstr "DoubleCommander dizininde ara" #: tfrmfinddlg.lblsearchdepth.caption msgid "Search su&bdirectories:" msgstr "Alt dizinleri ara" #: tfrmfinddlg.lbltemplateheader.caption msgid "&Previous searches:" msgstr "Önceki arama(lar)" #: tfrmfinddlg.miaction.caption msgid "&Action" msgstr "" #: tfrmfinddlg.mifreefrommemallothers.caption msgid "For all others, cancel, close and free from memory" msgstr "" #: tfrmfinddlg.miopeninnewtab.caption msgid "Open In New Tab(s)" msgstr "" #: tfrmfinddlg.mioptions.caption #, fuzzy msgctxt "tfrmfinddlg.mioptions.caption" msgid "Options" msgstr "Seçenekler" #: tfrmfinddlg.miremovefromllist.caption msgid "Remove from list" msgstr "Listeden kaldır" #: tfrmfinddlg.miresult.caption msgid "&Result" msgstr "" #: tfrmfinddlg.mishowallfound.caption msgid "Show all found items" msgstr "Bulunan tüm öğeleri göster" #: tfrmfinddlg.mishowineditor.caption msgid "Show In Editor" msgstr "" #: tfrmfinddlg.mishowinviewer.caption msgid "Show In Viewer" msgstr "Görüntüleyicide göster" #: tfrmfinddlg.miviewtab.caption #, fuzzy msgctxt "tfrmfinddlg.miviewtab.caption" msgid "&View" msgstr "&Göster" #: tfrmfinddlg.tsadvanced.caption msgid "Advanced" msgstr "Gelişmiş" #: tfrmfinddlg.tsloadsave.caption msgid "Load/Save" msgstr "Yükle/Kaydet" #: tfrmfinddlg.tsplugins.caption msgctxt "tfrmfinddlg.tsplugins.caption" msgid "Plugins" msgstr "Eklentiler" #: tfrmfinddlg.tsresults.caption msgid "Results" msgstr "Sonuçlar" #: tfrmfinddlg.tsstandard.caption msgid "Standard" msgstr "Standart" #: tfrmfindview.btnclose.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmfindview.btnfind.caption #, fuzzy #| msgid "Find" msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION" msgid "&Find" msgstr "Bul" #: tfrmfindview.caption msgctxt "TFRMFINDVIEW.CAPTION" msgid "Find" msgstr "Bul" #: tfrmfindview.cbcasesens.caption #, fuzzy #| msgid "Case sensitive" msgid "C&ase sensitive" msgstr "Büyük/küçük harf duyarlı" #: tfrmhardlink.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmhardlink.btnok.caption msgctxt "TFRMHARDLINK.BTNOK.CAPTION" msgid "&OK" msgstr "&TAMAM" #: tfrmhardlink.caption msgid "Create hard link" msgstr "Sabit bağlantı oluştur" #: tfrmhardlink.lblexistingfile.caption #, fuzzy #| msgid "Destination that the link will point to" msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "Mevcut hedef (nereye bağlantı noktası)" #: tfrmhardlink.lbllinktocreate.caption #, fuzzy #| msgid "Link name" msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "Bağlantı adı" #: tfrmhotdirexportimport.btnselectall.caption msgctxt "tfrmhotdirexportimport.btnselectall.caption" msgid "Import all!" msgstr "" #: tfrmhotdirexportimport.btnselectiondone.caption msgctxt "tfrmhotdirexportimport.btnselectiondone.caption" msgid "Import selected" msgstr "" #: tfrmhotdirexportimport.caption msgctxt "tfrmhotdirexportimport.caption" msgid "Select the entries your want to import" msgstr "" #: tfrmhotdirexportimport.lbhint.caption msgctxt "tfrmhotdirexportimport.lbhint.caption" msgid "When clicking a sub-menu, it will select the whole menu" msgstr "" #: tfrmhotdirexportimport.lblhintholdcontrol.caption msgid "Hold CTRL and click entries to select multiple ones" msgstr "" #: tfrmlinker.btnsave.caption msgctxt "TFRMLINKER.BTNSAVE.CAPTION" msgid "..." msgstr "..." #: tfrmlinker.caption msgctxt "tfrmlinker.caption" msgid "Linker" msgstr "Bağlayıcı" #: tfrmlinker.gbsaveto.caption msgid "Save to..." msgstr "Kaydedin..." #: tfrmlinker.grbxcontrol.caption msgid "Item" msgstr "Öğe" #: tfrmlinker.lblfilename.caption #, fuzzy #| msgid "File name" msgctxt "TFRMLINKER.LBLFILENAME.CAPTION" msgid "&File name" msgstr "Dosya Adı" #: tfrmlinker.spbtndown.caption #, fuzzy #| msgid "Down" msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION" msgid "Do&wn" msgstr "Aşağı" #: tfrmlinker.spbtndown.hint msgctxt "TFRMLINKER.SPBTNDOWN.HINT" msgid "Down" msgstr "Aşağı" #: tfrmlinker.spbtnrem.caption #, fuzzy #| msgid "Remove" msgctxt "tfrmlinker.spbtnrem.caption" msgid "&Remove" msgstr "Kaldır" #: tfrmlinker.spbtnrem.hint #, fuzzy msgctxt "tfrmlinker.spbtnrem.hint" msgid "Delete" msgstr "&Sil" #: tfrmlinker.spbtnup.caption #, fuzzy #| msgid "Up" msgctxt "TFRMLINKER.SPBTNUP.CAPTION" msgid "&Up" msgstr "Yukarı" #: tfrmlinker.spbtnup.hint msgctxt "TFRMLINKER.SPBTNUP.HINT" msgid "Up" msgstr "Yukarı" #: tfrmmain.actabout.caption msgctxt "TFRMMAIN.ACTABOUT.CAPTION" msgid "&About" msgstr "&Hakkında" #: tfrmmain.actaddfilenametocmdline.caption msgid "Add file name to command line" msgstr "Dosya adını komut satırına ekle" #: tfrmmain.actaddnewsearch.caption msgid "New search instance..." msgstr "" #: tfrmmain.actaddpathandfilenametocmdline.caption msgid "Add path and file name to command line" msgstr "Yolu ve dosya adını komut satırına ekle" #: tfrmmain.actaddpathtocmdline.caption msgid "Copy path to command line" msgstr "Komut satırına yolu kopyala" #: tfrmmain.actbenchmark.caption msgid "&Benchmark" msgstr "" #: tfrmmain.actbriefview.caption msgctxt "tfrmmain.actbriefview.caption" msgid "Brief view" msgstr "" #: tfrmmain.actbriefview.hint msgid "Brief View" msgstr "" #: tfrmmain.actcalculatespace.caption msgid "Calculate &Occupied Space" msgstr "Kullanılan alanı hesapla" #: tfrmmain.actchangedir.caption msgid "Change directory" msgstr "Dizin Değiştir" #: tfrmmain.actchangedirtohome.caption msgid "Change directory to home" msgstr "" #: tfrmmain.actchangedirtoparent.caption msgid "Change Directory To Parent" msgstr "Ana dizini değiştir" #: tfrmmain.actchangedirtoroot.caption msgid "Change directory to root" msgstr "Kök dizini Değiştir" #: tfrmmain.actchecksumcalc.caption msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION" msgid "Calculate Check&sum..." msgstr "Sağlama toplamı hesapla..." #: tfrmmain.actchecksumverify.caption msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION" msgid "&Verify Checksum..." msgstr "Sağlama toplamı doğrula..." #: tfrmmain.actclearlogfile.caption msgid "Clear log file" msgstr "Boş günlük dosyası" #: tfrmmain.actclearlogwindow.caption msgid "Clear log window" msgstr "Günlüğü Temizle penceresi" #: tfrmmain.actclosealltabs.caption msgid "Close &All Tabs" msgstr "" #: tfrmmain.actcloseduplicatetabs.caption msgid "Close Duplicate Tabs" msgstr "" #: tfrmmain.actclosetab.caption msgid "&Close Tab" msgstr "" #: tfrmmain.actcmdlinenext.caption msgid "Next Command Line" msgstr "" #: tfrmmain.actcmdlinenext.hint msgid "Set command line to next command in history" msgstr "" #: tfrmmain.actcmdlineprev.caption msgid "Previous Command Line" msgstr "" #: tfrmmain.actcmdlineprev.hint msgid "Set command line to previous command in history" msgstr "" #: tfrmmain.actcolumnsview.caption msgid "Full" msgstr "" #: tfrmmain.actcolumnsview.hint msgid "Columns View" msgstr "" #: tfrmmain.actcomparecontents.caption msgid "Compare by &Contents" msgstr "Içeriğine göre karşılaştır" #: tfrmmain.actcomparedirectories.caption msgctxt "tfrmmain.actcomparedirectories.caption" msgid "Compare Directories" msgstr "" #: tfrmmain.actcomparedirectories.hint msgctxt "tfrmmain.actcomparedirectories.hint" msgid "Compare Directories" msgstr "" #: tfrmmain.actconfigarchivers.caption msgid "Configuration of Archivers" msgstr "" #: tfrmmain.actconfigdirhotlist.caption msgctxt "tfrmmain.actconfigdirhotlist.caption" msgid "Configuration of Directory Hotlist" msgstr "" #: tfrmmain.actconfigfavoritetabs.caption msgid "Configuration of Favorite Tabs" msgstr "" #: tfrmmain.actconfigfoldertabs.caption msgid "Configuration of folder tabs" msgstr "" #: tfrmmain.actconfighotkeys.caption msgctxt "tfrmmain.actconfighotkeys.caption" msgid "Configuration of hot keys" msgstr "" #: tfrmmain.actconfigsavesettings.caption msgid "Save Settings" msgstr "" #: tfrmmain.actconfigsearches.caption msgid "Configuration of searches" msgstr "" #: tfrmmain.actconfigtoolbars.caption msgid "Toolbar..." msgstr "" #: tfrmmain.actconfigtreeviewmenus.caption msgctxt "tfrmmain.actconfigtreeviewmenus.caption" msgid "Configuration of Tree View Menu" msgstr "" #: tfrmmain.actconfigtreeviewmenuscolors.caption msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption" msgid "Configuration of Tree View Menu Colors" msgstr "" #: tfrmmain.actcontextmenu.caption msgid "Show context menu" msgstr "Bağlam menüsünü göster" #: tfrmmain.actcopy.caption #, fuzzy #| msgid "Copy F5" msgctxt "tfrmmain.actcopy.caption" msgid "Copy" msgstr "Kopyala F5" #: tfrmmain.actcopyalltabstoopposite.caption msgid "Copy all tabs to opposite side" msgstr "" #: tfrmmain.actcopyfiledetailstoclip.caption msgid "Copy all shown &columns" msgstr "" #: tfrmmain.actcopyfullnamestoclip.caption msgid "Copy Filename(s) with Full &Path" msgstr "Dosya ad(ları) tam yolu ile kopyala" #: tfrmmain.actcopynamestoclip.caption msgid "Copy &Filename(s) to Clipboard" msgstr "Dosya ad(ları) Panoya Kopyala" #: tfrmmain.actcopynoask.caption msgid "Copy files without asking for confirmation" msgstr "Onay istemeden dosya(ları) kopyala" #: tfrmmain.actcopypathnosepoffilestoclip.caption msgid "Copy Full Path of selected file(s) with no ending dir separator" msgstr "" #: tfrmmain.actcopypathoffilestoclip.caption msgid "Copy Full Path of selected file(s)" msgstr "" #: tfrmmain.actcopysamepanel.caption msgid "Copy to same panel" msgstr "Aynı panele kopyala" #: tfrmmain.actcopytoclipboard.caption msgid "&Copy" msgstr "Kopyala" #: tfrmmain.actcountdircontent.caption msgid "Sho&w Occupied Space" msgstr "&Kullanılan alanı göster" #: tfrmmain.actcuttoclipboard.caption msgid "Cu&t" msgstr "K&es" #: tfrmmain.actdebugshowcommandparameters.caption msgid "Show Command Parameters" msgstr "" #: tfrmmain.actdelete.caption #, fuzzy #| msgid "Delete F8" msgctxt "tfrmmain.actdelete.caption" msgid "Delete" msgstr "Sil F8" #: tfrmmain.actdeletesearches.caption msgid "For all searches, cancel, close and free memory" msgstr "" #: tfrmmain.actdirhistory.caption msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION" msgid "Directory history" msgstr "Dizin geçmişi" #: tfrmmain.actdirhotlist.caption msgid "Directory &Hotlist" msgstr "Sık Kullanılanlar &klasörü" #: tfrmmain.actdoanycmcommand.caption msgid "Select any command and execute it" msgstr "" #: tfrmmain.actedit.caption #, fuzzy #| msgid "Edit F4" msgctxt "tfrmmain.actedit.caption" msgid "Edit" msgstr "Düzenle F4" #: tfrmmain.acteditcomment.caption msgid "Edit Co&mment..." msgstr "Açıklamayı D&üzenle" #: tfrmmain.acteditnew.caption msgid "Edit new file" msgstr "Yeni dosya Düzenle" #: tfrmmain.acteditpath.caption msgid "Edit path field above file list" msgstr "Dosya listesi üzerinde Yol alanını düzenle" #: tfrmmain.actexchange.caption msgid "Swap &Panels" msgstr "Panoları &Değiştir" #: tfrmmain.actexecutescript.caption msgid "Execute Script" msgstr "" #: tfrmmain.actexit.caption msgctxt "TFRMMAIN.ACTEXIT.CAPTION" msgid "E&xit" msgstr "Ç&ıkış" #: tfrmmain.actextractfiles.caption msgid "&Extract Files..." msgstr "&Dosyaları Ayıkla" #: tfrmmain.actfileassoc.caption #, fuzzy #| msgid "File &Associations..." msgid "Configuration of File &Associations" msgstr "Dosya &ilişkileri" #: tfrmmain.actfilelinker.caption msgid "Com&bine Files..." msgstr "&Dosya(ları) birleştir" #: tfrmmain.actfileproperties.caption msgid "Show &File Properties" msgstr "Dosya Özelliklerini &Göster" #: tfrmmain.actfilespliter.caption msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION" msgid "Spl&it File..." msgstr "&Dosyayı Parçala" #: tfrmmain.actflatview.caption msgid "&Flat view" msgstr "" #: tfrmmain.actfocuscmdline.caption msgid "Focus command line" msgstr "Komut satırında odakla" #: tfrmmain.actfocusswap.caption msgid "Swap focus" msgstr "" #: tfrmmain.actfocusswap.hint msgid "Switch between left and right file list" msgstr "" #: tfrmmain.actgotofirstfile.caption msgid "Place cursor on first file in list" msgstr "Listedeki ilk öğeye ekleme noktasını(imleç) ayarla" #: tfrmmain.actgotolastfile.caption msgid "Place cursor on last file in list" msgstr "Listedeki son madde için imleci ayarlayın" #: tfrmmain.acthardlink.caption msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION" msgid "Create &Hard Link..." msgstr "&Sabit bağlantı oluştur" #: tfrmmain.acthelpindex.caption msgid "&Contents" msgstr "&İçindekiler" #: tfrmmain.acthorizontalfilepanels.caption msgid "&Horizontal Panels Mode" msgstr "&Panoları yatay bölme modu" #: tfrmmain.actkeyboard.caption msgid "&Keyboard" msgstr "&Klavye" #: tfrmmain.actleftbriefview.caption msgid "Brief view on left panel" msgstr "" #: tfrmmain.actleftcolumnsview.caption msgid "Columns view on left panel" msgstr "" #: tfrmmain.actleftequalright.caption msgid "Left &= Right" msgstr "Sol &= Sağ" #: tfrmmain.actleftflatview.caption msgid "&Flat view on left panel" msgstr "" #: tfrmmain.actleftopendrives.caption msgid "Open left drive list" msgstr "Sol sürücü listesini aç" #: tfrmmain.actleftreverseorder.caption msgid "Re&verse order on left panel" msgstr "" #: tfrmmain.actleftsortbyattr.caption msgid "Sort left panel by &Attributes" msgstr "" #: tfrmmain.actleftsortbydate.caption msgid "Sort left panel by &Date" msgstr "" #: tfrmmain.actleftsortbyext.caption msgid "Sort left panel by &Extension" msgstr "" #: tfrmmain.actleftsortbyname.caption msgid "Sort left panel by &Name" msgstr "" #: tfrmmain.actleftsortbysize.caption msgid "Sort left panel by &Size" msgstr "" #: tfrmmain.actleftthumbview.caption msgid "Thumbnails view on left panel" msgstr "" #: tfrmmain.actloadfavoritetabs.caption msgid "Load tabs from Favorite Tabs" msgstr "" #: tfrmmain.actloadselectionfromclip.caption msgid "Load Selection from Clip&board" msgstr "Panoya &Yükle öğesini seç" #: tfrmmain.actloadselectionfromfile.caption msgid "&Load Selection from File..." msgstr "&Dosya Yükle öğesini seç" #: tfrmmain.actloadtabs.caption msgid "&Load Tabs from File" msgstr "" #: tfrmmain.actmakedir.caption #, fuzzy #| msgid "Create directory" msgid "Create &Directory" msgstr "Yeni Dizin F7" #: tfrmmain.actmarkcurrentextension.caption msgid "Select All with the Same E&xtension" msgstr "Ayni uzantıya &sahip olanların tümünü seç" #: tfrmmain.actmarkcurrentname.caption msgid "Select all files with same name" msgstr "" #: tfrmmain.actmarkcurrentnameext.caption msgid "Select all files with same name and extension" msgstr "" #: tfrmmain.actmarkcurrentpath.caption msgid "Select all in same path" msgstr "" #: tfrmmain.actmarkinvert.caption msgid "&Invert Selection" msgstr "&Seçimi tersine çevir" #: tfrmmain.actmarkmarkall.caption msgid "&Select All" msgstr "&Tümünü Seç" #: tfrmmain.actmarkminus.caption msgid "Unselect a Gro&up..." msgstr "Gruptan& seçimi kaldır" #: tfrmmain.actmarkplus.caption msgid "Select a &Group..." msgstr "&Grup seç" #: tfrmmain.actmarkunmarkall.caption msgid "&Unselect All" msgstr "&Tüm Seçimi Kaldır" #: tfrmmain.actminimize.caption msgid "Minimize window" msgstr "Pencereyi simge durumuna küçült" #: tfrmmain.actmultirename.caption msgid "Multi &Rename Tool" msgstr "Çoklu ¥iden adlandırma aracı" #: tfrmmain.actnetworkconnect.caption msgid "Network &Connect..." msgstr "Ağ &Bağlantısı..." #: tfrmmain.actnetworkdisconnect.caption msgid "Network &Disconnect" msgstr "Ağ &Bağlantısını kes" #: tfrmmain.actnetworkquickconnect.caption msgid "Network &Quick Connect..." msgstr "Hızlı &Ağ Bağlantısı..." #: tfrmmain.actnewtab.caption msgid "&New Tab" msgstr "&Yeni Sekme" #: tfrmmain.actnextfavoritetabs.caption msgid "Load the Next Favorite Tabs in the list" msgstr "" #: tfrmmain.actnexttab.caption msgid "Switch to Nex&t Tab" msgstr "Sonraki &Sekmeye Geç" #: tfrmmain.actopen.caption msgctxt "TFRMMAIN.ACTOPEN.CAPTION" msgid "Open" msgstr "Açık" #: tfrmmain.actopenarchive.caption msgid "Try open archive" msgstr "Arşivi açmak için tekrar dene" #: tfrmmain.actopenbar.caption msgid "Open bar file" msgstr "Dosya Çubuğu Aç" #: tfrmmain.actopendirinnewtab.caption msgid "Open &Folder in a New Tab" msgstr "Klasörü &Yeni Sekmede Aç" #: tfrmmain.actopenvirtualfilesystemlist.caption msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION" msgid "Open &VFS List" msgstr "Sanal Dosya Sistemi &listesi(VFS) aç" #: tfrmmain.actoperationsviewer.caption msgid "Operations &Viewer" msgstr "İşlemleri & Görüntüle" #: tfrmmain.actoptions.caption msgid "&Options..." msgstr "&Seçenekler..." #: tfrmmain.actpackfiles.caption msgid "&Pack Files..." msgstr "&Sıkıştırılmış Dosya(lar)" #: tfrmmain.actpanelssplitterperpos.caption msgid "Set splitter position" msgstr "Parçalamanın konumunu ayarla" #: tfrmmain.actpastefromclipboard.caption msgid "&Paste" msgstr "&Yapıştır" #: tfrmmain.actpreviousfavoritetabs.caption msgid "Load the Previous Favorite Tabs in the list" msgstr "" #: tfrmmain.actprevtab.caption msgid "Switch to &Previous Tab" msgstr "Bir önceki &sekmeye geç" #: tfrmmain.actquickfilter.caption msgid "Quick filter" msgstr "Hızlı süzgeç" #: tfrmmain.actquicksearch.caption msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION" msgid "Quick search" msgstr "Hızlı ara" #: tfrmmain.actquickview.caption msgid "&Quick View Panel" msgstr "&Hızlı Görünüm paneli" #: tfrmmain.actrefresh.caption msgid "&Refresh" msgstr "&Yenile" #: tfrmmain.actreloadfavoritetabs.caption msgid "Reload the last Favorite Tabs loaded" msgstr "" #: tfrmmain.actrename.caption #, fuzzy #| msgid "Move F6" msgctxt "tfrmmain.actrename.caption" msgid "Move" msgstr "Taşı F6" #: tfrmmain.actrenamenoask.caption msgid "Move/Rename files without asking for confirmation" msgstr "Dosya(ları) onay istemeden Yeniden adlandır/ Taşı" #: tfrmmain.actrenameonly.caption msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION" msgid "Rename" msgstr "Yeniden Adlandır" #: tfrmmain.actrenametab.caption #, fuzzy #| msgid "Re&name Tab" msgid "&Rename Tab" msgstr "Sekmeyi &Yeniden Adlandır" #: tfrmmain.actresavefavoritetabs.caption msgid "Resave on the last Favorite Tabs loaded" msgstr "" #: tfrmmain.actrestoreselection.caption msgid "&Restore Selection" msgstr "&Seçimi geri yükle" #: tfrmmain.actreverseorder.caption msgid "Re&verse Order" msgstr "Te&rs Sırala" #: tfrmmain.actrightbriefview.caption msgid "Brief view on right panel" msgstr "" #: tfrmmain.actrightcolumnsview.caption msgid "Columns view on right panel" msgstr "" #: tfrmmain.actrightequalleft.caption msgid "Right &= Left" msgstr "Sağ &= Sol" #: tfrmmain.actrightflatview.caption msgid "&Flat view on right panel" msgstr "" #: tfrmmain.actrightopendrives.caption msgid "Open right drive list" msgstr "Sağ sürücü listesini aç" #: tfrmmain.actrightreverseorder.caption msgid "Re&verse order on right panel" msgstr "" #: tfrmmain.actrightsortbyattr.caption msgid "Sort right panel by &Attributes" msgstr "" #: tfrmmain.actrightsortbydate.caption msgid "Sort right panel by &Date" msgstr "" #: tfrmmain.actrightsortbyext.caption msgid "Sort right panel by &Extension" msgstr "" #: tfrmmain.actrightsortbyname.caption msgid "Sort right panel by &Name" msgstr "" #: tfrmmain.actrightsortbysize.caption msgid "Sort right panel by &Size" msgstr "" #: tfrmmain.actrightthumbview.caption msgid "Thumbnails view on right panel" msgstr "" #: tfrmmain.actrunterm.caption msgid "Run &Terminal" msgstr "Komut istemi penceresini aç" #: tfrmmain.actsavefavoritetabs.caption msgid "Save current tabs to a New Favorite Tabs" msgstr "" #: tfrmmain.actsaveselection.caption msgid "Sa&ve Selection" msgstr "Seçimi &Kaydet" #: tfrmmain.actsaveselectiontofile.caption msgid "Save S&election to File..." msgstr "Seçimi dosyaya &Kaydet" #: tfrmmain.actsavetabs.caption msgid "&Save Tabs to File" msgstr "" #: tfrmmain.actsearch.caption msgid "&Search..." msgstr "&Araştır" #: tfrmmain.actsetalltabsoptiondirsinnewtab.caption msgid "All tabs Locked with Dir Opened in New Tabs" msgstr "" #: tfrmmain.actsetalltabsoptionnormal.caption msgid "Set all tabs to Normal" msgstr "" #: tfrmmain.actsetalltabsoptionpathlocked.caption msgid "Set all tabs to Locked" msgstr "" #: tfrmmain.actsetalltabsoptionpathresets.caption msgid "All tabs Locked with Dir Changes Allowed" msgstr "" #: tfrmmain.actsetfileproperties.caption msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION" msgid "Change &Attributes..." msgstr "Öznitelikleri &Değiştir" #: tfrmmain.actsettaboptiondirsinnewtab.caption msgid "Locked with Directories Opened in New &Tabs" msgstr "Kilitli Dizinleri &Yeni Sekmede Aç" #: tfrmmain.actsettaboptionnormal.caption msgid "&Normal" msgstr "Normal" #: tfrmmain.actsettaboptionpathlocked.caption msgid "&Locked" msgstr "Kilitli" #: tfrmmain.actsettaboptionpathresets.caption msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION" msgid "Locked with &Directory Changes Allowed" msgstr "Kilitli, ancak &izin verilenler değiştirilebilir" #: tfrmmain.actshellexecute.caption msgctxt "tfrmmain.actshellexecute.caption" msgid "Open" msgstr "Açık" #: tfrmmain.actshellexecute.hint msgid "Open using system associations" msgstr "" #: tfrmmain.actshowbuttonmenu.caption msgid "Show button menu" msgstr "Düğme menüsünü göster" #: tfrmmain.actshowcmdlinehistory.caption msgid "Show command line history" msgstr "Komut satırı geçmişi göster" #: tfrmmain.actshowmainmenu.caption #, fuzzy #| msgid "Menu F9" msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION" msgid "Menu" msgstr "Menü F9" #: tfrmmain.actshowsysfiles.caption msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION" msgid "Show &Hidden/System Files" msgstr "Gizli/sistem &dosyalarını göster" #: tfrmmain.actsortbyattr.caption msgid "Sort by &Attributes" msgstr "Özniteliklerine &Göre Sırala" #: tfrmmain.actsortbydate.caption msgid "Sort by &Date" msgstr "Tarihine &Göre Sırala" #: tfrmmain.actsortbyext.caption msgid "Sort by &Extension" msgstr "Uzantısına &Göre Sırala" #: tfrmmain.actsortbyname.caption msgid "Sort by &Name" msgstr "Adına &Göre Sırala" #: tfrmmain.actsortbysize.caption msgid "Sort by &Size" msgstr "Boyutuna &Göre Sırala" #: tfrmmain.actsrcopendrives.caption msgid "Open drive list" msgstr "" #: tfrmmain.actswitchignorelist.caption msgid "Enable/disable ignore list file to not show file names" msgstr "Etkinleştirme/devre dışı bırakma yoksayma listesi dosyaları için dosya adları" #: tfrmmain.actsymlink.caption msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION" msgid "Create Symbolic &Link..." msgstr "Simgesel bağlantı &Oluştur" #: tfrmmain.actsyncdirs.caption msgid "Synchronize dirs..." msgstr "" #: tfrmmain.acttargetequalsource.caption msgid "Target &= Source" msgstr "Hedef &= Kaynak" #: tfrmmain.acttestarchive.caption msgid "&Test Archive(s)" msgstr "&Arşivi(leri)Test Et" #: tfrmmain.actthumbnailsview.caption msgctxt "tfrmmain.actthumbnailsview.caption" msgid "Thumbnails" msgstr "" #: tfrmmain.actthumbnailsview.hint msgid "Thumbnails View" msgstr "" #: tfrmmain.acttogglefullscreenconsole.caption msgid "Toggle fullscreen mode console" msgstr "" #: tfrmmain.acttransferleft.caption msgid "Transfer dir under cursor to left window" msgstr "Sol penceredeki seçilen klasörü taşı" #: tfrmmain.acttransferright.caption msgid "Transfer dir under cursor to right window" msgstr "sağ penceredeki seçilen klasörü taşı" #: tfrmmain.acttreeview.caption msgid "&Tree View Panel" msgstr "" #: tfrmmain.actuniversalsingledirectsort.caption msgid "Sort according to parameters" msgstr "" #: tfrmmain.actunmarkcurrentextension.caption msgid "Unselect All with the Same Ex&tension" msgstr "Ayni uzantılı olanların tümünün seçimini kaldır" #: tfrmmain.actunmarkcurrentname.caption msgid "Unselect all files with same name" msgstr "" #: tfrmmain.actunmarkcurrentnameext.caption msgid "Unselect all files with same name and extension" msgstr "" #: tfrmmain.actunmarkcurrentpath.caption msgid "Unselect all in same path" msgstr "" #: tfrmmain.actview.caption #, fuzzy #| msgid "View F3" msgctxt "tfrmmain.actview.caption" msgid "View" msgstr "Göster F3" #: tfrmmain.actviewhistory.caption msgid "Show history of visited paths for active view" msgstr "Ziyaret edilen yolun etkin görüntüsünün geçmişini göster\"" #: tfrmmain.actviewhistorynext.caption msgid "Go to next entry in history" msgstr "Git sonraki giriş tarihi" #: tfrmmain.actviewhistoryprev.caption msgid "Go to previous entry in history" msgstr "Git önceki giriş tarihi" #: tfrmmain.actviewlogfile.caption msgid "View log file" msgstr "" #: tfrmmain.actviewsearches.caption msgid "View current search instances" msgstr "" #: tfrmmain.actvisithomepage.caption msgid "&Visit Double Commander Website" msgstr "" #: tfrmmain.actwipe.caption msgid "Wipe" msgstr "Temizle" #: tfrmmain.actworkwithdirectoryhotlist.caption msgid "Work with Directory Hotlist and parameters" msgstr "" #: tfrmmain.btnf10.caption #, fuzzy #| msgid "Exit F10" msgctxt "tfrmmain.btnf10.caption" msgid "Exit" msgstr "Çıkış F10" #: tfrmmain.btnf7.caption msgctxt "tfrmmain.btnf7.caption" msgid "Directory" msgstr "Dizin" #: tfrmmain.btnf8.caption msgctxt "tfrmmain.btnf8.caption" msgid "Delete" msgstr "&Sil" #: tfrmmain.btnf9.caption #, fuzzy #| msgid "Terminal F9" msgctxt "tfrmmain.btnf9.caption" msgid "Terminal" msgstr "Komut İstemi F9" #: tfrmmain.btnleftdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "*" #: tfrmmain.btnleftdirectoryhotlist.hint #, fuzzy #| msgid "Directory hotlist" msgctxt "tfrmmain.btnleftdirectoryhotlist.hint" msgid "Directory Hotlist" msgstr "Önemli liste Dizini" #: tfrmmain.btnleftequalright.caption msgctxt "tfrmmain.btnleftequalright.caption" msgid "<" msgstr "<" #: tfrmmain.btnleftequalright.hint msgid "Show current directory of the right panel in the left panel" msgstr "Sol paneldeki sağ panelin geçerli dizini göster" #: tfrmmain.btnlefthome.caption msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION" msgid "~" msgstr "~" #: tfrmmain.btnlefthome.hint msgid "Go to home directory" msgstr "Dizinin Başına Git" #: tfrmmain.btnleftroot.caption msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION" msgid "/" msgstr "/" #: tfrmmain.btnleftroot.hint msgid "Go to root directory" msgstr "Kök Dizinine Git" #: tfrmmain.btnleftup.caption msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION" msgid ".." msgstr ".." #: tfrmmain.btnleftup.hint msgid "Go to parent directory" msgstr "Ana dizinine git" #: tfrmmain.btnrightdirectoryhotlist.caption msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION" msgid "*" msgstr "*" #: tfrmmain.btnrightdirectoryhotlist.hint #, fuzzy msgctxt "tfrmmain.btnrightdirectoryhotlist.hint" msgid "Directory Hotlist" msgstr "Önemli Liste Dizini" #: tfrmmain.btnrightequalleft.caption msgctxt "tfrmmain.btnrightequalleft.caption" msgid ">" msgstr ">" #: tfrmmain.btnrightequalleft.hint msgid "Show current directory of the left panel in the right panel" msgstr "Sağ paneldeki sol panelin geçerli dizini göster" #: tfrmmain.btnrighthome.caption msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION" msgid "~" msgstr "~" #: tfrmmain.btnrightroot.caption msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION" msgid "/" msgstr "/" #: tfrmmain.btnrightup.caption msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION" msgid ".." msgstr ".." #: tfrmmain.caption msgctxt "tfrmmain.caption" msgid "Double Commander" msgstr "Double Commander" #: tfrmmain.lblcommandpath.caption msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION" msgid "Path" msgstr "Yol" #: tfrmmain.mi2080.caption msgid "&20/80" msgstr "&20/80" #: tfrmmain.mi3070.caption msgid "&30/70" msgstr "&30/70" #: tfrmmain.mi4060.caption msgid "&40/60" msgstr "&40/60" #: tfrmmain.mi5050.caption msgid "&50/50" msgstr "&50/50" #: tfrmmain.mi6040.caption msgid "&60/40" msgstr "&60/40" #: tfrmmain.mi7030.caption msgid "&70/30" msgstr "&70/30" #: tfrmmain.mi8020.caption msgid "&80/20" msgstr "&80/20" #: tfrmmain.micancel.caption msgctxt "TFRMMAIN.MICANCEL.CAPTION" msgid "Cancel" msgstr "İptal" #: tfrmmain.micopy.caption msgid "Copy..." msgstr "Kopyala..." #: tfrmmain.mihardlink.caption msgctxt "TFRMMAIN.MIHARDLINK.CAPTION" msgid "Create link..." msgstr "Bağlantı oluştur" #: tfrmmain.milogclear.caption msgid "Clear" msgstr "Temizle" #: tfrmmain.milogcopy.caption msgctxt "TFRMMAIN.MILOGCOPY.CAPTION" msgid "Copy" msgstr "Kopyala" #: tfrmmain.miloghide.caption msgid "Hide" msgstr "Gizle" #: tfrmmain.milogselectall.caption msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION" msgid "Select All" msgstr "Hepsini Seç" #: tfrmmain.mimove.caption msgid "Move..." msgstr "Taşı..." #: tfrmmain.misymlink.caption msgctxt "TFRMMAIN.MISYMLINK.CAPTION" msgid "Create symlink..." msgstr "Sembolik bağ oluştur" #: tfrmmain.mitaboptions.caption msgid "Tab options" msgstr "Sekme seçenekleri" #: tfrmmain.mitrayiconexit.caption msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION" msgid "E&xit" msgstr "Çıkış" #: tfrmmain.mitrayiconrestore.caption msgid "Restore" msgstr "Eski haline getir" #: tfrmmain.mnualloperpause.caption msgctxt "tfrmmain.mnualloperpause.caption" msgid "||" msgstr "||" #: tfrmmain.mnualloperstart.caption msgctxt "tfrmmain.mnualloperstart.caption" msgid "Start" msgstr "Başlat" #: tfrmmain.mnualloperstop.caption #, fuzzy #| msgid "Cancel" msgctxt "tfrmmain.mnualloperstop.caption" msgid "Cancel" msgstr "Bitiş" #: tfrmmain.mnucmd.caption msgid "&Commands" msgstr "&Komutlar" #: tfrmmain.mnuconfig.caption msgid "C&onfiguration" msgstr "&Yapılandır" #: tfrmmain.mnufavoritetabs.caption msgid "Favorites" msgstr "" #: tfrmmain.mnufiles.caption msgid "&Files" msgstr "&Dosyalar" #: tfrmmain.mnuhelp.caption msgctxt "TFRMMAIN.MNUHELP.CAPTION" msgid "&Help" msgstr "&Yardım" #: tfrmmain.mnumark.caption msgid "&Mark" msgstr "&İşaretle" #: tfrmmain.mnunetwork.caption msgctxt "TFRMMAIN.MNUNETWORK.CAPTION" msgid "Network" msgstr "Ağ" #: tfrmmain.mnushow.caption msgid "&Show" msgstr "&Görünüm" #: tfrmmain.mnutaboptions.caption #, fuzzy #| msgid "&Options" msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION" msgid "Tab &Options" msgstr "Seçenekler" #: tfrmmain.mnutabs.caption msgid "&Tabs" msgstr "&Sekmeler" #: tfrmmain.tbchangedir.caption msgid "CD" msgstr "CD" #: tfrmmain.tbcopy.caption msgctxt "TFRMMAIN.TBCOPY.CAPTION" msgid "Copy" msgstr "Kopyala" #: tfrmmain.tbcut.caption msgctxt "TFRMMAIN.TBCUT.CAPTION" msgid "Cut" msgstr "Kes" #: tfrmmain.tbdelete.caption msgctxt "TFRMMAIN.TBDELETE.CAPTION" msgid "Delete" msgstr "Sil" #: tfrmmain.tbedit.caption msgctxt "TFRMMAIN.TBEDIT.CAPTION" msgid "Edit" msgstr "Düzenle" #: tfrmmain.tbpaste.caption msgctxt "TFRMMAIN.TBPASTE.CAPTION" msgid "Paste" msgstr "Yapıştır" #: tfrmmaincommandsdlg.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "tfrmmaincommandsdlg.btncancel.caption" msgid "&Cancel" msgstr "İptal" #: tfrmmaincommandsdlg.btnok.caption #, fuzzy msgctxt "tfrmmaincommandsdlg.btnok.caption" msgid "&OK" msgstr "&TAMAM" #: tfrmmaincommandsdlg.caption msgid "Select your internal command" msgstr "" #: tfrmmaincommandsdlg.cbcategorysortornot.text msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text" msgid "Legacy sorted" msgstr "" #: tfrmmaincommandsdlg.cbcommandssortornot.text msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text" msgid "Legacy sorted" msgstr "" #: tfrmmaincommandsdlg.cbselectallcategorydefault.caption msgid "Select all categories by default" msgstr "" #: tfrmmaincommandsdlg.gbselection.caption msgid "Selection:" msgstr "" #: tfrmmaincommandsdlg.lblcategory.caption msgid "&Categories:" msgstr "" #: tfrmmaincommandsdlg.lblcommandname.caption msgid "Command &name:" msgstr "" #: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption msgid "&Filter:" msgstr "" #: tfrmmaincommandsdlg.lblhint.caption msgid "Hint:" msgstr "" #: tfrmmaincommandsdlg.lblhotkey.caption msgid "Hotkey:" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommand.caption msgid "cm_name" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommandcategory.caption msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption" msgid "Category" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommandhelp.caption msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption" msgid "Help" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommandhint.caption msgid "Hint" msgstr "" #: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption #, fuzzy msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption" msgid "Hotkey" msgstr "Kısayol tuşu" #: tfrmmaskinputdlg.btnaddattribute.caption #, fuzzy msgctxt "tfrmmaskinputdlg.btnaddattribute.caption" msgid "&Add" msgstr "&Ekle" #: tfrmmaskinputdlg.btnattrshelp.caption #, fuzzy msgctxt "tfrmmaskinputdlg.btnattrshelp.caption" msgid "&Help" msgstr "&Yardım" #: tfrmmaskinputdlg.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmmaskinputdlg.btndefinetemplate.caption #, fuzzy #| msgid "Define..." msgid "&Define..." msgstr "Tanımla..." #: tfrmmaskinputdlg.btnok.caption msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION" msgid "&OK" msgstr "&TAMAM" #: tfrmmaskinputdlg.chkcasesensitive.caption msgid "Case sensitive" msgstr "" #: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption msgid "Ignore accents and ligatures" msgstr "" #: tfrmmaskinputdlg.lblattributes.caption msgid "Attri&butes:" msgstr "" #: tfrmmaskinputdlg.lblprompt.caption msgid "Input Mask:" msgstr "Make girişi:" #: tfrmmaskinputdlg.lblsearchtemplate.caption #, fuzzy #| msgid "Or select predefined selection type:" msgid "O&r select predefined selection type:" msgstr "Veya önceden tanımlanmış seçenek türünü seçin:" #: tfrmmkdir.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmmkdir.btnok.caption msgctxt "TFRMMKDIR.BTNOK.CAPTION" msgid "&OK" msgstr "&TAMAM" #: tfrmmkdir.caption msgid "Create new directory" msgstr "Yeni dizin oluştur" #: tfrmmkdir.lblmakedir.caption #, fuzzy #| msgid "Input new directory name:" msgid "&Input new directory name:" msgstr "Yeni klasör için ad girin" #: tfrmmodview.btnpath1.caption msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath2.caption msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath3.caption msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath4.caption msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.btnpath5.caption msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION" msgid "..." msgstr "..." #: tfrmmodview.caption msgctxt "tfrmmodview.caption" msgid "New Size" msgstr "Yeni Boyut" #: tfrmmodview.lblheight.caption msgid "Height :" msgstr "Yükseklik :" #: tfrmmodview.lblpath1.caption msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION" msgid "1" msgstr "1" #: tfrmmodview.lblpath2.caption msgid "2" msgstr "2" #: tfrmmodview.lblpath3.caption msgid "3" msgstr "3" #: tfrmmodview.lblpath4.caption msgid "4" msgstr "4" #: tfrmmodview.lblpath5.caption msgid "5" msgstr "5" #: tfrmmodview.lblquality.caption msgid "Quality of compress to Jpg" msgstr "JPG sıkıştırma kalitesi" #: tfrmmodview.lblwidth.caption msgid "Width :" msgstr "Genişlik:" #: tfrmmodview.rbbmp.caption msgid "BMP" msgstr "BMP" #: tfrmmodview.rbico.caption msgid "ICO" msgstr "ICO" #: tfrmmodview.rbjpg.caption msgid "JPG" msgstr "JPG" #: tfrmmodview.rbpng.caption msgid "PNG" msgstr "PNG" #: tfrmmodview.rbpnm.caption msgid "PNM" msgstr "PNM" #: tfrmmodview.teheight.text msgctxt "tfrmmodview.teheight.text" msgid "Height" msgstr "Yükseklik" #: tfrmmodview.tequality.text msgid "80" msgstr "80" #: tfrmmodview.tewidth.text msgctxt "TFRMMODVIEW.TEWIDTH.TEXT" msgid "Width" msgstr "Genişlik" #: tfrmmsg.lblmsg.caption msgid "456456465465465" msgstr "" #: tfrmmultirename.btnclose.caption msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION" msgid "&Close" msgstr "&Kapat" #: tfrmmultirename.btndeletepreset.caption msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION" msgid "&Delete" msgstr "&Sil" #: tfrmmultirename.btnedit.caption #, fuzzy msgctxt "tfrmmultirename.btnedit.caption" msgid "&Edit" msgstr "&Düzenle" #: tfrmmultirename.btnextmenu.caption msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION" msgid "..." msgstr "..." #: tfrmmultirename.btnloadpreset.caption msgid "&Load" msgstr "&Yükle" #: tfrmmultirename.btnnamemenu.caption msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION" msgid "..." msgstr "..." #: tfrmmultirename.btnrename.caption msgctxt "tfrmmultirename.btnrename.caption" msgid "&Rename" msgstr "&Yeniden Adlandır" #: tfrmmultirename.btnrestore.caption #, fuzzy #| msgid "Reset all" msgid "Reset &all" msgstr "Tümünü geri yükle" #: tfrmmultirename.btnsavepreset.caption msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION" msgid "&Save" msgstr "&Kaydet" #: tfrmmultirename.caption msgctxt "tfrmmultirename.caption" msgid "MultiRename" msgstr "Çoklu yeniden adlandırma" #: tfrmmultirename.cblog.caption #, fuzzy #| msgid "Enable" msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION" msgid "Ena&ble" msgstr "Etkinleştir" #: tfrmmultirename.cbregexp.caption msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION" msgid "Regular e&xpressions" msgstr "&Kısaltılmış metin karekterleri" #: tfrmmultirename.cbusesubs.caption msgid "&Use substitution" msgstr "&Yerine Kullan" #: tfrmmultirename.cmbxwidth.text msgid "01" msgstr "01" #: tfrmmultirename.edinterval.text msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT" msgid "1" msgstr "1" #: tfrmmultirename.edpoc.text msgctxt "TFRMMULTIRENAME.EDPOC.TEXT" msgid "1" msgstr "1" #: tfrmmultirename.extension.caption msgid "[E] Extension" msgstr "[E]Uzantı" #: tfrmmultirename.gbcounter.caption msgid "Counter" msgstr "Sayaç" #: tfrmmultirename.gbfindreplace.caption msgid "Find && Replace" msgstr "Bul ve Yerine Koy" #: tfrmmultirename.gblog.caption msgid "Log Result" msgstr "Günlük sonuç" #: tfrmmultirename.gbmaska.caption msgid "Mask" msgstr "Maske" #: tfrmmultirename.gbpresets.caption msgid "Presets" msgstr "Ön ayarlı" #: tfrmmultirename.lbext.caption msgid "&Extension" msgstr "&Uzantı" #: tfrmmultirename.lbfind.caption msgid "&Find..." msgstr "&Bul..." #: tfrmmultirename.lbinterval.caption #, fuzzy #| msgid "Interval" msgid "&Interval" msgstr "Aralık" #: tfrmmultirename.lbname.caption msgid "File &Name" msgstr "Dosya &Adı" #: tfrmmultirename.lbreplace.caption msgid "Re&place..." msgstr "&Değiştir..." #: tfrmmultirename.lbstnb.caption #, fuzzy #| msgid "Start Number" msgid "S&tart Number" msgstr "Başlangıç ​​Numarası" #: tfrmmultirename.lbwidth.caption #, fuzzy #| msgid "Width" msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION" msgid "&Width" msgstr "Genişlik" #: tfrmmultirename.micounter.caption msgid "[C] Counter" msgstr "[C] Yöntem sayma" #: tfrmmultirename.miday.caption msgid "[D] Day" msgstr "[D] Gün" #: tfrmmultirename.miday1.caption msgid "[DD] Day (2 digits)" msgstr "[DD] Gün (2 basamaklı)" #: tfrmmultirename.miday2.caption msgid "[DDD] Day of the week (short, e.g., \"mon\")" msgstr "[DDD] Haftanın günü (kısa, Örneğin, \"Prtesi\")" #: tfrmmultirename.miday3.caption msgid "[DDDD] Day of the week (long, e.g., \"monday\")" msgstr "[DDDD] Haftanın günü (uzun, Örneğin, \"Pazartesi\")" #: tfrmmultirename.miextensionx.caption msgid "[Ex] Character at position x" msgstr "[Ex]Karakter konumu x" #: tfrmmultirename.miextensionxx.caption msgid "[Ex:y] Characters from position x to y" msgstr "[Ex:y]Karakter konumu x ile y" #: tfrmmultirename.mihour.caption msgid "[h] Hour" msgstr "[h]Saat" #: tfrmmultirename.mihour1.caption msgid "[hh] Hour (2 digits)" msgstr "[hh] Saat (2 basamaklı)" #: tfrmmultirename.miminute.caption msgid "[n] Minute" msgstr "[n] Dakika" #: tfrmmultirename.miminute1.caption msgid "[nn] Minute (2 digits)" msgstr "[nn] Dakika (2 basamaklı)" #: tfrmmultirename.mimonth.caption msgid "[M] Month" msgstr "[M] Ay" #: tfrmmultirename.mimonth1.caption msgid "[MM] Month (2 digits)" msgstr "[MM] Ay (2 basamaklı)" #: tfrmmultirename.mimonth2.caption msgid "[MMM] Month name (short, e.g., \"jan\")" msgstr "[MMM] Ay Adı (kısa, Örneğin, \"Şbat\")" #: tfrmmultirename.mimonth3.caption #, fuzzy #| msgid "[MMMM] Month name (long, e.g. \"january\")" msgid "[MMMM] Month name (long, e.g., \"january\")" msgstr "[MMMM] Ay Adı (Uzun, Örneğin, \"Şubat\")" #: tfrmmultirename.miname.caption msgid "[N] Name" msgstr "[N] Adı" #: tfrmmultirename.minamex.caption msgid "[Nx] Character at position x" msgstr "[Nx]Karakter konumu x" #: tfrmmultirename.minamexx.caption msgid "[Nx:y] Characters from position x to y" msgstr "[Nx:y] Karakter konumu x ile y" #: tfrmmultirename.minext.caption msgid "Time..." msgstr "Tarih..." #: tfrmmultirename.minextextension.caption msgid "Extension..." msgstr "Uzantı..." #: tfrmmultirename.minextname.caption msgid "Name..." msgstr "Adı..." #: tfrmmultirename.miplugin.caption msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION" msgid "Plugin" msgstr "Eklenti" #: tfrmmultirename.misecond.caption msgid "[s] Second" msgstr "[S] Saniye " #: tfrmmultirename.misecond1.caption msgid "[ss] Second (2 digits)" msgstr "[ss] Saniye (2 basamaklı)" #: tfrmmultirename.miyear.caption msgid "[Y] Year (2 digits)" msgstr "[Y] Yıl (2 basamaklı)" #: tfrmmultirename.miyear1.caption msgid "[YYYY] Year (4 digits)" msgstr "[YYYY] Yıl (4 basamaklı)" #: tfrmmultirename.mnueditnames.caption msgid "Edit names..." msgstr "" #: tfrmmultirename.mnuloadfromfile.caption msgid "Load names from file..." msgstr "" #: tfrmmultirename.n1.caption msgctxt "TFRMMULTIRENAME.N1.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n2.caption msgctxt "TFRMMULTIRENAME.N2.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n3.caption msgctxt "TFRMMULTIRENAME.N3.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n4.caption msgctxt "TFRMMULTIRENAME.N4.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.n5.caption msgctxt "TFRMMULTIRENAME.N5.CAPTION" msgid "-" msgstr "-" #: tfrmmultirename.stringgrid.columns[0].title.caption msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption" msgid "Old File Name" msgstr "Eski dosya adı" #: tfrmmultirename.stringgrid.columns[1].title.caption msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption" msgid "New File Name" msgstr "Yeni dosya adı" #: tfrmmultirename.stringgrid.columns[2].title.caption msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption" msgid "File Path" msgstr "Dosya Yolu" #: tfrmmultirenamewait.caption #, fuzzy msgctxt "tfrmmultirenamewait.caption" msgid "Double Commander" msgstr "Double Commander" #: tfrmmultirenamewait.lblmessage.caption msgid "Click OK when you have closed the editor to load the changed names!" msgstr "" #: tfrmopenwith.caption msgid "Choose an application" msgstr "" #: tfrmopenwith.chkcustomcommand.caption msgid "Custom command" msgstr "" #: tfrmopenwith.chksaveassociation.caption msgid "Save association" msgstr "" #: tfrmopenwith.chkuseasdefault.caption msgid "Set selected application as default action" msgstr "" #: tfrmopenwith.lblmimetype.caption msgid "File type to be opened: %s" msgstr "" #: tfrmopenwith.milistoffiles.caption msgid "Multiple file names" msgstr "" #: tfrmopenwith.milistoffiles.hint msgid "%F" msgstr "" #: tfrmopenwith.milistofurls.caption msgid "Multiple URIs" msgstr "" #: tfrmopenwith.milistofurls.hint msgid "%U" msgstr "" #: tfrmopenwith.misinglefilename.caption msgid "Single file name" msgstr "" #: tfrmopenwith.misinglefilename.hint msgid "%f" msgstr "" #: tfrmopenwith.misingleurl.caption msgid "Single URI" msgstr "" #: tfrmopenwith.misingleurl.hint msgid "%u" msgstr "" #: tfrmoptions.btnapply.caption #, fuzzy #| msgid "Apply" msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION" msgid "&Apply" msgstr "Uygula" #: tfrmoptions.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmoptions.btnok.caption msgctxt "TFRMOPTIONS.BTNOK.CAPTION" msgid "&OK" msgstr "&TAMAM" #: tfrmoptions.caption msgctxt "tfrmoptions.caption" msgid "Options" msgstr "Seçenekler" #: tfrmoptions.lblemptyeditor.caption msgid "Please select one of the subpages, this page does not contain any settings." msgstr "" #: tfrmoptionsarchivers.btnarchiveradd.caption msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption" msgid "A&dd" msgstr "Ekle" #: tfrmoptionsarchivers.btnarchiveraddhelper.hint msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverapply.caption msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption" msgid "A&pply" msgstr "Uygula" #: tfrmoptionsarchivers.btnarchivercopy.caption msgid "Cop&y" msgstr "Kopyala" #: tfrmoptionsarchivers.btnarchiverdelete.caption msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption" msgid "Delete" msgstr "&Sil" #: tfrmoptionsarchivers.btnarchiverdeletehelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverextracthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverlisthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchiverother.caption msgid "Oth&er..." msgstr "Diğer..." #: tfrmoptionsarchivers.btnarchiverrelativer.hint msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsarchivers.btnarchiverrename.caption msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption" msgid "&Rename" msgstr "&Yeniden Adlandır" #: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.btnarchivertesthelper.hint msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint" msgid "Variable reminder helper" msgstr "" #: tfrmoptionsarchivers.bvlarchiverids.caption msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption" msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:" msgstr "" #: tfrmoptionsarchivers.bvlarchiveroptions.caption msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption" msgid "Options:" msgstr "Seçenekler:" #: tfrmoptionsarchivers.bvlarchiverparsingmode.caption msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption" msgid "Format parsing mode:" msgstr "Format ayrıştırma modu:" #: tfrmoptionsarchivers.chkarchiverenabled.caption msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption" msgid "E&nabled" msgstr "" #: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption msgid "De&bug mode" msgstr "" #: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption" msgid "S&how console output" msgstr "" #: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption msgid "Uni&x file attributes" msgstr "" #: tfrmoptionsarchivers.ckbarchiverunixpath.caption msgid "&Unix path delimiter \"/\"" msgstr "" #: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption msgid "Windows &file attributes" msgstr "" #: tfrmoptionsarchivers.ckbarchiverwindowspath.caption msgid "Windows path deli&miter \"\\\"" msgstr "" #: tfrmoptionsarchivers.lblarchiveradd.caption msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption" msgid "Add&ing:" msgstr "" #: tfrmoptionsarchivers.lblarchiverarchiver.caption msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption" msgid "Arc&hiver:" msgstr "" #: tfrmoptionsarchivers.lblarchiverdelete.caption msgid "De&lete:" msgstr "Sil:" #: tfrmoptionsarchivers.lblarchiverdescription.caption msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption" msgid "De&scription:" msgstr "" #: tfrmoptionsarchivers.lblarchiverextension.caption msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption" msgid "E&xtension:" msgstr "" #: tfrmoptionsarchivers.lblarchiverextract.caption msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption" msgid "Ex&tract:" msgstr "" #: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption msgid "Extract &without path:" msgstr "Yol olmadan Çıkart:" #: tfrmoptionsarchivers.lblarchiveridposition.caption msgid "ID Po&sition:" msgstr "(ID)Kimlik konumu" #: tfrmoptionsarchivers.lblarchiverids.caption msgid "&ID:" msgstr "KİMLİK(ID):" #: tfrmoptionsarchivers.lblarchiveridseekrange.caption msgid "ID See&k Range:" msgstr "ID Kimlik arama aralığı (isteğe bağlı)" #: tfrmoptionsarchivers.lblarchiverlist.caption msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption" msgid "&List:" msgstr "" #: tfrmoptionsarchivers.lblarchiverlistbox.caption msgid "Archi&vers:" msgstr "Sıkıştır:" #: tfrmoptionsarchivers.lblarchiverlistend.caption msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption" msgid "Listing &finish (optional):" msgstr "" #: tfrmoptionsarchivers.lblarchiverlistformat.caption msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption" msgid "Listing for&mat:" msgstr "" #: tfrmoptionsarchivers.lblarchiverliststart.caption msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption" msgid "Listin&g start (optional):" msgstr "" #: tfrmoptionsarchivers.lblarchiverpasswordquery.caption msgid "Password &query string:" msgstr "Şifre sorgu dizgisi:" #: tfrmoptionsarchivers.lblarchiverselfextract.caption msgid "Create self extractin&g archive:" msgstr "Kendiliğinden açılan arşiv oluştur(Sfx):" #: tfrmoptionsarchivers.lblarchivertest.caption msgid "Tes&t:" msgstr "Deneme:" #: tfrmoptionsarchivers.miarchiverautoconfigure.caption msgid "Auto Configure" msgstr "" #: tfrmoptionsarchivers.miarchiverdisableall.caption msgid "Disable all" msgstr "" #: tfrmoptionsarchivers.miarchiverdiscardmodification.caption msgid "Discard modifications" msgstr "" #: tfrmoptionsarchivers.miarchiverenableall.caption msgid "Enable all" msgstr "" #: tfrmoptionsarchivers.miarchiverexport.caption msgctxt "tfrmoptionsarchivers.miarchiverexport.caption" msgid "Export..." msgstr "" #: tfrmoptionsarchivers.miarchiverimport.caption msgctxt "tfrmoptionsarchivers.miarchiverimport.caption" msgid "Import..." msgstr "" #: tfrmoptionsarchivers.miarchiversortarchivers.caption msgid "Sort archivers" msgstr "" #: tfrmoptionsarchivers.tbarchiveradditional.caption msgctxt "tfrmoptionsarchivers.tbarchiveradditional.caption" msgid "Additional" msgstr "Ek" #: tfrmoptionsarchivers.tbarchivergeneral.caption msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption" msgid "General" msgstr "Genel" #: tfrmoptionsautorefresh.cbwatchattributeschange.caption msgctxt "tfrmoptionsautorefresh.cbwatchattributeschange.caption" msgid "When &size, date or attributes change" msgstr "Gerektiğinde &Boyut,Tarih veya özniteliklerini değiştir" #: tfrmoptionsautorefresh.cbwatchexcludedirs.caption msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption" msgid "For the following &paths and their subdirectories:" msgstr "Aşağıdaki &yolları ve alt dizinleri için:" #: tfrmoptionsautorefresh.cbwatchfilenamechange.caption msgid "When &files are created, deleted or renamed" msgstr "" #: tfrmoptionsautorefresh.cbwatchonlyforeground.caption msgctxt "tfrmoptionsautorefresh.cbwatchonlyforeground.caption" msgid "When application is in the &background" msgstr "Güncellemeleri arka planda yap" #: tfrmoptionsautorefresh.gbautorefreshdisable.caption msgctxt "tfrmoptionsautorefresh.gbautorefreshdisable.caption" msgid "Disable auto-refresh" msgstr "Otomatik yenilemeyi devre dışı bırak" #: tfrmoptionsautorefresh.gbautorefreshenable.caption msgctxt "tfrmoptionsautorefresh.gbautorefreshenable.caption" msgid "Refresh file list" msgstr "Dosya listesini yenile" #: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption msgid "Al&ways show tray icon" msgstr "" #: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption msgid "Automatically &hide unmounted devices" msgstr "" #: tfrmoptionsbehavior.cbminimizetotray.caption msgctxt "tfrmoptionsbehavior.cbminimizetotray.caption" msgid "Mo&ve icon to system tray when minimized" msgstr "Küçültüldüğünde simgeyi sistem tepsisine taşı" #: tfrmoptionsbehavior.cbonlyonce.caption msgid "A&llow only one copy of DC at a time" msgstr "" #: tfrmoptionsbehavior.edtdrivesblacklist.hint msgid "Here you can enter one or more drives or mount points, separated by \";\"." msgstr "" #: tfrmoptionsbehavior.lbldrivesblacklist.caption msgid "Drives &blacklist" msgstr "" #: tfrmoptionsbriefview.gbcolumns.caption msgid "Columns size" msgstr "" #: tfrmoptionsbriefview.gbshowfileext.caption msgid "Show file extensions" msgstr "" #: tfrmoptionsbriefview.rbaligned.caption msgid "ali&gned (with Tab)" msgstr "" #: tfrmoptionsbriefview.rbdirectly.caption msgid "di&rectly after filename" msgstr "" #: tfrmoptionsbriefview.rbuseautosize.caption msgid "Auto" msgstr "" #: tfrmoptionsbriefview.rbusefixedcount.caption msgid "Fixed columns count" msgstr "" #: tfrmoptionsbriefview.rbusefixedwidth.caption msgid "Fixed columns width" msgstr "" #: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption msgid "Cut &text to column width" msgstr "" #: tfrmoptionscolumnsview.cbextendcellwidth.caption msgid "&Extend cell width if text is not fitting into column" msgstr "" #: tfrmoptionscolumnsview.cbgridhorzline.caption msgid "&Horizontal lines" msgstr "" #: tfrmoptionscolumnsview.cbgridvertline.caption msgid "&Vertical lines" msgstr "" #: tfrmoptionscolumnsview.chkautofillcolumns.caption msgid "A&uto fill columns" msgstr "" #: tfrmoptionscolumnsview.gbshowgrid.caption msgid "Show grid" msgstr "" #: tfrmoptionscolumnsview.grpautosizecolumns.caption msgid "Auto-size columns" msgstr "" #: tfrmoptionscolumnsview.lblautosizecolumn.caption msgid "Auto si&ze column:" msgstr "" #: tfrmoptionsconfiguration.btnconfigapply.caption msgctxt "tfrmoptionsconfiguration.btnconfigapply.caption" msgid "A&pply" msgstr "Uygula" #: tfrmoptionsconfiguration.btnconfigedit.caption msgctxt "tfrmoptionsconfiguration.btnconfigedit.caption" msgid "&Edit" msgstr "&Düzenle" #: tfrmoptionsconfiguration.cbcmdlinehistory.caption msgid "Co&mmand line history" msgstr "" #: tfrmoptionsconfiguration.cbdirhistory.caption msgid "&Directory history" msgstr "" #: tfrmoptionsconfiguration.cbfilemaskhistory.caption msgid "&File mask history" msgstr "" #: tfrmoptionsconfiguration.chksaveconfiguration.caption msgid "Sa&ve configuration" msgstr "" #: tfrmoptionsconfiguration.chksearchreplacehistory.caption msgid "Searc&h/Replace history" msgstr "" #: tfrmoptionsconfiguration.gbdirectories.caption msgctxt "tfrmoptionsconfiguration.gbdirectories.caption" msgid "Directories" msgstr "" #: tfrmoptionsconfiguration.gblocconfigfiles.caption msgctxt "tfrmoptionsconfiguration.gblocconfigfiles.caption" msgid "Location of configuration files" msgstr "Yapılandırma dosyasının konumu" #: tfrmoptionsconfiguration.gbsaveonexit.caption msgctxt "tfrmoptionsconfiguration.gbsaveonexit.caption" msgid "Save on exit" msgstr "Çıkışta Kaydet" #: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption msgid "Sort order of configuration order in left tree" msgstr "" #: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption msgctxt "tfrmoptionsconfiguration.lblcmdlineconfigdir.caption" msgid "Set on command line" msgstr "Komut satırında ayarla" #: tfrmoptionsconfiguration.lblhighlighters.caption msgid "Highlighters:" msgstr "" #: tfrmoptionsconfiguration.lbliconthemes.caption msgid "Icon themes:" msgstr "" #: tfrmoptionsconfiguration.lblthumbcache.caption msgid "Thumbnails cache:" msgstr "" #: tfrmoptionsconfiguration.rbprogramdir.caption msgid "P&rogram directory (portable version)" msgstr "" #: tfrmoptionsconfiguration.rbuserhomedir.caption msgid "&User home directory" msgstr "" #: tfrmoptionscustomcolumns.btnallallowovercolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallallowovercolor.hint msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallbackcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallbackcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallbackcolor2.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallbackcolor2.hint msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallcursorcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallcursorcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallcursortext.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallcursortext.hint msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallfont.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallfont.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallfont.hint msgctxt "tfrmoptionscustomcolumns.btnallfont.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallforecolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallforecolor.hint msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnallmarkcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnallmarkcolor.hint msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption" msgid "All" msgstr "Tüm" #: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint" msgid "Apply modification to all columns" msgstr "" #: tfrmoptionscustomcolumns.btnbackcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnbackcolor2.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursorbordercolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursorcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btncursortext.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btncursortext.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption" msgid "&Delete" msgstr "&Sil" #: tfrmoptionscustomcolumns.btnfont.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnfont.caption" msgid "..." msgstr "..." #: tfrmoptionscustomcolumns.btnforecolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btngotosetdefault.caption msgid "Go to set default" msgstr "" #: tfrmoptionscustomcolumns.btngotosetdefault.hint msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btninactivecursorcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btninactivemarkcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnmarkcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionscustomcolumns.btnnewconfig.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption" msgid "New" msgstr "Yeni" #: tfrmoptionscustomcolumns.btnnext.caption msgid "Next" msgstr "" #: tfrmoptionscustomcolumns.btnprev.caption msgid "Previous" msgstr "" #: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption" msgid "Rename" msgstr "Yeniden Adlandır" #: tfrmoptionscustomcolumns.btnresetallowovercolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetallowovercolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetbackcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetbackcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetbackcolor2.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetbackcolor2.hint msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursorborder.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursorborder.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursorcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursorcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetcursortext.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetcursortext.hint msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetfont.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetfont.hint msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetforecolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetforecolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetframecursor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetframecursor.hint msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetmarkcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetmarkcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption" msgid "R" msgstr "R" #: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint" msgid "Reset to default" msgstr "" #: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption" msgid "Save as" msgstr "Farklı Kaydet..." #: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption" msgid "Save" msgstr "Kaydet" #: tfrmoptionscustomcolumns.cballowovercolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption" msgid "Allow Overcolor" msgstr "Fazla renge izin ver" #: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption msgid "When clicking to change something, change for all columns" msgstr "" #: tfrmoptionscustomcolumns.cbconfigcolumns.text #, fuzzy msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text" msgid "General" msgstr "Genel" #: tfrmoptionscustomcolumns.cbcursorborder.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption" msgid "Cursor border" msgstr "Gösterge sınırı" #: tfrmoptionscustomcolumns.cbuseframecursor.caption msgid "Use Frame Cursor" msgstr "" #: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption msgid "Use Inactive Selection Color" msgstr "" #: tfrmoptionscustomcolumns.cbuseinvertedselection.caption msgid "Use Inverted Selection" msgstr "" #: tfrmoptionscustomcolumns.chkusecustomview.caption msgid "Use custom font and color for this view" msgstr "" #: tfrmoptionscustomcolumns.lblbackcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption" msgid "BackGround:" msgstr "Arka plan:" #: tfrmoptionscustomcolumns.lblbackcolor2.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption" msgid "Background 2:" msgstr "Arka plan 2:" #: tfrmoptionscustomcolumns.lblconfigcolumns.caption msgid "Con&figure columns view:" msgstr "" #: tfrmoptionscustomcolumns.lblcurrentcolumn.caption msgid "[Current Column Name]" msgstr "" #: tfrmoptionscustomcolumns.lblcursorcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption" msgid "Cursor Color:" msgstr "Gösterge rengi:" #: tfrmoptionscustomcolumns.lblcursortext.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption" msgid "Cursor Text:" msgstr "Metin İmleci:" #: tfrmoptionscustomcolumns.lblfontname.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.lblfontname.caption" msgid "Font:" msgstr "Yazı karakteri:" #: tfrmoptionscustomcolumns.lblfontsize.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption" msgid "Size:" msgstr "Boyut:" #: tfrmoptionscustomcolumns.lblforecolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption" msgid "Text Color:" msgstr "Metin rengi" #: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption" msgid "Inactive Cursor Color:" msgstr "" #: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption" msgid "Inactive Mark Color:" msgstr "" #: tfrmoptionscustomcolumns.lblmarkcolor.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption" msgid "Mark Color:" msgstr "İşaret rengi:" #: tfrmoptionscustomcolumns.lblpreviewtop.caption msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "" #: tfrmoptionscustomcolumns.lblworkingcolumn.caption msgid "Settings for column:" msgstr "" #: tfrmoptionscustomcolumns.miaddcolumn.caption #, fuzzy msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption" msgid "Add column" msgstr "Sütun Ekle" #: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption msgid "Position of frame panel after the comparison:" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption msgid "Add directory of the &active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption msgid "Add &directories of the active && inactive frames" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption msgid "Add directory I will bro&wse to" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption" msgid "Add a copy of the selected entry" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption msgid "Add current &selected or active directories of active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddseparator.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption" msgid "Add a separator" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption msgid "Add a sub menu" msgstr "" #: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption" msgid "Add directory I will type" msgstr "" #: tfrmoptionsdirectoryhotlist.actcollapseall.caption msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption" msgid "Collapse all" msgstr "" #: tfrmoptionsdirectoryhotlist.actcollapseitem.caption msgid "Collapse item" msgstr "" #: tfrmoptionsdirectoryhotlist.actcut.caption msgid "Cut selection of entries" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeleteall.caption msgid "Delete all!" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption" msgid "Delete selected item" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption msgid "Delete sub-menu and all its elements" msgstr "" #: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption msgid "Delete just sub-menu but keep elements" msgstr "" #: tfrmoptionsdirectoryhotlist.actexpanditem.caption msgid "Expand item" msgstr "" #: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption msgid "Focus tree window" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption msgid "Goto first item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotolastitem.caption msgid "Goto last item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotonextitem.caption msgid "Go to next item" msgstr "" #: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption msgid "Go to previous item" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption msgid "Insert directory of the &active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption msgid "Insert &directories of the active && inactive frames" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption msgid "Insert directory I will bro&wse to" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption msgid "Insert a copy of the selected entry" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption msgid "Insert current &selected or active directories of active frame" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertseparator.caption msgid "Insert a separator" msgstr "" #: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption msgid "Insert sub menu" msgstr "" #: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption" msgid "Insert directory I will type" msgstr "" #: tfrmoptionsdirectoryhotlist.actmovetonext.caption msgid "Move to next" msgstr "" #: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption msgid "Move to previous" msgstr "" #: tfrmoptionsdirectoryhotlist.actopenallbranches.caption msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption" msgid "Open all branches" msgstr "" #: tfrmoptionsdirectoryhotlist.actpaste.caption msgid "Paste what was cut" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption msgid "Search && replace in &path" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption msgid "Search && replace in both path and target" msgstr "" #: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption msgid "Search && replace in &target path" msgstr "" #: tfrmoptionsdirectoryhotlist.acttweakpath.caption msgid "Tweak path" msgstr "" #: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption msgid "Tweak target path" msgstr "" #: tfrmoptionsdirectoryhotlist.btnadd.caption msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption" msgid "A&dd..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnbackup.caption msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption" msgid "Bac&kup..." msgstr "" #: tfrmoptionsdirectoryhotlist.btndelete.caption msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption" msgid "De&lete..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnexport.caption msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption" msgid "E&xport..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnhelp.caption msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption" msgid "&Help" msgstr "&Yardım" #: tfrmoptionsdirectoryhotlist.btnimport.caption msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption" msgid "Impo&rt..." msgstr "" #: tfrmoptionsdirectoryhotlist.btninsert.caption msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption" msgid "&Insert..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption msgid "&Miscellaneous..." msgstr "" #: tfrmoptionsdirectoryhotlist.btnrelativepath.hint msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint" msgid "Some functions to select appropriate target" msgstr "" #: tfrmoptionsdirectoryhotlist.btnsort.caption msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption" msgid "&Sort..." msgstr "" #: tfrmoptionsdirectoryhotlist.cbaddtarget.caption msgid "&When adding directory, add also target" msgstr "" #: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption" msgid "Alwa&ys expand tree" msgstr "" #: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption msgid "Show only &valid environment variables" msgstr "" #: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption msgid "In pop&up, show [path also]" msgstr "" #: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text" msgid "Name, a-z" msgstr "" #: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text" msgid "Name, a-z" msgstr "" #: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption msgid "Directory Hotlist (reorder by drag && drop)" msgstr "" #: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption" msgid "Other options" msgstr "" #: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption" msgid "Name:" msgstr "İsim:" #: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption" msgid "Path:" msgstr "Yol:" #: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption" msgid "&Target:" msgstr "" #: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption" msgid "...current le&vel of item(s) selected only" msgstr "" #: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption" msgid "Scan all &hotdir's path to validate the ones that actually exist" msgstr "" #: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption" msgid "&Scan all hotdir's path && target to validate the ones that actually exist" msgstr "" #: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption msgid "to a Directory &Hotlist file (.hotlist)" msgstr "" #: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption" msgid "to a \"wincmd.ini\" of TC (&keep existing)" msgstr "" #: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption" msgid "to a \"wincmd.ini\" of TC (&erase existing)" msgstr "" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption" msgid "Go to &configure TC related info" msgstr "" #: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption" msgid "Go to &configure TC related info" msgstr "" #: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption msgid "HotDirTestMenu" msgstr "" #: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption msgid "from a Directory &Hotlist file (.hotlist)" msgstr "" #: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption msgid "from \"&wincmd.ini\" of TC" msgstr "" #: tfrmoptionsdirectoryhotlist.minavigate.caption msgid "&Navigate..." msgstr "" #: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption msgid "&Restore a backup of Directory Hotlist" msgstr "" #: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption msgid "&Save a backup of current Directory Hotlist" msgstr "" #: tfrmoptionsdirectoryhotlist.misearchandreplace.caption msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption" msgid "Search and &replace..." msgstr "" #: tfrmoptionsdirectoryhotlist.misorteverything.caption msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption" msgid "...everything, from A to &Z!" msgstr "" #: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption" msgid "...single &group of item(s) only" msgstr "" #: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption" msgid "...&content of submenu(s) selected, no sublevel" msgstr "" #: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption" msgid "...content of submenu(s) selected and &all sublevels" msgstr "" #: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption" msgid "Test resultin&g menu" msgstr "" #: tfrmoptionsdirectoryhotlist.mitweakpath.caption msgid "Tweak &path" msgstr "" #: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption msgid "Tweak &target path" msgstr "" #: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption msgid "Addition from main panel" msgstr "" #: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption msgid "From all the supported formats, ask which one to use every time" msgstr "" #: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)" msgstr "" #: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption msgid "When dropping text, generate filename automatically (otherwise will prompt the user)" msgstr "" #: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption msgid "&Show confirmation dialog after drop" msgstr "" #: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption msgid "When drag && dropping text into panels:" msgstr "" #: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption msgid "Place the most desired format on top of list (use dag && drop):" msgstr "" #: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption msgid "(if the most desired is not present, we'll take second one and so on)" msgstr "" #: tfrmoptionsdragdrop.lblwarningforaskformat.caption msgid "(will not work with some source application, so try to uncheck if problem)" msgstr "" #: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption msgid "Show &file system" msgstr "" #: tfrmoptionsdriveslistbutton.cbshowfreespace.caption msgid "Show fr&ee space" msgstr "" #: tfrmoptionsdriveslistbutton.cbshowlabel.caption msgid "Show &label" msgstr "" #: tfrmoptionsdriveslistbutton.gbdriveslist.caption msgid "Drives list" msgstr "" #: tfrmoptionseditor.chkautoindent.caption msgid "Auto Indent" msgstr "" #: tfrmoptionseditor.chkautoindent.hint msgid "Allows to indent the caret, when new line is created with , with the same amount of leading white space as the preceding line" msgstr "" #: tfrmoptionseditor.chkscrollpastendline.caption msgid "Caret past end of line" msgstr "" #: tfrmoptionseditor.chkscrollpastendline.hint msgid "Allows caret to go into empty space beyond end-of-line position" msgstr "" #: tfrmoptionseditor.chkshowspecialchars.caption msgid "Show special characters" msgstr "" #: tfrmoptionseditor.chkshowspecialchars.hint msgid "Shows special characters for spaces and tabulations" msgstr "" #: tfrmoptionseditor.chktabindent.caption msgid "Tab indents blocks" msgstr "" #: tfrmoptionseditor.chktabindent.hint msgid "When active and act as block indent, unindent when text is selected" msgstr "" #: tfrmoptionseditor.chktabstospaces.caption msgid "Use spaces instead tab characters" msgstr "" #: tfrmoptionseditor.chktabstospaces.hint msgid "Converts tab characters to a specified number of space characters (when entering)" msgstr "" #: tfrmoptionseditor.chktrimtrailingspaces.caption msgid "Delete trailing spaces" msgstr "" #: tfrmoptionseditor.chktrimtrailingspaces.hint msgid "Auto delete trailing spaces, this applies only to edited lines" msgstr "" #: tfrmoptionseditor.gbinternaleditor.caption msgid "Internal editor options" msgstr "" #: tfrmoptionseditorcolors.backgroundlabel.caption msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption" msgid "Bac&kground" msgstr "" #: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption" msgid "Bac&kground" msgstr "" #: tfrmoptionseditorcolors.btnresetmask.hint msgid "Reset" msgstr "" #: tfrmoptionseditorcolors.btnsavemask.hint msgctxt "tfrmoptionseditorcolors.btnsavemask.hint" msgid "Save" msgstr "Kaydet" #: tfrmoptionseditorcolors.bvlattributesection.caption msgid "Element Attributes" msgstr "" #: tfrmoptionseditorcolors.foregroundlabel.caption msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption" msgid "Fo®round" msgstr "" #: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption" msgid "Fo®round" msgstr "" #: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption msgid "&Text-mark" msgstr "" #: tfrmoptionseditorcolors.tbtnglobal.caption msgid "Use (and edit) &global scheme settings" msgstr "" #: tfrmoptionseditorcolors.tbtnlocal.caption msgid "Use &local scheme settings" msgstr "" #: tfrmoptionseditorcolors.textboldcheckbox.caption msgctxt "tfrmoptionseditorcolors.textboldcheckbox.caption" msgid "&Bold" msgstr "&Kalın" #: tfrmoptionseditorcolors.textboldradioinvert.caption msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption" msgid "In&vert" msgstr "" #: tfrmoptionseditorcolors.textboldradiooff.caption msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption" msgid "O&ff" msgstr "" #: tfrmoptionseditorcolors.textboldradioon.caption msgctxt "tfrmoptionseditorcolors.textboldradioon.caption" msgid "O&n" msgstr "" #: tfrmoptionseditorcolors.textitaliccheckbox.caption msgctxt "tfrmoptionseditorcolors.textitaliccheckbox.caption" msgid "&Italic" msgstr "&Yatık" #: tfrmoptionseditorcolors.textitalicradioinvert.caption msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption" msgid "In&vert" msgstr "" #: tfrmoptionseditorcolors.textitalicradiooff.caption msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption" msgid "O&ff" msgstr "" #: tfrmoptionseditorcolors.textitalicradioon.caption msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption" msgid "O&n" msgstr "" #: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption msgid "&Strike Out" msgstr "" #: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption" msgid "In&vert" msgstr "" #: tfrmoptionseditorcolors.textstrikeoutradiooff.caption msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption" msgid "O&ff" msgstr "" #: tfrmoptionseditorcolors.textstrikeoutradioon.caption msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption" msgid "O&n" msgstr "" #: tfrmoptionseditorcolors.textunderlinecheckbox.caption msgctxt "tfrmoptionseditorcolors.textunderlinecheckbox.caption" msgid "&Underline" msgstr "&Alt çizgi" #: tfrmoptionseditorcolors.textunderlineradioinvert.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption" msgid "In&vert" msgstr "" #: tfrmoptionseditorcolors.textunderlineradiooff.caption msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption" msgid "O&ff" msgstr "" #: tfrmoptionseditorcolors.textunderlineradioon.caption msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption" msgid "O&n" msgstr "" #: tfrmoptionsfavoritetabs.btnadd.caption msgctxt "tfrmoptionsfavoritetabs.btnadd.caption" msgid "Add..." msgstr "" #: tfrmoptionsfavoritetabs.btndelete.caption msgctxt "tfrmoptionsfavoritetabs.btndelete.caption" msgid "Delete..." msgstr "" #: tfrmoptionsfavoritetabs.btnimportexport.caption msgid "Import/Export" msgstr "" #: tfrmoptionsfavoritetabs.btninsert.caption msgctxt "tfrmoptionsfavoritetabs.btninsert.caption" msgid "Insert..." msgstr "" #: tfrmoptionsfavoritetabs.btnrename.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.btnrename.caption" msgid "Rename" msgstr "Yeniden Adlandır" #: tfrmoptionsfavoritetabs.btnsort.caption msgctxt "tfrmoptionsfavoritetabs.btnsort.caption" msgid "Sort..." msgstr "" #: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text" msgid "None" msgstr "" #: tfrmoptionsfavoritetabs.cbfullexpandtree.caption msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption" msgid "Always expand tree" msgstr "" #: tfrmoptionsfavoritetabs.cbsavedirhistory.text #, fuzzy msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text" msgid "No" msgstr "Hayır" #: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text" msgid "Left" msgstr "" #: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text" msgid "Right" msgstr "" #: tfrmoptionsfavoritetabs.gbfavoritetabs.caption msgid "Favorite Tabs list (reorder by drag && drop)" msgstr "" #: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption" msgid "Other options" msgstr "" #: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption msgid "What to restore where for the selected entry:" msgstr "" #: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption msgid "Existing tabs to keep:" msgstr "" #: tfrmoptionsfavoritetabs.lblsavedirhistory.caption msgid "Save dir history:" msgstr "" #: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption msgid "Tabs saved on left to be restored to:" msgstr "" #: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption msgid "Tabs saved on right to be restored to:" msgstr "" #: tfrmoptionsfavoritetabs.menuitem1.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.menuitem2.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miaddseparator.caption msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption" msgid "a separator" msgstr "" #: tfrmoptionsfavoritetabs.miaddseparator2.caption msgid "Add separator" msgstr "" #: tfrmoptionsfavoritetabs.miaddsubmenu.caption msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption" msgid "sub-menu" msgstr "" #: tfrmoptionsfavoritetabs.miaddsubmenu2.caption msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption" msgid "Add sub-menu" msgstr "" #: tfrmoptionsfavoritetabs.micollapseall.caption msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption" msgid "Collapse all" msgstr "" #: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption" msgid "...current level of item(s) selected only" msgstr "" #: tfrmoptionsfavoritetabs.micutselection.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.micutselection.caption" msgid "Cut" msgstr "Kes" #: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption" msgid "delete all!" msgstr "" #: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption" msgid "sub-menu and all its elements" msgstr "" #: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption" msgid "just sub-menu but keep elements" msgstr "" #: tfrmoptionsfavoritetabs.mideleteselectedentry.caption msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption" msgid "selected item" msgstr "" #: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption" msgid "Delete selected item" msgstr "" #: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption msgid "Export selection to legacy .tab file(s)" msgstr "" #: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption msgid "FavoriteTabsTestMenu" msgstr "" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption msgid "Import legacy .tab file(s) according to default setting" msgstr "" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption" msgid "Import legacy .tab file(s) at selected position" msgstr "" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption" msgid "Import legacy .tab file(s) at selected position" msgstr "" #: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption msgid "Import legacy .tab file(s) at selected position in a sub menu" msgstr "" #: tfrmoptionsfavoritetabs.miinsertseparator.caption msgid "Insert separator" msgstr "" #: tfrmoptionsfavoritetabs.miinsertsubmenu.caption msgid "Insert sub-menu" msgstr "" #: tfrmoptionsfavoritetabs.miopenallbranches.caption msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption" msgid "Open all branches" msgstr "" #: tfrmoptionsfavoritetabs.mipasteselection.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption" msgid "Paste" msgstr "Yapıştır" #: tfrmoptionsfavoritetabs.mirename.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.mirename.caption" msgid "Rename" msgstr "Yeniden Adlandır" #: tfrmoptionsfavoritetabs.miseparator1.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator10.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator11.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator2.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator3.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator7.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator8.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.miseparator9.caption #, fuzzy msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption" msgid "-" msgstr "-" #: tfrmoptionsfavoritetabs.misorteverything.caption msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption" msgid "...everything, from A to Z!" msgstr "" #: tfrmoptionsfavoritetabs.misortsinglegroup.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption" msgid "...single group of item(s) only" msgstr "" #: tfrmoptionsfavoritetabs.misortsinglegroup2.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption" msgid "Sort single group of item(s) only" msgstr "" #: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption" msgid "...content of submenu(s) selected, no sublevel" msgstr "" #: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption" msgid "...content of submenu(s) selected and all sublevels" msgstr "" #: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption" msgid "Test resulting menu" msgstr "" #: tfrmoptionsfileassoc.btnaddact.caption msgctxt "tfrmoptionsfileassoc.btnaddact.caption" msgid "Add" msgstr "Ekle" #: tfrmoptionsfileassoc.btnaddext.caption msgctxt "tfrmoptionsfileassoc.btnaddext.caption" msgid "&Add" msgstr "&Ekle" #: tfrmoptionsfileassoc.btnaddnewtype.caption msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption" msgid "A&dd" msgstr "Ekle" #: tfrmoptionsfileassoc.btncloneact.caption msgid "Clone" msgstr "" #: tfrmoptionsfileassoc.btndownact.caption #, fuzzy #| msgid "Down" msgctxt "tfrmoptionsfileassoc.btndownact.caption" msgid "&Down" msgstr "Aşağı" #: tfrmoptionsfileassoc.btneditext.caption #, fuzzy msgctxt "tfrmoptionsfileassoc.btneditext.caption" msgid "Edit" msgstr "Düzenle" #: tfrmoptionsfileassoc.btninsertact.caption msgctxt "tfrmoptionsfileassoc.btninsertact.caption" msgid "Insert" msgstr "" #: tfrmoptionsfileassoc.btninsertext.caption msgctxt "tfrmoptionsfileassoc.btninsertext.caption" msgid "Insert" msgstr "" #: tfrmoptionsfileassoc.btnremoveact.caption #, fuzzy #| msgid "Remove" msgctxt "tfrmoptionsfileassoc.btnremoveact.caption" msgid "Remo&ve" msgstr "Kaldır" #: tfrmoptionsfileassoc.btnremoveext.caption #, fuzzy #| msgid "Remove" msgctxt "tfrmoptionsfileassoc.btnremoveext.caption" msgid "Re&move" msgstr "Kaldır" #: tfrmoptionsfileassoc.btnremovetype.caption #, fuzzy #| msgid "Remove" msgctxt "tfrmoptionsfileassoc.btnremovetype.caption" msgid "&Remove" msgstr "Kaldır" #: tfrmoptionsfileassoc.btnrenametype.caption #, fuzzy #| msgid "Rename" msgctxt "tfrmoptionsfileassoc.btnrenametype.caption" msgid "R&ename" msgstr "Yeniden Adlandır" #: tfrmoptionsfileassoc.btnupact.caption #, fuzzy #| msgid "Up" msgctxt "tfrmoptionsfileassoc.btnupact.caption" msgid "&Up" msgstr "Yukarı" #: tfrmoptionsfileassoc.destartpath.hint msgid "Starting path of the command. Never quote this string." msgstr "" #: tfrmoptionsfileassoc.edbactionname.hint msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you" msgstr "" #: tfrmoptionsfileassoc.edtparams.hint msgid "Parameter to pass to the command. Long filename with spaces should be quoted." msgstr "" #: tfrmoptionsfileassoc.fnecommand.hint msgid "Command to execute. Long filename with space should be quoted." msgstr "" #: tfrmoptionsfileassoc.gbactiondescription.caption msgid "Action description:" msgstr "" #: tfrmoptionsfileassoc.gbactions.caption msgctxt "tfrmoptionsfileassoc.gbactions.caption" msgid "Actions" msgstr "Eylemler" #: tfrmoptionsfileassoc.gbexts.caption msgctxt "tfrmoptionsfileassoc.gbexts.caption" msgid "Extensions" msgstr "Uzantıları" #: tfrmoptionsfileassoc.gbexts.hint msgid "Can be sorted by drag & drop" msgstr "" #: tfrmoptionsfileassoc.gbfiletypes.caption msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption" msgid "File types" msgstr "Dosya türü" #: tfrmoptionsfileassoc.gbicon.caption msgctxt "tfrmoptionsfileassoc.gbicon.caption" msgid "Icon" msgstr "Simge" #: tfrmoptionsfileassoc.lbactions.hint msgid "Actions may be sorted by drag & drop" msgstr "" #: tfrmoptionsfileassoc.lbexts.hint msgid "Extensions may be sorted by drag & drop" msgstr "" #: tfrmoptionsfileassoc.lbfiletypes.hint msgid "File types may be sorted by drag & drop" msgstr "" #: tfrmoptionsfileassoc.lblaction.caption #, fuzzy #| msgid "Action:" msgctxt "tfrmoptionsfileassoc.lblaction.caption" msgid "Action name:" msgstr "Eylem:" #: tfrmoptionsfileassoc.lblcommand.caption msgctxt "tfrmoptionsfileassoc.lblcommand.caption" msgid "&Command:" msgstr "&Komut" #: tfrmoptionsfileassoc.lblexternalparameters.caption msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption" msgid "Parameter&s:" msgstr "Değişkenler:" #: tfrmoptionsfileassoc.lblstartpath.caption msgctxt "tfrmoptionsfileassoc.lblstartpath.caption" msgid "Start pat&h:" msgstr "" #: tfrmoptionsfileassoc.menuitem1.caption #, fuzzy msgctxt "tfrmoptionsfileassoc.menuitem1.caption" msgid "-" msgstr "-" #: tfrmoptionsfileassoc.menuitem3.caption msgid "Custom with..." msgstr "" #: tfrmoptionsfileassoc.micustom.caption msgid "Custom" msgstr "" #: tfrmoptionsfileassoc.miedit.caption msgctxt "tfrmoptionsfileassoc.miedit.caption" msgid "Edit" msgstr "Düzenle" #: tfrmoptionsfileassoc.mieditor.caption msgctxt "tfrmoptionsfileassoc.mieditor.caption" msgid "Open in Editor" msgstr "Düzenleyici´de aç" #: tfrmoptionsfileassoc.mieditwith.caption msgid "Edit with..." msgstr "" #: tfrmoptionsfileassoc.migetoutputfromcommand.caption msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption" msgid "Get output from command" msgstr "Çıkış komutu Alın" #: tfrmoptionsfileassoc.miinternaleditor.caption msgid "Open in Internal Editor" msgstr "" #: tfrmoptionsfileassoc.miinternalviewer.caption msgid "Open in Internal Viewer" msgstr "" #: tfrmoptionsfileassoc.miopen.caption msgctxt "tfrmoptionsfileassoc.miopen.caption" msgid "Open" msgstr "Açık" #: tfrmoptionsfileassoc.miopenwith.caption msgid "Open with..." msgstr "" #: tfrmoptionsfileassoc.miseparator.caption #, fuzzy msgctxt "tfrmoptionsfileassoc.miseparator.caption" msgid "-" msgstr "-" #: tfrmoptionsfileassoc.mishell.caption msgctxt "tfrmoptionsfileassoc.mishell.caption" msgid "Run in terminal" msgstr "Konsol penceresinde çalıştırın" #: tfrmoptionsfileassoc.miview.caption #, fuzzy #| msgid "View F3" msgctxt "tfrmoptionsfileassoc.miview.caption" msgid "View" msgstr "Göster F3" #: tfrmoptionsfileassoc.miviewer.caption msgctxt "tfrmoptionsfileassoc.miviewer.caption" msgid "Open in Viewer" msgstr "Görüntüleyicide açık" #: tfrmoptionsfileassoc.miviewwith.caption msgid "View with..." msgstr "" #: tfrmoptionsfileassoc.sbtnicon.hint msgid "Click me to change icon!" msgstr "" #: tfrmoptionsfileassocextra.cbexecuteviashell.caption msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption" msgid "Execute via shell" msgstr "" #: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption msgid "Extended context menu" msgstr "" #: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption msgid "File association configuration" msgstr "" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption msgid "Offer to add selection to file association when not included already" msgstr "" #: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint" msgid "When accessing file association, offer to add current selected file if not already included in a configured file type" msgstr "" #: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption" msgid "Execute via terminal and close" msgstr "" #: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption" msgid "Execute via terminal and stay open" msgstr "" #: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption msgid "Extended options items:" msgstr "" #: tfrmoptionsfileoperations.bvlconfirmations.caption msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption" msgid "Show confirmation window for:" msgstr "" #: tfrmoptionsfileoperations.cbcopyconfirmation.caption msgid "Cop&y operation" msgstr "" #: tfrmoptionsfileoperations.cbdeleteconfirmation.caption msgid "&Delete operation" msgstr "" #: tfrmoptionsfileoperations.cbdeletetotrash.caption msgid "Dele&te to recycle bin (Shift key reverses this setting)" msgstr "" #: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption msgid "D&elete to trash operation" msgstr "" #: tfrmoptionsfileoperations.cbdropreadonlyflag.caption msgid "D&rop readonly flag" msgstr "" #: tfrmoptionsfileoperations.cbmoveconfirmation.caption msgid "&Move operation" msgstr "" #: tfrmoptionsfileoperations.cbprocesscomments.caption msgid "&Process comments with files/folders" msgstr "" #: tfrmoptionsfileoperations.cbrenameselonlyname.caption msgid "Select &file name without extension when renaming" msgstr "" #: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption msgid "Sho&w tab select panel in copy/move dialog" msgstr "" #: tfrmoptionsfileoperations.cbskipfileoperror.caption msgid "S&kip file operations errors and write them to log window" msgstr "" #: tfrmoptionsfileoperations.gbexecutingoperations.caption msgid "Executing operations" msgstr "" #: tfrmoptionsfileoperations.gbuserinterface.caption msgid "User interface" msgstr "" #: tfrmoptionsfileoperations.lblbuffersize.caption msgid "&Buffer size for file operations (in KB):" msgstr "" #: tfrmoptionsfileoperations.lblhashbuffersize.caption msgid "Buffer size for &hash calculation (in KB):" msgstr "" #: tfrmoptionsfileoperations.lblprogresskind.caption msgid "Show operations progress &initially in" msgstr "" #: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption" msgid "Duplicated name auto-rename style:" msgstr "" #: tfrmoptionsfileoperations.lblwipepassnumber.caption msgid "&Number of wipe passes:" msgstr "" #: tfrmoptionsfilepanelscolors.btnbackcolor.caption msgctxt "tfrmoptionsfilepanelscolors.btnbackcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnbackcolor2.caption msgctxt "tfrmoptionsfilepanelscolors.btnbackcolor2.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption #, fuzzy msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursorcolor.caption msgctxt "tfrmoptionsfilepanelscolors.btncursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btncursortext.caption msgctxt "tfrmoptionsfilepanelscolors.btncursortext.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnforecolor.caption msgctxt "tfrmoptionsfilepanelscolors.btnforecolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption #, fuzzy msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption #, fuzzy msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnindbackcolor.caption msgctxt "tfrmoptionsfilepanelscolors.btnindbackcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnindcolor.caption msgctxt "tfrmoptionsfilepanelscolors.btnindcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnmarkcolor.caption msgctxt "tfrmoptionsfilepanelscolors.btnmarkcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption msgid "Reset to DC default" msgstr "" #: tfrmoptionsfilepanelscolors.cballowovercolor.caption #, fuzzy msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption" msgid "Allow Overcolor" msgstr "Fazla renge izin ver" #: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption msgid "Use &Frame Cursor" msgstr "" #: tfrmoptionsfilepanelscolors.cbbusegradientind.caption msgid "Use &Gradient Indicator" msgstr "" #: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption msgid "Use Inactive Sel Color" msgstr "" #: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption msgid "U&se Inverted Selection" msgstr "" #: tfrmoptionsfilepanelscolors.cbusecursorborder.caption #, fuzzy msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption" msgid "Cursor border" msgstr "Gösterge sınırı" #: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption msgid "Drive Free Space Indicator" msgstr "" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption msgid "Bac&kground:" msgstr "" #: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption msgid "Backg&round 2:" msgstr "" #: tfrmoptionsfilepanelscolors.lblcursorcolor.caption msgid "C&ursor Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblcursortext.caption msgid "Cursor Te&xt:" msgstr "" #: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption" msgid "Inactive Cursor Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption" msgid "Inactive Mark Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption msgid "&Brightness level of inactive panel" msgstr "" #: tfrmoptionsfilepanelscolors.lblindbackcolor.caption msgid "In&dicator Back Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblindcolor.caption msgid "&Indicator Fore Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblmarkcolor.caption msgid "&Mark Color:" msgstr "" #: tfrmoptionsfilepanelscolors.lblpreview.caption msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings." msgstr "" #: tfrmoptionsfilepanelscolors.lbltextcolor.caption msgid "T&ext Color:" msgstr "" #: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption msgid "When launching file search, clear file mask filter" msgstr "" #: tfrmoptionsfilesearch.cbpartialnamesearch.caption msgid "&Search for part of file name" msgstr "" #: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption msgid "Show menu bar in \"Find files\"" msgstr "" #: tfrmoptionsfilesearch.dbtextsearch.caption msgid "Text search in files" msgstr "" #: tfrmoptionsfilesearch.gbfilesearch.caption #, fuzzy msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption" msgid "File search" msgstr "Dosya ara" #: tfrmoptionsfilesearch.lblnewsearchfilters.caption msgid "Current filters with \"New search\" button:" msgstr "" #: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption msgid "Default search template:" msgstr "" #: tfrmoptionsfilesearch.rbusemmapinsearch.caption msgid "Use memory mapping for search te&xt in files" msgstr "" #: tfrmoptionsfilesearch.rbusestreaminsearch.caption msgid "&Use stream for search text in files" msgstr "" #: tfrmoptionsfilesviews.btnaddattribute.caption #, fuzzy msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption" msgid "&Add" msgstr "&Ekle" #: tfrmoptionsfilesviews.btnattrshelp.caption #, fuzzy msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption" msgid "&Help" msgstr "&Yardım" #: tfrmoptionsfilesviews.cbdblclicktoparent.caption msgid "Enable changing to &parent folder when double-clicking on empty part of file view" msgstr "" #: tfrmoptionsfilesviews.cbdelayloadingtabs.caption msgid "Do&n't load file list until a tab is activated" msgstr "" #: tfrmoptionsfilesviews.cbdirbrackets.caption msgid "S&how square brackets around directories" msgstr "" #: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption msgid "Hi&ghlight new and updated files" msgstr "" #: tfrmoptionsfilesviews.cbinplacerename.caption msgid "Enable inplace &renaming when clicking twice on a name" msgstr "" #: tfrmoptionsfilesviews.cblistfilesinthread.caption msgid "Load &file list in separate thread" msgstr "" #: tfrmoptionsfilesviews.cbloadiconsseparately.caption msgid "Load icons af&ter file list" msgstr "" #: tfrmoptionsfilesviews.cbshowsystemfiles.caption msgid "Show s&ystem and hidden files" msgstr "" #: tfrmoptionsfilesviews.cbspacemovesdown.caption msgid "&When selecting files with , move down to next file (as with )" msgstr "" #: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption" msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)" msgstr "" #: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption" msgid "Use an independent attribute filter in mask input dialog each time" msgstr "" #: tfrmoptionsfilesviews.gbformatting.caption msgid "Formatting" msgstr "" #: tfrmoptionsfilesviews.gbmarking.caption msgid "Marking/Unmarking entries" msgstr "" #: tfrmoptionsfilesviews.gbsorting.caption msgctxt "tfrmoptionsfilesviews.gbsorting.caption" msgid "Sorting" msgstr "Sınıflandır" #: tfrmoptionsfilesviews.lbattributemask.caption msgctxt "tfrmoptionsfilesviews.lbattributemask.caption" msgid "Default attribute mask value to use:" msgstr "" #: tfrmoptionsfilesviews.lblcasesensitivity.caption msgid "Case s&ensitivity:" msgstr "" #: tfrmoptionsfilesviews.lbldatetimeexample.caption msgid "Incorrect format" msgstr "" #: tfrmoptionsfilesviews.lbldatetimeformat.caption msgid "&Date and time format:" msgstr "" #: tfrmoptionsfilesviews.lblfilesizeformat.caption msgid "File si&ze format:" msgstr "" #: tfrmoptionsfilesviews.lblnewfilesposition.caption msgid "&Insert new files:" msgstr "" #: tfrmoptionsfilesviews.lblsortfoldermode.caption msgid "So&rting directories:" msgstr "" #: tfrmoptionsfilesviews.lblsortmethod.caption msgid "&Sort method:" msgstr "" #: tfrmoptionsfilesviews.lblupdatedfilesposition.caption msgid "&Move updated files:" msgstr "" #: tfrmoptionsfiletypescolors.btnaddcategory.caption msgctxt "tfrmoptionsfiletypescolors.btnaddcategory.caption" msgid "A&dd" msgstr "Ekle" #: tfrmoptionsfiletypescolors.btnapplycategory.caption msgctxt "tfrmoptionsfiletypescolors.btnapplycategory.caption" msgid "A&pply" msgstr "Uygula" #: tfrmoptionsfiletypescolors.btncategorycolor.caption msgctxt "tfrmoptionsfiletypescolors.btncategorycolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsfiletypescolors.btndeletecategory.caption msgctxt "tfrmoptionsfiletypescolors.btndeletecategory.caption" msgid "D&elete" msgstr "&Sil" #: tfrmoptionsfiletypescolors.btnsearchtemplate.hint msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint" msgid "Template..." msgstr "Şablon..." #: tfrmoptionsfiletypescolors.gbfiletypescolors.caption msgid "File types colors (sort by drag&&drop)" msgstr "" #: tfrmoptionsfiletypescolors.lblcategoryattr.caption msgid "Category a&ttributes:" msgstr "" #: tfrmoptionsfiletypescolors.lblcategorycolor.caption msgid "Category co&lor:" msgstr "" #: tfrmoptionsfiletypescolors.lblcategorymask.caption msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption" msgid "Category &mask:" msgstr "Sınıf maskesi" #: tfrmoptionsfiletypescolors.lblcategoryname.caption msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption" msgid "Category &name:" msgstr "Sınıf adı" #: tfrmoptionsfonts.btnpatheditfnt.caption #, fuzzy msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnsearchresultsfnt.caption #, fuzzy msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselconsolefnt.caption #, fuzzy msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnseleditfnt.caption msgctxt "tfrmoptionsfonts.btnseleditfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnsellogfnt.caption msgctxt "tfrmoptionsfonts.btnsellogfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselmainfnt.caption msgctxt "tfrmoptionsfonts.btnselmainfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselviewerbookfnt.caption msgctxt "tfrmoptionsfonts.btnselviewerbookfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.btnselviewfnt.caption msgctxt "tfrmoptionsfonts.btnselviewfnt.caption" msgid "..." msgstr "..." #: tfrmoptionsfonts.lblconsolefont.caption msgid "&Console font" msgstr "" #: tfrmoptionsfonts.lbleditorfont.caption msgid "&Editor font" msgstr "" #: tfrmoptionsfonts.lbllogfont.caption msgid "&Log font" msgstr "" #: tfrmoptionsfonts.lblmainfont.caption msgid "Main &font" msgstr "" #: tfrmoptionsfonts.lblpatheditfont.caption msgid "Path font" msgstr "" #: tfrmoptionsfonts.lblsearchresultsfont.caption msgid "Search results font" msgstr "" #: tfrmoptionsfonts.lblviewerbookfont.caption msgid "Viewer&Book Font" msgstr "" #: tfrmoptionsfonts.lblviewerfont.caption msgid "&Viewer font" msgstr "" #: tfrmoptionshotkeys.actaddhotkey.caption msgctxt "tfrmoptionshotkeys.actaddhotkey.caption" msgid "Add &hotkey" msgstr "" #: tfrmoptionshotkeys.actcopy.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actcopy.caption" msgid "Copy" msgstr "Kopyala" #: tfrmoptionshotkeys.actdelete.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actdelete.caption" msgid "Delete" msgstr "Sil" #: tfrmoptionshotkeys.actdeletehotkey.caption msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption" msgid "&Delete hotkey" msgstr "" #: tfrmoptionshotkeys.actedithotkey.caption msgctxt "tfrmoptionshotkeys.actedithotkey.caption" msgid "&Edit hotkey" msgstr "" #: tfrmoptionshotkeys.actnextcategory.caption msgid "Next category" msgstr "" #: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption msgid "Make popup the file related menu" msgstr "" #: tfrmoptionshotkeys.actpreviouscategory.caption msgid "Previous category" msgstr "" #: tfrmoptionshotkeys.actrename.caption #, fuzzy msgctxt "tfrmoptionshotkeys.actrename.caption" msgid "Rename" msgstr "Yeniden Adlandır" #: tfrmoptionshotkeys.actrestoredefault.caption msgid "Restore DC default" msgstr "" #: tfrmoptionshotkeys.actsavenow.caption msgid "Save now" msgstr "" #: tfrmoptionshotkeys.actsortbycommand.caption msgid "Sort by command name" msgstr "" #: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption msgid "Sort by hotkeys (grouped)" msgstr "" #: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption msgid "Sort by hotkeys (one per row)" msgstr "" #: tfrmoptionshotkeys.lbfilter.caption msgid "&Filter" msgstr "" #: tfrmoptionshotkeys.lblcategories.caption msgid "C&ategories:" msgstr "" #: tfrmoptionshotkeys.lblcommands.caption msgid "Co&mmands:" msgstr "" #: tfrmoptionshotkeys.lblscfiles.caption msgid "&Shortcut files:" msgstr "" #: tfrmoptionshotkeys.lblsortorder.caption msgid "So&rt order:" msgstr "" #: tfrmoptionshotkeys.micategories.caption msgid "Categories" msgstr "" #: tfrmoptionshotkeys.micommands.caption msgctxt "tfrmoptionshotkeys.micommands.caption" msgid "Command" msgstr "" #: tfrmoptionshotkeys.miseparator1.caption #, fuzzy msgctxt "tfrmoptionshotkeys.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionshotkeys.misortorder.caption msgid "Sort order" msgstr "" #: tfrmoptionsicons.cbiconsexclude.caption msgctxt "tfrmoptionsicons.cbiconsexclude.caption" msgid "For the following &paths and their subdirectories:" msgstr "Aşağıdaki &yolları ve alt dizinleri için:" #: tfrmoptionsicons.cbiconsinmenus.caption msgid "Show icons for actions in &menus" msgstr "" #: tfrmoptionsicons.cbiconsinmenussize.text msgctxt "tfrmoptionsicons.cbiconsinmenussize.text" msgid "16x16" msgstr "16x16" #: tfrmoptionsicons.cbiconsonbuttons.caption msgid "Show icons on buttons" msgstr "" #: tfrmoptionsicons.cbiconsshowoverlay.caption msgid "Show o&verlay icons, e.g. for links" msgstr "" #: tfrmoptionsicons.chkshowhiddendimmed.caption msgid "&Dimmed hidden files (slower)" msgstr "" #: tfrmoptionsicons.gbdisablespecialicons.caption msgid "Disable special icons" msgstr "" #: tfrmoptionsicons.gbiconssize.caption msgid " Icon size " msgstr "" #: tfrmoptionsicons.gbicontheme.caption msgid "Icon theme" msgstr "" #: tfrmoptionsicons.gbshowicons.caption msgid "Show icons" msgstr "" #: tfrmoptionsicons.gbshowiconsmode.caption msgctxt "tfrmoptionsicons.gbshowiconsmode.caption" msgid " Show icons to the left of the filename " msgstr "Dosya adının solundaki simgeleri göster" #: tfrmoptionsicons.lbldiskpanel.caption msgid "Disk panel:" msgstr "" #: tfrmoptionsicons.lblfilepanel.caption msgid "File panel:" msgstr "" #: tfrmoptionsicons.rbiconsshowall.caption msgctxt "tfrmoptionsicons.rbiconsshowall.caption" msgid "A&ll" msgstr "&Tümü" #: tfrmoptionsicons.rbiconsshowallandexe.caption msgctxt "tfrmoptionsicons.rbiconsshowallandexe.caption" msgid "All associated + &EXE/LNK (slow)" msgstr "Tüm ilişkili+&exe/LNK(yavaş)" #: tfrmoptionsicons.rbiconsshownone.caption msgctxt "tfrmoptionsicons.rbiconsshownone.caption" msgid "&No icons" msgstr "&Simge yok" #: tfrmoptionsicons.rbiconsshowstandard.caption msgid "Only &standard icons" msgstr "" #: tfrmoptionsignorelist.btnaddsel.caption msgid "A&dd selected names" msgstr "" #: tfrmoptionsignorelist.btnaddselwithpath.caption msgctxt "tfrmoptionsignorelist.btnaddselwithpath.caption" msgid "Add selected names with &full path" msgstr "Seçilen isimler ile &tam yolu ekle" #: tfrmoptionsignorelist.btnrelativesavein.hint msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsignorelist.chkignoreenable.caption msgctxt "tfrmoptionsignorelist.chkignoreenable.caption" msgid "&Ignore (don't show) the following files and folders:" msgstr "&Aşağıdaki dosya ve klasörleri Yoksay (görmezden gel):" #: tfrmoptionsignorelist.lblsavein.caption msgctxt "tfrmoptionsignorelist.lblsavein.caption" msgid "&Save in:" msgstr "&Kaydet:" #: tfrmoptionskeyboard.cblynxlike.caption msgid "Le&ft, Right arrows change directory (Lynx-like movement)" msgstr "" #: tfrmoptionskeyboard.gbtyping.caption msgid "Typing" msgstr "" #: tfrmoptionskeyboard.lblalt.caption msgid "Alt+L&etters:" msgstr "" #: tfrmoptionskeyboard.lblctrlalt.caption msgid "Ctrl+Alt+Le&tters:" msgstr "" #: tfrmoptionskeyboard.lblnomodifier.caption msgid "&Letters:" msgstr "" #: tfrmoptionslayout.cbflatdiskpanel.caption msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption" msgid "&Flat buttons" msgstr "" #: tfrmoptionslayout.cbflatinterface.caption msgid "Flat i&nterface" msgstr "" #: tfrmoptionslayout.cbflattoolbar.caption msgctxt "tfrmoptionslayout.cbflattoolbar.caption" msgid "Flat b&uttons" msgstr "Yassı düğmeler" #: tfrmoptionslayout.cbfreespaceind.caption msgid "Show fr&ee space indicator on drive label" msgstr "" #: tfrmoptionslayout.cblogwindow.caption msgid "Show lo&g window" msgstr "" #: tfrmoptionslayout.cbpanelofoperations.caption msgctxt "tfrmoptionslayout.cbpanelofoperations.caption" msgid "Show panel of operation in background" msgstr "Panel işlemlerini arka planda göster" #: tfrmoptionslayout.cbproginmenubar.caption msgctxt "tfrmoptionslayout.cbproginmenubar.caption" msgid "Show common progress in menu bar" msgstr "Genel ilerlemeyi menü çubuğunda göster" #: tfrmoptionslayout.cbshowcmdline.caption msgid "Show command l&ine" msgstr "" #: tfrmoptionslayout.cbshowcurdir.caption msgid "Show current director&y" msgstr "" #: tfrmoptionslayout.cbshowdiskpanel.caption msgctxt "tfrmoptionslayout.cbshowdiskpanel.caption" msgid "Show &drive buttons" msgstr "Göster &sürücü düğmeleri" #: tfrmoptionslayout.cbshowdrivefreespace.caption msgid "Show free s&pace label" msgstr "" #: tfrmoptionslayout.cbshowdriveslistbutton.caption msgid "Show drives list bu&tton" msgstr "" #: tfrmoptionslayout.cbshowkeyspanel.caption msgid "Show function &key buttons" msgstr "" #: tfrmoptionslayout.cbshowmainmenu.caption msgid "Show &main menu" msgstr "" #: tfrmoptionslayout.cbshowmaintoolbar.caption #, fuzzy #| msgid "Show &button bar" msgctxt "tfrmoptionslayout.cbshowmaintoolbar.caption" msgid "Show tool&bar" msgstr "Düğme çubuğunu &göster" #: tfrmoptionslayout.cbshowshortdrivefreespace.caption msgid "Show short free space &label" msgstr "" #: tfrmoptionslayout.cbshowstatusbar.caption msgctxt "tfrmoptionslayout.cbshowstatusbar.caption" msgid "Show &status bar" msgstr "Durum çubuğunu &göster" #: tfrmoptionslayout.cbshowtabheader.caption msgid "S&how tabstop header" msgstr "" #: tfrmoptionslayout.cbshowtabs.caption msgctxt "tfrmoptionslayout.cbshowtabs.caption" msgid "Sho&w folder tabs" msgstr "Klasör sekmelerini göster" #: tfrmoptionslayout.cbtermwindow.caption msgid "Show te&rminal window" msgstr "" #: tfrmoptionslayout.cbtwodiskpanels.caption msgid "Show two drive button bars (fi&xed width, above file windows)" msgstr "" #: tfrmoptionslayout.gbscreenlayout.caption msgctxt "tfrmoptionslayout.gbscreenlayout.caption" msgid " Screen layout " msgstr "Ekran düzeni" #: tfrmoptionslog.btnrelativelogfile.hint msgctxt "tfrmoptionslog.btnrelativelogfile.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionslog.btnviewlogfile.hint msgctxt "tfrmoptionslog.btnviewlogfile.hint" msgid "View log file content" msgstr "" #: tfrmoptionslog.cbincludedateinlogfilename.caption msgid "Include date in log filename" msgstr "" #: tfrmoptionslog.cblogarcop.caption msgid "&Pack/Unpack" msgstr "" #: tfrmoptionslog.cblogcommandlineexecution.caption msgid "External command line execution" msgstr "" #: tfrmoptionslog.cblogcpmvln.caption msgid "Cop&y/Move/Create link/symlink" msgstr "" #: tfrmoptionslog.cblogdelete.caption msgctxt "tfrmoptionslog.cblogdelete.caption" msgid "&Delete" msgstr "&Sil" #: tfrmoptionslog.cblogdirop.caption msgid "Crea&te/Delete directories" msgstr "" #: tfrmoptionslog.cblogerrors.caption msgctxt "tfrmoptionslog.cblogerrors.caption" msgid "Log &errors" msgstr "Günlük &hataları" #: tfrmoptionslog.cblogfile.caption msgid "C&reate a log file:" msgstr "" #: tfrmoptionslog.cbloginfo.caption msgid "Log &information messages" msgstr "" #: tfrmoptionslog.cblogstartshutdown.caption msgid "Start/shutdown" msgstr "" #: tfrmoptionslog.cblogsuccess.caption msgctxt "tfrmoptionslog.cblogsuccess.caption" msgid "Log &successful operations" msgstr "Günlük &başarılı işlemler" #: tfrmoptionslog.cblogvfs.caption msgid "&File system plugins" msgstr "" #: tfrmoptionslog.gblogfile.caption msgctxt "tfrmoptionslog.gblogfile.caption" msgid "File operation log file" msgstr "Günlük dosyası İşlemi" #: tfrmoptionslog.gblogfileop.caption msgid "Log operations" msgstr "" #: tfrmoptionslog.gblogfilestatus.caption msgid "Operation status" msgstr "" #: tfrmoptionsmisc.btnoutputpathfortoolbar.caption msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption" msgid ">>" msgstr ">>" #: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsmisc.btnrelativetcconfigfile.hint msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsmisc.btnrelativetcexecutablefile.hint msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionsmisc.btnthumbcompactcache.caption msgid "&Remove thumbnails for no longer existing files" msgstr "" #: tfrmoptionsmisc.btnviewconfigfile.hint msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint" msgid "View log file content" msgstr "" #: tfrmoptionsmisc.chkdesccreateunicode.caption msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption" msgid "Create new with the encoding:" msgstr "" #: tfrmoptionsmisc.chkgotoroot.caption msgid "Always &go to the root of a drive when changing drives" msgstr "" #: tfrmoptionsmisc.chkshowwarningmessages.caption msgid "Show &warning messages (\"OK\" button only)" msgstr "" #: tfrmoptionsmisc.chkthumbsave.caption msgid "&Save thumbnails in cache" msgstr "" #: tfrmoptionsmisc.dblthumbnails.caption msgctxt "tfrmoptionsmisc.dblthumbnails.caption" msgid "Thumbnails" msgstr "" #: tfrmoptionsmisc.gbfilecomments.caption msgid "File comments (descript.ion)" msgstr "" #: tfrmoptionsmisc.gbtcexportimport.caption msgid "Regarding TC export/import:" msgstr "" #: tfrmoptionsmisc.lbldescrdefaultencoding.caption msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption" msgid "Default encoding:" msgstr "" #: tfrmoptionsmisc.lbltcconfig.caption msgid "Configuration file:" msgstr "" #: tfrmoptionsmisc.lbltcexecutable.caption msgid "TC executable:" msgstr "" #: tfrmoptionsmisc.lbltcpathfortool.caption msgid "Toolbar output path:" msgstr "" #: tfrmoptionsmisc.lblthumbpixels.caption msgid "pixels" msgstr "" #: tfrmoptionsmisc.lblthumbseparator.caption msgctxt "tfrmoptionsmisc.lblthumbseparator.caption" msgid "X" msgstr "X" #: tfrmoptionsmisc.lblthumbsize.caption msgid "&Thumbnail size:" msgstr "" #: tfrmoptionsmouse.cbselectionbymouse.caption msgid "&Selection by mouse" msgstr "" #: tfrmoptionsmouse.chkmouseselectioniconclick.caption msgid "By clic&king on icon" msgstr "" #: tfrmoptionsmouse.gbscrolling.caption msgctxt "tfrmoptionsmouse.gbscrolling.caption" msgid "Scrolling" msgstr "Kaydırma" #: tfrmoptionsmouse.gbselection.caption msgid "Selection" msgstr "" #: tfrmoptionsmouse.lblmousemode.caption msgid "&Mode:" msgstr "" #: tfrmoptionsmouse.rbscrolllinebyline.caption msgid "&Line by line" msgstr "" #: tfrmoptionsmouse.rbscrolllinebylinecursor.caption msgid "Line by line &with cursor movement" msgstr "" #: tfrmoptionsmouse.rbscrollpagebypage.caption msgid "&Page by page" msgstr "" #: tfrmoptionsplugins.btnaddplugin.caption #, fuzzy #| msgid "Add" msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION" msgid "A&dd" msgstr "Ekle" #: tfrmoptionsplugins.btnconfigplugin.caption #, fuzzy #| msgid "Configure" msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION" msgid "Con&figure" msgstr "Yapılandırma" #: tfrmoptionsplugins.btnenableplugin.caption #, fuzzy #| msgid "Enable" msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION" msgid "E&nable" msgstr "Etkinleştir" #: tfrmoptionsplugins.btnremoveplugin.caption #, fuzzy #| msgid "Remove" msgctxt "tfrmoptionsplugins.btnremoveplugin.caption" msgid "&Remove" msgstr "Kaldır" #: tfrmoptionsplugins.btntweakplugin.caption #, fuzzy msgctxt "tfrmoptionsplugins.btntweakplugin.caption" msgid "&Tweak" msgstr "Ayarla" #: tfrmoptionsplugins.lbldsxdescription.caption #, fuzzy #| msgid "Searc&h plugins allow to use alternative search algorithms or external tools (like \"locate\", etc.)" msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION" msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)" msgstr "Alternatif arama algoritmaları kullanmak için arama eklentilerine veya harici araçlara izin ver(\"yerini belirle\",vb.gibi)" #: tfrmoptionsplugins.lblwcxdescription.caption #, fuzzy #| msgid "Packer plugins are used to work with archives." msgctxt "tfrmoptionsplugins.lblwcxdescription.caption" msgid "Pack&er plugins are used to work with archives" msgstr "Arşivler ile çalışmak için sıkıştırma eklentileri kullanılabilir." #: tfrmoptionsplugins.lblwdxdescription.caption #, fuzzy #| msgid "Content plu&gins allow to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool" msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION" msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool" msgstr "İçerik eklentilerine izin ver, genişletilmiş dosya ayrıntıları gibi mp3 etiketleri veya resim özniteliklerini dosya listelerinde görüntülemek için veya onları aramada kullan ve çoklu-yeniden adlandırma aracı" #: tfrmoptionsplugins.lblwfxdescription.caption #, fuzzy #| msgid "File system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC." msgctxt "TFRMOPTIONSPLUGINS.LBLallow one to displayAPTION" msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC." msgstr "Dosya sistemi eklentileri işletim sistemi tarafından ulaşılmaz disklere veya allow one to displaygibi harici cihazlara erişim sağlar" #: tfrmoptionsplugins.lblwlxdescription.caption #, fuzzy #| msgid "Vie&wer plugins allow to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)" msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)" msgstr "Görüntüleyici eklentilerine izin ver, dosya tipleri,resimler,elektronik tablolar, veritabanları vb. gibi.gösterilmesini sağlar(F3, Ctrl+Q)" #: tfrmoptionsplugins.stgplugins.columns[0].title.caption msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption" msgid "Active" msgstr "Etkin" #: tfrmoptionsplugins.stgplugins.columns[1].title.caption msgctxt "tfrmoptionsplugins.stgplugins.columns[1].title.caption" msgid "Plugin" msgstr "Eklenti" #: tfrmoptionsplugins.stgplugins.columns[2].title.caption msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption" msgid "Registered for" msgstr "Kayıtlı" #: tfrmoptionsplugins.stgplugins.columns[3].title.caption msgctxt "tfrmoptionsplugins.stgplugins.columns[3].title.caption" msgid "File name" msgstr "Dosya Adı" #: tfrmoptionsplugins.tsdsx.caption #, fuzzy #| msgid "Search plugins (.DSX)" msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION" msgid "&Search plugins (.DSX)" msgstr "Arama eklentileri(.DSX)" #: tfrmoptionsplugins.tswcx.caption #, fuzzy #| msgid "Packer plugins (.WCX)" msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION" msgid "Pac&ker plugins (.WCX)" msgstr "Sıkıştırma eklentileri (.WCX)" #: tfrmoptionsplugins.tswdx.caption #, fuzzy #| msgid "Content plugins (.WDX)" msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION" msgid "Content pl&ugins (.WDX)" msgstr "İçerik eklentileri (.WDX)" #: tfrmoptionsplugins.tswfx.caption #, fuzzy #| msgid "File system plugins (.WFX)" msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION" msgid "F&ile system plugins (.WFX)" msgstr "Dosya sistemi eklentileri (.WFX)" #: tfrmoptionsplugins.tswlx.caption #, fuzzy #| msgid "Viewer plugins (.WLX)" msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION" msgid "&Viewer plugins (.WLX)" msgstr "Görüntüleyici eklentileri(.WLX)" #: tfrmoptionsquicksearchfilter.cbexactbeginning.caption msgctxt "tfrmoptionsquicksearchfilter.cbexactbeginning.caption" msgid "&Beginning (name must start with first typed character)" msgstr "&Başlangıç (Adı ilk yazdığınız karakterle başlamalıdır)" #: tfrmoptionsquicksearchfilter.cbexactending.caption msgctxt "tfrmoptionsquicksearchfilter.cbexactending.caption" msgid "En&ding (last character before a typed dot . must match)" msgstr "&Bitiş (Noktadan önceki son karakter ile . uyumlu olmalıdır)" #: tfrmoptionsquicksearchfilter.cgpoptions.caption msgctxt "tfrmoptionsquicksearchfilter.cgpoptions.caption" msgid "Options" msgstr "Seçenekler" #: tfrmoptionsquicksearchfilter.gbexactnamematch.caption msgid "Exact name match" msgstr "" #: tfrmoptionsquicksearchfilter.rgpsearchcase.caption msgid "Search case" msgstr "" #: tfrmoptionsquicksearchfilter.rgpsearchitems.caption msgid "Search for these items" msgstr "" #: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption msgid "Keep renamed name when unlocking a tab" msgstr "" #: tfrmoptionstabs.cbtabsactivateonclick.caption msgctxt "tfrmoptionstabs.cbtabsactivateonclick.caption" msgid "Activate target &panel when clicking on one of its Tabs" msgstr "Hedef &paneli etkinleştir onun sekmelerinden birisini tıklayarak" #: tfrmoptionstabs.cbtabsalwaysvisible.caption msgctxt "tfrmoptionstabs.cbtabsalwaysvisible.caption" msgid "&Show tab header also when there is only one tab" msgstr "&Sadece bir sekme olduğunda da sekme başlığı göster" #: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption msgid "Close duplicate tabs when closing application" msgstr "" #: tfrmoptionstabs.cbtabsconfirmcloseall.caption msgid "Con&firm close all tabs" msgstr "" #: tfrmoptionstabs.cbtabsconfirmcloselocked.caption msgid "Confirm close locked tabs" msgstr "" #: tfrmoptionstabs.cbtabslimitoption.caption msgctxt "tfrmoptionstabs.cbtabslimitoption.caption" msgid "&Limit tab title length to" msgstr "&Sekme başlık(alınlık) uzunluğunu sınırla" #: tfrmoptionstabs.cbtabslockedasterisk.caption msgctxt "tfrmoptionstabs.cbtabslockedasterisk.caption" msgid "Show locked tabs &with an asterisk *" msgstr "Kilitli sekmeleri &yıldız işareti * ile göster" #: tfrmoptionstabs.cbtabsmultilines.caption msgctxt "tfrmoptionstabs.cbtabsmultilines.caption" msgid "&Tabs on multiple lines" msgstr "&Çoklu satır sekmeleri" #: tfrmoptionstabs.cbtabsopenforeground.caption msgctxt "tfrmoptionstabs.cbtabsopenforeground.caption" msgid "Ctrl+&Up opens new tab in foreground" msgstr "Ctrl+&Up ön planda yeni sekmede açar" #: tfrmoptionstabs.cbtabsopennearcurrent.caption msgctxt "tfrmoptionstabs.cbtabsopennearcurrent.caption" msgid "Open &new tabs near current tab" msgstr "Geçerli sekmenin yanında yeni bir sekme ekle" #: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption msgid "Reuse existing tab when possible" msgstr "" #: tfrmoptionstabs.cbtabsshowclosebutton.caption msgid "Show ta&b close button" msgstr "" #: tfrmoptionstabs.cbtabsshowdriveletter.caption msgid "Always show drive letter in tab title" msgstr "" #: tfrmoptionstabs.gbtabs.caption msgctxt "tfrmoptionstabs.gbtabs.caption" msgid "Folder tabs headers" msgstr "Klasör sekmeleri başlıkları" #: tfrmoptionstabs.lblchar.caption msgctxt "tfrmoptionstabs.lblchar.caption" msgid "characters" msgstr "karakterler" #: tfrmoptionstabs.lbltabsactionondoubleclick.caption msgid "Action to do when double click on a tab:" msgstr "" #: tfrmoptionstabs.lbltabsposition.caption msgid "Ta&bs position" msgstr "" #: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text" msgid "None" msgstr "" #: tfrmoptionstabsextra.cbdefaultsavedirhistory.text #, fuzzy msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text" msgid "No" msgstr "Hayır" #: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text" msgid "Left" msgstr "" #: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text" msgid "Right" msgstr "" #: tfrmoptionstabsextra.cbgotoconfigafterresave.caption msgid "Goto to Favorite Tabs Configuration after resaving" msgstr "" #: tfrmoptionstabsextra.cbgotoconfigaftersave.caption msgid "Goto to Favorite Tabs Configuration after saving a new one" msgstr "" #: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)" msgstr "" #: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption msgid "Default extra settings when saving new Favorite Tabs:" msgstr "" #: tfrmoptionstabsextra.gbtabs.caption msgid "Folder tabs headers extra" msgstr "" #: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption msgid "When restoring tab, existing tabs to keep:" msgstr "" #: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption msgid "Tabs saved on left will be restored to:" msgstr "" #: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption msgid "Tabs saved on right will be restored to:" msgstr "" #: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption" msgid "Keep saving dir history with Favorite Tabs:" msgstr "" #: tfrmoptionstabsextra.rgwheretoadd.caption msgid "Default position in menu when saving a new Favorite Tabs:" msgstr "" #: tfrmoptionsterminal.edrunintermcloseparams.hint msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "" #: tfrmoptionsterminal.edrunintermstayopenparams.hint msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "" #: tfrmoptionsterminal.edruntermparams.hint msgctxt "tfrmoptionsterminal.edruntermparams.hint" msgid "{command} should normally be present here to reflect the command to be run in terminal" msgstr "" #: tfrmoptionsterminal.gbjustrunterminal.caption msgid "Command for just running terminal:" msgstr "" #: tfrmoptionsterminal.gbruninterminalclose.caption msgid "Command for running a command in terminal and close after:" msgstr "" #: tfrmoptionsterminal.gbruninterminalstayopen.caption msgid "Command for running a command in terminal and stay open:" msgstr "" #: tfrmoptionsterminal.lbrunintermclosecmd.caption msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption" msgid "Command:" msgstr "Komut:" #: tfrmoptionsterminal.lbrunintermcloseparams.caption msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption" msgid "Parameters:" msgstr "Değişkenler:" #: tfrmoptionsterminal.lbrunintermstayopencmd.caption msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption" msgid "Command:" msgstr "Komut:" #: tfrmoptionsterminal.lbrunintermstayopenparams.caption msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption" msgid "Parameters:" msgstr "Değişkenler:" #: tfrmoptionsterminal.lbruntermcmd.caption msgctxt "tfrmoptionsterminal.lbruntermcmd.caption" msgid "Command:" msgstr "Komut:" #: tfrmoptionsterminal.lbruntermparams.caption msgctxt "tfrmoptionsterminal.lbruntermparams.caption" msgid "Parameters:" msgstr "Değişkenler:" #: tfrmoptionstoolbar.btnclonebutton.caption msgid "C&lone button" msgstr "" #: tfrmoptionstoolbar.btndeletebutton.caption msgctxt "tfrmoptionstoolbar.btndeletebutton.caption" msgid "&Delete" msgstr "&Sil" #: tfrmoptionstoolbar.btnedithotkey.caption msgid "Edit hot&key" msgstr "" #: tfrmoptionstoolbar.btninsertbutton.caption msgctxt "tfrmoptionstoolbar.btninsertbutton.caption" msgid "&Insert new button" msgstr "&Yeni düğme ekle" #: tfrmoptionstoolbar.btnopencmddlg.caption msgid "Select" msgstr "" #: tfrmoptionstoolbar.btnopenfile.caption msgctxt "tfrmoptionstoolbar.btnopenfile.caption" msgid ">>" msgstr ">>" #: tfrmoptionstoolbar.btnother.caption msgctxt "tfrmoptionstoolbar.btnother.caption" msgid "Other..." msgstr "" #: tfrmoptionstoolbar.btnremovehotkey.caption msgid "Remove hotke&y" msgstr "" #: tfrmoptionstoolbar.btnstartpath.caption msgctxt "tfrmoptionstoolbar.btnstartpath.caption" msgid ">>" msgstr ">>" #: tfrmoptionstoolbar.btnsuggestiontooltip.caption msgid "Suggest" msgstr "" #: tfrmoptionstoolbar.btnsuggestiontooltip.hint msgid "Have DC suggest the tooltip based on button type, command and parameters" msgstr "" #: tfrmoptionstoolbar.cbflatbuttons.caption msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption" msgid "&Flat buttons" msgstr "" #: tfrmoptionstoolbar.cbreporterrorwithcommands.caption msgid "Report errors with commands" msgstr "" #: tfrmoptionstoolbar.edtinternalparameters.hint msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters." msgstr "" #: tfrmoptionstoolbar.gbgroupbox.caption msgctxt "tfrmoptionstoolbar.gbgroupbox.caption" msgid "Appearance" msgstr "Görünüm" #: tfrmoptionstoolbar.lblbarsize.caption msgid "&Bar size:" msgstr "" #: tfrmoptionstoolbar.lblexternalcommand.caption msgid "Comman&d:" msgstr "" #: tfrmoptionstoolbar.lblexternalparameters.caption msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption" msgid "Parameter&s:" msgstr "Değişkenler:" #: tfrmoptionstoolbar.lblhelponinternalcommand.caption msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption" msgid "Help" msgstr "" #: tfrmoptionstoolbar.lblhotkey.caption msgid "Hot key:" msgstr "" #: tfrmoptionstoolbar.lbliconfile.caption msgid "Ico&n:" msgstr "" #: tfrmoptionstoolbar.lbliconsize.caption msgid "Icon si&ze:" msgstr "" #: tfrmoptionstoolbar.lblinternalcommand.caption msgid "Co&mmand:" msgstr "" #: tfrmoptionstoolbar.lblinternalparameters.caption msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption" msgid "&Parameters:" msgstr "Değişkenler" #: tfrmoptionstoolbar.lblstartpath.caption msgctxt "tfrmoptionstoolbar.lblstartpath.caption" msgid "Start pat&h:" msgstr "" #: tfrmoptionstoolbar.lbltooltip.caption msgctxt "tfrmoptionstoolbar.lbltooltip.caption" msgid "&Tooltip:" msgstr "&Araç İpucu" #: tfrmoptionstoolbar.miaddallcmds.caption msgid "Add toolbar with ALL DC commands" msgstr "" #: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption msgid "for an external command" msgstr "" #: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption msgid "for an internal command" msgstr "" #: tfrmoptionstoolbar.miaddseparatorsubmenu.caption msgid "for a separator" msgstr "" #: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption msgid "for a sub-tool bar" msgstr "" #: tfrmoptionstoolbar.mibackup.caption msgctxt "tfrmoptionstoolbar.mibackup.caption" msgid "Backup..." msgstr "" #: tfrmoptionstoolbar.miexport.caption msgctxt "tfrmoptionstoolbar.miexport.caption" msgid "Export..." msgstr "" #: tfrmoptionstoolbar.miexportcurrent.caption msgid "Current toolbar..." msgstr "" #: tfrmoptionstoolbar.miexportcurrenttodcbar.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption" msgid "to a Toolbar File (.toolbar)" msgstr "" #: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption" msgid "to a TC .BAR file (keep existing)" msgstr "" #: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption" msgid "to a TC .BAR file (erase existing)" msgstr "" #: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "" #: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "" #: tfrmoptionstoolbar.miexportseparator1.caption msgctxt "tfrmoptionstoolbar.miexportseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator2.caption msgctxt "tfrmoptionstoolbar.miexportseparator2.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator3.caption msgctxt "tfrmoptionstoolbar.miexportseparator3.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexportseparator4.caption msgctxt "tfrmoptionstoolbar.miexportseparator4.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miexporttop.caption msgid "Top toolbar..." msgstr "" #: tfrmoptionstoolbar.miexporttoptobackup.caption msgid "Save a backup of Toolbar" msgstr "" #: tfrmoptionstoolbar.miexporttoptodcbar.caption msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption" msgid "to a Toolbar File (.toolbar)" msgstr "" #: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption" msgid "to a TC .BAR file (keep existing)" msgstr "" #: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption" msgid "to a TC .BAR file (erase existing)" msgstr "" #: tfrmoptionstoolbar.miexporttoptotcinikeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption" msgid "to a \"wincmd.ini\" of TC (keep existing)" msgstr "" #: tfrmoptionstoolbar.miexporttoptotcininokeep.caption msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption" msgid "to a \"wincmd.ini\" of TC (erase existing)" msgstr "" #: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption" msgid "just after current selection" msgstr "" #: tfrmoptionstoolbar.miexternalcommandfirstelement.caption msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption" msgid "as first element" msgstr "" #: tfrmoptionstoolbar.miexternalcommandlastelement.caption msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption" msgid "as last element" msgstr "" #: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption" msgid "just prior current selection" msgstr "" #: tfrmoptionstoolbar.miimport.caption msgctxt "tfrmoptionstoolbar.miimport.caption" msgid "Import..." msgstr "" #: tfrmoptionstoolbar.miimportbackup.caption msgid "Restore a backup of Toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupaddcurrent.caption msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption" msgid "to add to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupaddmenutop.caption msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupaddtop.caption msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption" msgid "to add to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportbackupreplacetop.caption msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption" msgid "to replace top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbar.caption msgid "from a Toolbar File (.toolbar)" msgstr "" #: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption" msgid "to add to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbaraddtop.caption msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption" msgid "to add to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportdcbarreplacetop.caption msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption" msgid "to replace top toolbar" msgstr "" #: tfrmoptionstoolbar.miimportseparator.caption msgctxt "tfrmoptionstoolbar.miimportseparator.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miimporttcbar.caption msgid "from a single TC .BAR file" msgstr "" #: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption" msgid "to add to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcbaraddtop.caption msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption" msgid "to add to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcbarreplacetop.caption msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption" msgid "to replace top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcini.caption msgid "from \"wincmd.ini\" of TC..." msgstr "" #: tfrmoptionstoolbar.miimporttciniaddcurrent.caption msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption" msgid "to add to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption" msgid "to add to a new toolbar to current toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttciniaddmenutop.caption msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption" msgid "to add to a new toolbar to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttciniaddtop.caption msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption" msgid "to add to top toolbar" msgstr "" #: tfrmoptionstoolbar.miimporttcinireplacetop.caption msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption" msgid "to replace top toolbar" msgstr "" #: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption" msgid "just after current selection" msgstr "" #: tfrmoptionstoolbar.miinternalcommandfirstelement.caption msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption" msgid "as first element" msgstr "" #: tfrmoptionstoolbar.miinternalcommandlastelement.caption msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption" msgid "as last element" msgstr "" #: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption" msgid "just prior current selection" msgstr "" #: tfrmoptionstoolbar.misearchandreplace.caption msgctxt "tfrmoptionstoolbar.misearchandreplace.caption" msgid "Search and replace..." msgstr "" #: tfrmoptionstoolbar.miseparator1.caption msgctxt "tfrmoptionstoolbar.miseparator1.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator10.caption msgctxt "tfrmoptionstoolbar.miseparator10.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator11.caption msgctxt "tfrmoptionstoolbar.miseparator11.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator13.caption msgctxt "tfrmoptionstoolbar.miseparator13.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator14.caption msgctxt "tfrmoptionstoolbar.miseparator14.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator2.caption msgctxt "tfrmoptionstoolbar.miseparator2.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator6.caption msgctxt "tfrmoptionstoolbar.miseparator6.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator7.caption msgctxt "tfrmoptionstoolbar.miseparator7.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator8.caption msgctxt "tfrmoptionstoolbar.miseparator8.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparator9.caption msgctxt "tfrmoptionstoolbar.miseparator9.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.miseparatoraftercurrent.caption msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption" msgid "just after current selection" msgstr "" #: tfrmoptionstoolbar.miseparatorfirstitem.caption msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption" msgid "as first element" msgstr "" #: tfrmoptionstoolbar.miseparatorlastelement.caption msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption" msgid "as last element" msgstr "" #: tfrmoptionstoolbar.miseparatorpriorcurrent.caption msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption" msgid "just prior current selection" msgstr "" #: tfrmoptionstoolbar.misrcrplallofall.caption msgid "in all of all the above..." msgstr "" #: tfrmoptionstoolbar.misrcrplclickseparator.caption msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption" msgid "-" msgstr "-" #: tfrmoptionstoolbar.misrcrplcommands.caption msgid "in all commands..." msgstr "" #: tfrmoptionstoolbar.misrcrpliconnames.caption msgid "in all icon names..." msgstr "" #: tfrmoptionstoolbar.misrcrplparameters.caption msgid "in all parameters..." msgstr "" #: tfrmoptionstoolbar.misrcrplstartpath.caption msgid "in all start path..." msgstr "" #: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption" msgid "just after current selection" msgstr "" #: tfrmoptionstoolbar.misubtoolbarfirstelement.caption msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption" msgid "as first element" msgstr "" #: tfrmoptionstoolbar.misubtoolbarlastelement.caption msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption" msgid "as last element" msgstr "" #: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption" msgid "just prior current selection" msgstr "" #: tfrmoptionstoolbar.rgtoolitemtype.caption msgid "Button type" msgstr "" #: tfrmoptionstoolbase.btnrelativetoolpath.hint msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption msgid "&Keep terminal window open after executing program" msgstr "" #: tfrmoptionstoolbase.cbtoolsruninterminal.caption msgid "&Execute in terminal" msgstr "" #: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption msgid "&Use external program" msgstr "" #: tfrmoptionstoolbase.lbltoolsparameters.caption msgid "A&dditional parameters" msgstr "" #: tfrmoptionstoolbase.lbltoolspath.caption msgid "&Path to program to execute" msgstr "" #: tfrmoptionstooltips.btnaddfields.caption #, fuzzy #| msgid "Add" msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION" msgid "A&dd" msgstr "Ekle" #: tfrmoptionstooltips.btnapplyfields.caption #, fuzzy #| msgid "Apply" msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION" msgid "A&pply" msgstr "Uygula" #: tfrmoptionstooltips.btndeletefields.caption #, fuzzy #| msgid "Delete" msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION" msgid "D&elete" msgstr "&Sil" #: tfrmoptionstooltips.btnfieldslist.caption msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION" msgid ">>" msgstr ">>" #: tfrmoptionstooltips.btnfieldssearchtemplate.hint msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT" msgid "Template..." msgstr "Şablon..." #: tfrmoptionstooltips.chkshowtooltip.caption #, fuzzy #| msgid "Show tool tip" msgctxt "tfrmoptionstooltips.chkshowtooltip.caption" msgid "&Show tooltip for files in the file panel" msgstr "Araç İpucu'nu göster (Not sözleri)" #: tfrmoptionstooltips.gbcustomfields.caption msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION" msgid "Custom fields by file type" msgstr "Dosya türüne göre özel alanlar" #: tfrmoptionstooltips.lblfieldslist.caption #, fuzzy #| msgid "Category hint:" msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION" msgid "Category &hint:" msgstr "Sınıf ipucu:" #: tfrmoptionstooltips.lblfieldsmask.caption #, fuzzy #| msgid "Category mask:" msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION" msgid "Category &mask:" msgstr "Sınıf maskesi" #: tfrmoptionstooltips.lblfieldsname.caption #, fuzzy #| msgid "Category name:" msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION" msgid "Category &name:" msgstr "Sınıf adı" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption msgid "With double-click on the bar on top of a file panel" msgstr "" #: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption" msgid "With the menu and internal command" msgstr "" #: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption msgid "Double click in tree select and exit" msgstr "" #: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption" msgid "With the menu and internal command" msgstr "" #: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption msgid "With double-click on a tab (if configured for it)" msgstr "" #: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption msgid "When using the keyboard shortcut, it will exit the window returning the current choice" msgstr "" #: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption msgid "Single mouse click in tree select and exit" msgstr "" #: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption msgid "Use it for Command Line History" msgstr "" #: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption msgid "Use it for the Dir History" msgstr "" #: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption msgid "Use it for the View History (Visited paths for active view)" msgstr "" #: tfrmoptionstreeviewmenu.gbbehavior.caption msgid "Behavior regarding selection:" msgstr "" #: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption msgid "Tree View Menus related options:" msgstr "" #: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption msgid "Where to use Tree View Menus:" msgstr "" #: tfrmoptionstreeviewmenu.lblnote.caption msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another." msgstr "" #: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption msgid "With Directory Hotlist:" msgstr "" #: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption msgid "With Favorite Tabs:" msgstr "" #: tfrmoptionstreeviewmenu.lblusewithhistory.caption msgid "With History:" msgstr "" #: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btncursorcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption #, fuzzy msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption" msgid ">>" msgstr ">>" #: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption msgid "Use and display keyboard shortcut for choosing items" msgstr "" #: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption msgid "Layout and colors options:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption msgid "Background color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption msgid "Cursor color:" msgstr "Gösterge rengi:" #: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption msgid "Found text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption msgid "Found text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption msgid "Normal text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption msgid "Normal text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblpreview.caption msgid "Tree View Menu Preview:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption msgid "Secondary text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption msgid "Secondary text under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption msgid "Shortcut color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption msgid "Shortcut under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption msgid "Unselectable text color:" msgstr "" #: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption msgid "Unselectable under cursor:" msgstr "" #: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample." msgstr "" #: tfrmoptionsviewer.btnbackviewercolor.caption msgctxt "tfrmoptionsviewer.btnbackviewercolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsviewer.btnfontviewercolor.caption msgctxt "tfrmoptionsviewer.btnfontviewercolor.caption" msgid ">>" msgstr ">>" #: tfrmoptionsviewer.gbviewerbookmode.caption msgctxt "tfrmoptionsviewer.gbviewerbookmode.caption" msgid "Viewer Book Mode" msgstr "Kitap Modu Görünümü" #: tfrmoptionsviewer.gbviewerexample.caption msgctxt "tfrmoptionsviewer.gbviewerexample.caption" msgid "Example" msgstr "Örnek" #: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption msgid "&Background color in book viewer" msgstr "" #: tfrmoptionsviewer.lblfontcolorviewerbook.caption msgid "&Font color in book viewer" msgstr "" #: tfrmoptionsviewer.lblnumbercolumnsviewer.caption msgid "&Number of columns in book viewer" msgstr "" #: tfrmpackdlg.btnconfig.caption #, fuzzy #| msgid "&Configure" msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION" msgid "Con&figure" msgstr "&Yapılandır" #: tfrmpackdlg.caption msgctxt "tfrmpackdlg.caption" msgid "Pack files" msgstr "Sıkıştırılmış dosyalar" #: tfrmpackdlg.cbcreateseparatearchives.caption #, fuzzy #| msgid "Create separate archives, o&ne per selected file/dir" msgid "C&reate separate archives, one per selected file/dir" msgstr "Ayrı arşiv oluştur, &Bir seçili dosya/dizin başına" #: tfrmpackdlg.cbcreatesfx.caption msgid "Create self e&xtracting archive" msgstr "Kendi kendine &açılan arşiv oluştur(SFX)" #: tfrmpackdlg.cbencrypt.caption msgid "Encr&ypt" msgstr "Şifrele&mek" #: tfrmpackdlg.cbmovetoarchive.caption #, fuzzy #| msgid "M&ove to archive" msgid "Mo&ve to archive" msgstr "&Arşive taşı" #: tfrmpackdlg.cbmultivolume.caption msgid "&Multiple disk archive" msgstr "&Çoklu disk arşivi" #: tfrmpackdlg.cbotherplugins.caption msgid "=>" msgstr "=>" #: tfrmpackdlg.cbputintarfirst.caption #, fuzzy #| msgid "Put in the TAR archive first" msgid "P&ut in the TAR archive first" msgstr "İlk TAR arşivi yerleştir" #: tfrmpackdlg.cbstoredir.caption msgid "Also &pack path names (only recursed)" msgstr "Ayrıca sıkıştırılmış yol adları (sadece özyineleme)" #: tfrmpackdlg.lblprompt.caption msgid "Pack file(s) to the file:" msgstr "Dosya;Sıkıştırma dosya(lar)ına " #: tfrmpackdlg.rgpacker.caption msgid "Packer" msgstr "Sıkıştırıcı" #: tfrmpackinfodlg.btnclose.caption #, fuzzy #| msgid "Close" msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION" msgid "&Close" msgstr "Kapat" #: tfrmpackinfodlg.btnunpackallandexec.caption msgid "Unpack &all and execute" msgstr "&Tümünü aç ve yürüt" #: tfrmpackinfodlg.btnunpackandexec.caption msgid "&Unpack and execute" msgstr "&Aç ve yürüt" #: tfrmpackinfodlg.caption msgctxt "tfrmpackinfodlg.caption" msgid "Properties of packed file" msgstr "Sıkıştırılmış dosyanın Özellikleri" #: tfrmpackinfodlg.lblattributes.caption msgid "Attributes:" msgstr "Öznitelikleri:" #: tfrmpackinfodlg.lblcompressionratio.caption msgid "Compression ratio:" msgstr "Sıkıştırma oranı:" #: tfrmpackinfodlg.lbldate.caption msgid "Date:" msgstr "Tarihi:" #: tfrmpackinfodlg.lblmethod.caption msgid "Method:" msgstr "Yöntemi:" #: tfrmpackinfodlg.lbloriginalsize.caption msgid "Original size:" msgstr "Orijinal boyutu" #: tfrmpackinfodlg.lblpackedfile.caption msgid "File:" msgstr "Dosya:" #: tfrmpackinfodlg.lblpackedsize.caption msgid "Packed size:" msgstr "Sıkıştırılmış boyutu:" #: tfrmpackinfodlg.lblpacker.caption msgid "Packer:" msgstr "Sıkıştırıcı:" #: tfrmpackinfodlg.lbltime.caption msgid "Time:" msgstr "Zaman:" #: tfrmquicksearch.btncancel.caption msgctxt "tfrmquicksearch.btncancel.caption" msgid "X" msgstr "X" #: tfrmquicksearch.btncancel.hint msgid "Close filter panel" msgstr "" #: tfrmquicksearch.edtsearch.hint msgid "Enter text to search for or filter by" msgstr "" #: tfrmquicksearch.sbcasesensitive.caption msgid "Aa" msgstr "" #: tfrmquicksearch.sbcasesensitive.hint msgid "Case Sensitive" msgstr "" #: tfrmquicksearch.sbdirectories.caption msgid "D" msgstr "" #: tfrmquicksearch.sbdirectories.hint msgctxt "tfrmquicksearch.sbdirectories.hint" msgid "Directories" msgstr "" #: tfrmquicksearch.sbfiles.caption msgid "F" msgstr "" #: tfrmquicksearch.sbfiles.hint msgctxt "tfrmquicksearch.sbfiles.hint" msgid "Files" msgstr "" #: tfrmquicksearch.sbmatchbeginning.caption msgid "{" msgstr "" #: tfrmquicksearch.sbmatchbeginning.hint msgid "Match Beginning" msgstr "" #: tfrmquicksearch.sbmatchending.caption msgid "}" msgstr "" #: tfrmquicksearch.sbmatchending.hint msgid "Match Ending" msgstr "" #: tfrmquicksearch.tglfilter.caption msgctxt "tfrmquicksearch.tglfilter.caption" msgid "Filter" msgstr "Süzgeç" #: tfrmquicksearch.tglfilter.hint msgid "Toggle between search or filter" msgstr "" #: tfrmsearchplugin.btnadd.caption msgid "&More rules" msgstr "" #: tfrmsearchplugin.btndelete.caption msgid "L&ess rules" msgstr "" #: tfrmsearchplugin.chkuseplugins.caption msgid "Use &content plugins, combine with:" msgstr "" #: tfrmsearchplugin.headercontrol.sections[0].text msgctxt "tfrmsearchplugin.headercontrol.sections[0].text" msgid "Plugin" msgstr "Eklenti" #: tfrmsearchplugin.headercontrol.sections[1].text msgid "Field" msgstr "" #: tfrmsearchplugin.headercontrol.sections[2].text msgid "Operator" msgstr "" #: tfrmsearchplugin.headercontrol.sections[3].text msgctxt "tfrmsearchplugin.headercontrol.sections[3].text" msgid "Value" msgstr "Değer" #: tfrmsearchplugin.rband.caption msgid "&AND (all match)" msgstr "" #: tfrmsearchplugin.rbor.caption msgid "&OR (any match)" msgstr "" #: tfrmselecttextrange.btppanel.cancelbutton.caption msgctxt "tfrmselecttextrange.btppanel.cancelbutton.caption" msgid "Cancel" msgstr "İptal" #: tfrmselecttextrange.btppanel.closebutton.caption msgctxt "tfrmselecttextrange.btppanel.closebutton.caption" msgid "&Close" msgstr "&Kapat" #: tfrmselecttextrange.btppanel.helpbutton.caption msgctxt "tfrmselecttextrange.btppanel.helpbutton.caption" msgid "&Help" msgstr "&Yardım" #: tfrmselecttextrange.btppanel.okbutton.caption msgctxt "tfrmselecttextrange.btppanel.okbutton.caption" msgid "&OK" msgstr "&TAMAM" #: tfrmselecttextrange.lblselecttext.caption msgid "&Select the characters to insert:" msgstr "" #: tfrmsetfileproperties.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmsetfileproperties.btnok.caption msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION" msgid "&OK" msgstr "&TAMAM" #: tfrmsetfileproperties.caption msgctxt "tfrmsetfileproperties.caption" msgid "Change attributes" msgstr "Öznitelikleri Değiştir" #: tfrmsetfileproperties.cbsgid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION" msgid "SGID" msgstr "SGID" #: tfrmsetfileproperties.cbsticky.caption msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION" msgid "Sticky" msgstr "Yapışkan" #: tfrmsetfileproperties.cbsuid.caption msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION" msgid "SUID" msgstr "SUID" #: tfrmsetfileproperties.chkarchive.caption msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION" msgid "Archive" msgstr "Arşiv" #: tfrmsetfileproperties.chkcreationtime.caption msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION" msgid "Created:" msgstr "Oluşturulan:" #: tfrmsetfileproperties.chkhidden.caption msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION" msgid "Hidden" msgstr "Gizli" #: tfrmsetfileproperties.chklastaccesstime.caption msgid "Accessed:" msgstr "Giriş:" #: tfrmsetfileproperties.chklastwritetime.caption msgid "Modified:" msgstr "Değişiklik yap" #: tfrmsetfileproperties.chkreadonly.caption msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION" msgid "Read only" msgstr "Salt okunur" #: tfrmsetfileproperties.chkrecursive.caption #, fuzzy #| msgid "Recursive" msgid "Including subfolders" msgstr "Özyinelemeli" #: tfrmsetfileproperties.chksystem.caption msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION" msgid "System" msgstr "Sistem" #: tfrmsetfileproperties.gbtimesamp.caption msgid "Timestamp properties" msgstr "Zaman Damgası özellikleri(geçerli tarih ve saat, ayarlı değerleri)" #: tfrmsetfileproperties.gbunixattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Öznitelikler" #: tfrmsetfileproperties.gbwinattributes.caption msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION" msgid "Attributes" msgstr "Öznitelikler" #: tfrmsetfileproperties.lblattrbitsstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION" msgid "Bits:" msgstr "Bit:" #: tfrmsetfileproperties.lblattrgroupstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION" msgid "Group" msgstr "Grup" #: tfrmsetfileproperties.lblattrinfo.caption #, fuzzy #| msgid "(gray field means unchanged value)\"" msgctxt "tfrmsetfileproperties.lblattrinfo.caption" msgid "(gray field means unchanged value)" msgstr "(gri alan değiştirilmemiş değer anlamına gelir)" #: tfrmsetfileproperties.lblattrotherstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION" msgid "Other" msgstr "Diğer" #: tfrmsetfileproperties.lblattrownerstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION" msgid "Owner" msgstr "Sahibi" #: tfrmsetfileproperties.lblattrtext.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION" msgid "-----------" msgstr "-----------" #: tfrmsetfileproperties.lblattrtextstr.caption msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION" msgid "Text:" msgstr "Metin gösterimi" #: tfrmsetfileproperties.lblexec.caption msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION" msgid "Execute" msgstr "Yürüt" #: tfrmsetfileproperties.lblmodeinfo.caption #, fuzzy #| msgid "(gray field means unchanged value)\"" msgctxt "tfrmsetfileproperties.lblmodeinfo.caption" msgid "(gray field means unchanged value)" msgstr "(gri alan değiştirilmemiş değer anlamına gelir)" #: tfrmsetfileproperties.lbloctal.caption msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION" msgid "Octal:" msgstr "Sekizli:" #: tfrmsetfileproperties.lblread.caption msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION" msgid "Read" msgstr "Okuma" #: tfrmsetfileproperties.lblwrite.caption msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION" msgid "Write" msgstr "Yazma" #: tfrmsplitter.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmsplitter.btnftchoice.caption msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION" msgid "..." msgstr "..." #: tfrmsplitter.btnok.caption #, fuzzy #| msgid "OK" msgctxt "TFRMSPLITTER.BTNOK.CAPTION" msgid "&OK" msgstr "TAMAM" #: tfrmsplitter.btnrelativeftchoice.hint msgctxt "tfrmsplitter.btnrelativeftchoice.hint" msgid "Some functions to select appropriate path" msgstr "" #: tfrmsplitter.caption msgctxt "tfrmsplitter.caption" msgid "Splitter" msgstr "Ayırıcı" #: tfrmsplitter.cbrequireacrc32verificationfile.caption msgid "Require a CRC32 verification file" msgstr "" #: tfrmsplitter.cmbxsize.text msgid "1457664B - 3.5\"" msgstr "1457664B - 3.5\"" #: tfrmsplitter.grbxfile.caption msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION" msgid "File name" msgstr "Dosya Adı" #: tfrmsplitter.grbxsize.caption msgid "Size and number of parts" msgstr "Boyut ve parça sayıları" #: tfrmsplitter.lbdirtarget.caption #, fuzzy #| msgid "Directory target" msgid "Directory &target" msgstr "Hedef dizin" #: tfrmsplitter.lbfilesource.caption #, fuzzy #| msgid "File source" msgid "File &source" msgstr "Dosya kaynağı" #: tfrmsplitter.lblnumberparts.caption #, fuzzy #| msgid "Number of parts" msgid "&Number of parts" msgstr "Parça sayısı" #: tfrmsplitter.rbtnbyte.caption msgid "&Bytes" msgstr "" #: tfrmsplitter.rbtngigab.caption #, fuzzy #| msgid "Gigabytes" msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION" msgid "&Gigabytes" msgstr "Gigabayt" #: tfrmsplitter.rbtnkilob.caption #, fuzzy #| msgid "Kilobytes" msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION" msgid "&Kilobytes" msgstr "Kilobayt" #: tfrmsplitter.rbtnmegab.caption #, fuzzy #| msgid "Megabytes" msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION" msgid "&Megabytes" msgstr "Megabayt" #: tfrmstartingsplash.caption msgctxt "tfrmstartingsplash.caption" msgid "Double Commander" msgstr "Double Commander" #: tfrmstartingsplash.lblbuild.caption msgctxt "tfrmstartingsplash.lblbuild.caption" msgid "Build" msgstr "Yapı" #: tfrmstartingsplash.lblfreepascalver.caption msgctxt "tfrmstartingsplash.lblfreepascalver.caption" msgid "Free Pascal" msgstr "Free Pascal Editor" #: tfrmstartingsplash.lbllazarusver.caption msgctxt "tfrmstartingsplash.lbllazarusver.caption" msgid "Lazarus" msgstr "Lazarus" #: tfrmstartingsplash.lbloperatingsystem.caption msgid "Operating System" msgstr "" #: tfrmstartingsplash.lblplatform.caption msgid "Platform" msgstr "" #: tfrmstartingsplash.lblrevision.caption msgctxt "tfrmstartingsplash.lblrevision.caption" msgid "Revision" msgstr "Gözden geçir" #: tfrmstartingsplash.lbltitle.caption msgctxt "tfrmstartingsplash.lbltitle.caption" msgid "Double Commander" msgstr "Double Commander" #: tfrmstartingsplash.lblversion.caption #, fuzzy #| msgid "Version %s" msgctxt "tfrmstartingsplash.lblversion.caption" msgid "Version" msgstr "Çeviri Çağlar" #: tfrmstartingsplash.lblwidgetsetver.caption msgid "WidgetsetVer" msgstr "" #: tfrmsymlink.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmsymlink.btnok.caption msgctxt "TFRMSYMLINK.BTNOK.CAPTION" msgid "&OK" msgstr "&TAMAM" #: tfrmsymlink.caption msgid "Create symbolic link" msgstr "Sembolik bağlantı oluştur" #: tfrmsymlink.chkuserelativepath.caption msgid "Use &relative path when possible" msgstr "" #: tfrmsymlink.lblexistingfile.caption #, fuzzy #| msgid "Destination that the link will point to" msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION" msgid "&Destination that the link will point to" msgstr "Mevcut hedef;bağlantı noktası ile gösterilen" #: tfrmsymlink.lbllinktocreate.caption #, fuzzy #| msgid "Link name" msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION" msgid "&Link name" msgstr "Bağlantı adı" #: tfrmsyncdirsdlg.actselectclear.caption msgid "Remove selection" msgstr "" #: tfrmsyncdirsdlg.actselectcopydefault.caption msgid "Select for copying (default direction)" msgstr "" #: tfrmsyncdirsdlg.actselectcopylefttoright.caption msgid "Select for copying -> (left to right)" msgstr "" #: tfrmsyncdirsdlg.actselectcopyreverse.caption msgid "Reverse copy direction" msgstr "" #: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption msgid "Select for copying <- (right to left)" msgstr "" #: tfrmsyncdirsdlg.actselectdeleteright.caption msgid "Select for deleting -> (right)" msgstr "" #: tfrmsyncdirsdlg.btnclose.caption msgctxt "tfrmsyncdirsdlg.btnclose.caption" msgid "Close" msgstr "Kapat" #: tfrmsyncdirsdlg.btncompare.caption msgctxt "tfrmsyncdirsdlg.btncompare.caption" msgid "Compare" msgstr "Karşılaştır" #: tfrmsyncdirsdlg.btnseldir1.caption msgctxt "tfrmsyncdirsdlg.btnseldir1.caption" msgid ">>" msgstr ">>" #: tfrmsyncdirsdlg.btnseldir2.caption msgctxt "tfrmsyncdirsdlg.btnseldir2.caption" msgid ">>" msgstr ">>" #: tfrmsyncdirsdlg.btnsynchronize.caption msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption" msgid "Synchronize" msgstr "" #: tfrmsyncdirsdlg.caption msgid "Synchronize directories" msgstr "" #: tfrmsyncdirsdlg.cbextfilter.text msgctxt "tfrmsyncdirsdlg.cbextfilter.text" msgid "*.*" msgstr "*" #: tfrmsyncdirsdlg.chkasymmetric.caption msgid "asymmetric" msgstr "" #: tfrmsyncdirsdlg.chkbycontent.caption msgid "by content" msgstr "" #: tfrmsyncdirsdlg.chkignoredate.caption msgid "ignore date" msgstr "" #: tfrmsyncdirsdlg.chkonlyselected.caption msgid "only selected" msgstr "" #: tfrmsyncdirsdlg.chksubdirs.caption msgid "Subdirs" msgstr "" #: tfrmsyncdirsdlg.groupbox1.caption msgid "Show:" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[0].title.caption #, fuzzy msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption" msgid "Name" msgstr "Adı" #: tfrmsyncdirsdlg.headerdg.columns[1].title.caption #, fuzzy msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption" msgid "Size" msgstr "Boyutu" #: tfrmsyncdirsdlg.headerdg.columns[2].title.caption #, fuzzy msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption" msgid "Date" msgstr "Tarih" #: tfrmsyncdirsdlg.headerdg.columns[3].title.caption msgid "<=>" msgstr "" #: tfrmsyncdirsdlg.headerdg.columns[4].title.caption #, fuzzy msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption" msgid "Date" msgstr "Tarih" #: tfrmsyncdirsdlg.headerdg.columns[5].title.caption #, fuzzy msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption" msgid "Size" msgstr "Boyutu" #: tfrmsyncdirsdlg.headerdg.columns[6].title.caption #, fuzzy msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption" msgid "Name" msgstr "Adı" #: tfrmsyncdirsdlg.label1.caption msgid "(in main window)" msgstr "" #: tfrmsyncdirsdlg.menuitemcompare.caption msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption" msgid "Compare" msgstr "Karşılaştır" #: tfrmsyncdirsdlg.menuitemviewleft.caption msgid "View left" msgstr "" #: tfrmsyncdirsdlg.menuitemviewright.caption msgid "View right" msgstr "" #: tfrmsyncdirsdlg.sbcopyleft.caption msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption" msgid "<" msgstr "<" #: tfrmsyncdirsdlg.sbcopyright.caption msgctxt "tfrmsyncdirsdlg.sbcopyright.caption" msgid ">" msgstr ">" #: tfrmsyncdirsdlg.sbduplicates.caption msgid "duplicates" msgstr "" #: tfrmsyncdirsdlg.sbequal.caption msgid "=" msgstr "" #: tfrmsyncdirsdlg.sbnotequal.caption msgid "!=" msgstr "" #: tfrmsyncdirsdlg.sbsingles.caption msgid "singles" msgstr "" #: tfrmsyncdirsdlg.statusbar1.panels[0].text msgid "Please press \"Compare\" to start" msgstr "" #: tfrmsyncdirsperformdlg.caption msgctxt "tfrmsyncdirsperformdlg.caption" msgid "Synchronize" msgstr "" #: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption msgid "Confirm overwrites" msgstr "" #: tfrmtreeviewmenu.caption msgctxt "tfrmtreeviewmenu.caption" msgid "Tree View Menu" msgstr "" #: tfrmtreeviewmenu.lblsearchingentry.caption msgid "Select your hot directory:" msgstr "" #: tfrmtreeviewmenu.pmicasesensitive.caption msgid "Search is case sensitive" msgstr "" #: tfrmtreeviewmenu.pmifullcollapse.caption msgid "Full collapse" msgstr "" #: tfrmtreeviewmenu.pmifullexpand.caption msgid "Full expand" msgstr "" #: tfrmtreeviewmenu.pmiignoreaccents.caption msgid "Search ignore accents and ligatures" msgstr "" #: tfrmtreeviewmenu.pminotcasesensitive.caption msgid "Search is not case sensitive" msgstr "" #: tfrmtreeviewmenu.pminotignoreaccents.caption msgid "Search is strict regarding accents and ligatures" msgstr "" #: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption msgid "Don't show the branch content \"just\" because the searched string is found in the branche name" msgstr "" #: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption msgid "If searched string is found in a branch name, show the whole branch even if elements don't match" msgstr "" #: tfrmtreeviewmenu.tbcancelandquit.hint msgid "Close Tree View Menu" msgstr "" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint" msgid "Configuration of Tree View Menu" msgstr "" #: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint" msgid "Configuration of Tree View Menu Colors" msgstr "" #: tfrmtweakplugin.btnadd.caption #, fuzzy #| msgid "Add new" msgid "A&dd new" msgstr "Yeni ekle" #: tfrmtweakplugin.btncancel.caption #, fuzzy #| msgid "Cancel" msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION" msgid "&Cancel" msgstr "İptal" #: tfrmtweakplugin.btnchange.caption #, fuzzy #| msgid "Change" msgid "C&hange" msgstr "Değiştir" #: tfrmtweakplugin.btndefault.caption #, fuzzy #| msgid "Default" msgid "De&fault" msgstr "Varsayılan" #: tfrmtweakplugin.btnok.caption #, fuzzy #| msgid "OK" msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION" msgid "&OK" msgstr "TAMAM" #: tfrmtweakplugin.btnremove.caption #, fuzzy #| msgid "Remove" msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION" msgid "&Remove" msgstr "Kaldır" #: tfrmtweakplugin.caption msgctxt "tfrmtweakplugin.caption" msgid "Tweak plugin" msgstr "Ayarlama eklentisi" #: tfrmtweakplugin.cbpk_caps_by_content.caption #, fuzzy #| msgid "Detect archive type by content\"" msgid "De&tect archive type by content" msgstr "Arşiv türü içeriğini algıla" #: tfrmtweakplugin.cbpk_caps_delete.caption #, fuzzy #| msgid "Can delete files" msgid "Can de&lete files" msgstr "Dosyaları silebilirsiniz" #: tfrmtweakplugin.cbpk_caps_encrypt.caption #, fuzzy #| msgid "Supports encryption" msgid "Supports e&ncryption" msgstr "Şifrelemeyexisting archives tfrmtweakplugin.cbpk_existing archive" #: tfrmtweakplugin.cbpk_caps_hide.caption #, fuzzy #| msgid "Show as normal files (hide packer icon)" msgctxt "tfrmtweakplugin.cbpk_caps_hide.caption" msgid "Sho&w as normal files (hide packer icon)" msgstr "Normal dosyalar olarak göster(Sıkıştırıcı simgesini gizle)" #: tfrmtweakplugin.cbpk_caps_mempack.caption #, fuzzy #| msgid "Sho&w as normal files (hide packer icon)" msgctxt "tfrmtweakplugin.cbpk_caps_mempack.caption" msgid "Supports pac&king in memory" msgstr "Normal dosyalar olarak göster(Sıkıştırıcı simgesini gizle)" #: tfrmtweakplugin.cbpk_caps_modify.caption #, fuzzy #| msgid "Supports pac&king in memory" msgid "Can &modify existing archives" msgstr "Bellek içi sıkıştırmayı destekler" #: tfrmtweakplugin.cbpk_caps_multiple.caption #, fuzzy #| msgid "Can &modify exisiting archives" msgid "&Archive can contain multiple files" msgstr "Var olan arşivi değiştirebilirsiniz" #: tfrmtweakplugin.cbpk_caps_new.caption #, fuzzy #| msgid "&Archive can contain multiple files" msgid "Can create new archi&ves" msgstr "Arşiv birden fazla dosya içerebilir" #: tfrmtweakplugin.cbpk_caps_options.caption #, fuzzy #| msgid "Can create new archi&ves" msgid "S&upports the options dialogbox" msgstr "Yeni arşivler oluşturabilirsiniz" #: tfrmtweakplugin.cbpk_caps_searchtext.caption #, fuzzy #| msgid "S&upports the options dialogbox" msgid "Allow searchin&g for text in archives" msgstr "Seçenekler iletişim kutusunu destekler" #: tfrmtweakplugin.lbldescription.caption #, fuzzy #| msgid "Allow searchin&g for text in archives" msgid "&Description:" msgstr "Metin arşivlerinde arama izni verir" #: tfrmtweakplugin.lbldetectstr.caption #, fuzzy #| msgid "&Description:" msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION" msgid "D&etect string:" msgstr "Tanım:" #: tfrmtweakplugin.lblextension.caption #, fuzzy #| msgid "D&etect string:" msgid "&Extension:" msgstr "Dizi algıla:" #: tfrmtweakplugin.lblflags.caption #, fuzzy #| msgid "&Extension:Flags:" msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION" msgid "Flags:" msgstr "Uzantı:Etiketler" #: tfrmtweakplugin.lblname.caption #, fuzzy #| msgid "Name:" msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION" msgid "&Name:" msgstr "Adı:" #: tfrmtweakplugin.lblplugin.caption #, fuzzy #| msgid "Plugin:" msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION" msgid "&Plugin:" msgstr "Eklenti" #: tfrmtweakplugin.lblplugin1.caption #, fuzzy #| msgid "Plugin:" msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION" msgid "&Plugin:" msgstr "Eklenti" #: tfrmviewer.actabout.caption msgctxt "tfrmviewer.actabout.caption" msgid "About Viewer..." msgstr "Görüntüleyici Hakkında" #: tfrmviewer.actabout.hint msgid "Displays the About message" msgstr "" #: tfrmviewer.actchangeencoding.caption msgid "Change encoding" msgstr "" #: tfrmviewer.actcopyfile.caption msgctxt "tfrmviewer.actcopyfile.caption" msgid "Copy File" msgstr "" #: tfrmviewer.actcopyfile.hint msgctxt "tfrmviewer.actcopyfile.hint" msgid "Copy File" msgstr "" #: tfrmviewer.actcopytoclipboard.caption #, fuzzy msgctxt "tfrmviewer.actcopytoclipboard.caption" msgid "Copy To Clipboard" msgstr "Panoya kopyala" #: tfrmviewer.actcopytoclipboardformatted.caption msgid "Copy To Clipboard Formatted" msgstr "" #: tfrmviewer.actdeletefile.caption msgctxt "tfrmviewer.actdeletefile.caption" msgid "Delete File" msgstr "" #: tfrmviewer.actdeletefile.hint msgctxt "tfrmviewer.actdeletefile.hint" msgid "Delete File" msgstr "" #: tfrmviewer.actexitviewer.caption #, fuzzy msgctxt "tfrmviewer.actexitviewer.caption" msgid "E&xit" msgstr "Çıkış" #: tfrmviewer.actfind.caption #, fuzzy msgctxt "tfrmviewer.actfind.caption" msgid "Find" msgstr "Bul" #: tfrmviewer.actfindnext.caption #, fuzzy msgctxt "tfrmviewer.actfindnext.caption" msgid "Find next" msgstr "Sonrakini Bul" #: tfrmviewer.actfindprev.caption msgctxt "tfrmviewer.actfindprev.caption" msgid "Find previous" msgstr "" #: tfrmviewer.actfullscreen.caption #, fuzzy msgctxt "tfrmviewer.actfullscreen.caption" msgid "Full Screen" msgstr "Tam Ekran" #: tfrmviewer.actimagecenter.caption msgctxt "tfrmviewer.actimagecenter.caption" msgid "Center" msgstr "" #: tfrmviewer.actloadnextfile.caption msgctxt "tfrmviewer.actloadnextfile.caption" msgid "&Next" msgstr "&Sonraki" #: tfrmviewer.actloadnextfile.hint msgid "Load Next File" msgstr "" #: tfrmviewer.actloadprevfile.caption msgctxt "tfrmviewer.actloadprevfile.caption" msgid "&Previous" msgstr "&Önceki" #: tfrmviewer.actloadprevfile.hint msgid "Load Previous File" msgstr "" #: tfrmviewer.actmirrorhorz.caption msgid "Mirror Horizontally" msgstr "" #: tfrmviewer.actmirrorhorz.hint #, fuzzy msgctxt "tfrmviewer.actmirrorhorz.hint" msgid "Mirror" msgstr "Yansıt(Aynala)" #: tfrmviewer.actmirrorvert.caption msgid "Mirror Vertically" msgstr "" #: tfrmviewer.actmovefile.caption msgctxt "tfrmviewer.actmovefile.caption" msgid "Move File" msgstr "" #: tfrmviewer.actmovefile.hint msgctxt "tfrmviewer.actmovefile.hint" msgid "Move File" msgstr "" #: tfrmviewer.actpreview.caption #, fuzzy msgctxt "tfrmviewer.actpreview.caption" msgid "Preview" msgstr "Önizleme" #: tfrmviewer.actreload.caption msgctxt "tfrmviewer.actreload.caption" msgid "Reload" msgstr "Güncelle" #: tfrmviewer.actreload.hint msgid "Reload current file" msgstr "" #: tfrmviewer.actrotate180.caption msgctxt "tfrmviewer.actrotate180.caption" msgid "+ 180" msgstr "" #: tfrmviewer.actrotate180.hint msgctxt "tfrmviewer.actrotate180.hint" msgid "Rotate 180 degrees" msgstr "" #: tfrmviewer.actrotate270.caption msgctxt "tfrmviewer.actrotate270.caption" msgid "- 90" msgstr "" #: tfrmviewer.actrotate270.hint msgctxt "tfrmviewer.actrotate270.hint" msgid "Rotate -90 degrees" msgstr "" #: tfrmviewer.actrotate90.caption msgctxt "tfrmviewer.actrotate90.caption" msgid "+ 90" msgstr "" #: tfrmviewer.actrotate90.hint msgctxt "tfrmviewer.actrotate90.hint" msgid "Rotate +90 degrees" msgstr "" #: tfrmviewer.actsave.caption #, fuzzy msgctxt "tfrmviewer.actsave.caption" msgid "Save" msgstr "Kaydet" #: tfrmviewer.actsaveas.caption msgctxt "tfrmviewer.actsaveas.caption" msgid "Save As..." msgstr "Farklı Kaydet ..." #: tfrmviewer.actsaveas.hint msgid "Save File As..." msgstr "" #: tfrmviewer.actscreenshot.caption #, fuzzy msgctxt "tfrmviewer.actscreenshot.caption" msgid "Screenshot" msgstr "Ekran görüntüsü" #: tfrmviewer.actscreenshotdelay3sec.caption msgid "Delay 3 sec" msgstr "" #: tfrmviewer.actscreenshotdelay5sec.caption msgid "Delay 5 sec" msgstr "" #: tfrmviewer.actselectall.caption #, fuzzy msgctxt "tfrmviewer.actselectall.caption" msgid "Select All" msgstr "Tümünü Seç" #: tfrmviewer.actshowasbin.caption #, fuzzy msgctxt "tfrmviewer.actshowasbin.caption" msgid "Show as &Bin" msgstr "Ikili olarak göster&Bin dosyaları[0,1]" #: tfrmviewer.actshowasbook.caption #, fuzzy msgctxt "tfrmviewer.actshowasbook.caption" msgid "Show as B&ook" msgstr "Kitap olarak &göster" #: tfrmviewer.actshowasdec.caption msgid "Show as &Dec" msgstr "" #: tfrmviewer.actshowashex.caption #, fuzzy msgctxt "tfrmviewer.actshowashex.caption" msgid "Show as &Hex" msgstr "&Hex olarak göster(onaltılı sayı sistemi)" #: tfrmviewer.actshowastext.caption #, fuzzy msgctxt "tfrmviewer.actshowastext.caption" msgid "Show as &Text" msgstr "Metin olarak &göster" #: tfrmviewer.actshowaswraptext.caption #, fuzzy msgctxt "tfrmviewer.actshowaswraptext.caption" msgid "Show as &Wrap text" msgstr "Kaydırma metin &olarak göster" #: tfrmviewer.actshowgraphics.caption #, fuzzy msgctxt "tfrmviewer.actshowgraphics.caption" msgid "Graphics" msgstr "Teknik çizim" #: tfrmviewer.actshowplugins.caption #, fuzzy msgctxt "tfrmviewer.actshowplugins.caption" msgid "Plugins" msgstr "Eklentiler" #: tfrmviewer.actstretchimage.caption msgctxt "tfrmviewer.actstretchimage.caption" msgid "Stretch" msgstr "Çek-Düzelt" #: tfrmviewer.actstretchimage.hint msgid "Stretch Image" msgstr "" #: tfrmviewer.actstretchonlylarge.caption msgctxt "tfrmviewer.actstretchonlylarge.caption" msgid "Stretch only large" msgstr "" #: tfrmviewer.actzoom.caption msgid "Zoom" msgstr "" #: tfrmviewer.actzoomin.caption #, fuzzy msgctxt "tfrmviewer.actzoomin.caption" msgid "Zoom In" msgstr "Yakınlaştır" #: tfrmviewer.actzoomout.caption #, fuzzy msgctxt "tfrmviewer.actzoomout.caption" msgid "Zoom Out" msgstr "Uzaklaştır" #: tfrmviewer.btncopyfile.hint msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT" msgid "Copy" msgstr "Kopyala" #: tfrmviewer.btncopyfile1.hint msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT" msgid "Copy" msgstr "Kopyala" #: tfrmviewer.btncuttuimage.hint msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT" msgid "Crop" msgstr "Kırp" #: tfrmviewer.btndeletefile.hint msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT" msgid "Delete" msgstr "&Sil" #: tfrmviewer.btndeletefile1.hint msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT" msgid "Delete" msgstr "&Sil" #: tfrmviewer.btnfullscreen.hint msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT" msgid "Full Screen" msgstr "Tam Ekran" #: tfrmviewer.btngifmove.caption msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION" msgid "||" msgstr "||" #: tfrmviewer.btngiftobmp.caption msgid "S" msgstr "S" #: tfrmviewer.btnhightlight.hint msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT" msgid "Highlight" msgstr "Vurgula" #: tfrmviewer.btnmovefile.hint msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT" msgid "Move" msgstr "Taşı" #: tfrmviewer.btnmovefile1.hint msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT" msgid "Move" msgstr "Taşı" #: tfrmviewer.btnnextgifframe.caption msgid "||>" msgstr "||" #: tfrmviewer.btnpaint.hint msgctxt "TFRMVIEWER.BTNPAINT.HINT" msgid "Paint" msgstr "Boya" #: tfrmviewer.btnprevgifframe.caption msgid "<||" msgstr "<||" #: tfrmviewer.btnredeye.hint msgid "Red Eyes" msgstr "Kırmızı göz" #: tfrmviewer.btnresize.hint msgctxt "TFRMVIEWER.BTNRESIZE.HINT" msgid "Resize" msgstr "Yeniden boyutlandır" #: tfrmviewer.btnundo.hint msgctxt "TFRMVIEWER.BTNUNDO.HINT" msgid "Undo" msgstr "Geri al" #: tfrmviewer.caption msgctxt "tfrmviewer.caption" msgid "Viewer" msgstr "Göster" #: tfrmviewer.cbslideshow.caption msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "Resimleri otomatik olarak sırayla göster(Slayt Gösterisi)" #: tfrmviewer.comboboxpaint.text msgid "Pen" msgstr "Kalem" #: tfrmviewer.comboboxwidth.text msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT" msgid "1" msgstr "1" #: tfrmviewer.gboxhightlight.caption msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION" msgid "Highlight" msgstr "Vurgula" #: tfrmviewer.gboxpaint.caption msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION" msgid "Paint" msgstr "Boya" #: tfrmviewer.gboxslideshow.caption msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION" msgid "Slide Show" msgstr "Resimleri otomatik olarak sırayla göster(Slayt Gösterisi)" #: tfrmviewer.gboxview.caption msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION" msgid "View" msgstr "Göster" #: tfrmviewer.lblhightlight.caption msgid "0x0" msgstr "0x0" #: tfrmviewer.miabout.caption msgctxt "TFRMVIEWER.MIABOUT.CAPTION" msgid "About" msgstr "Hakkında" #: tfrmviewer.midiv1.caption msgctxt "TFRMVIEWER.MIDIV1.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv2.caption msgctxt "TFRMVIEWER.MIDIV2.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv3.caption msgctxt "TFRMVIEWER.MIDIV3.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv4.caption msgctxt "TFRMVIEWER.MIDIV4.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.midiv5.caption msgctxt "TFRMVIEWER.MIDIV5.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.miedit.caption msgctxt "TFRMVIEWER.MIEDIT.CAPTION" msgid "&Edit" msgstr "&Düzenle" #: tfrmviewer.miencoding.caption msgctxt "TFRMVIEWER.MIENCODING.CAPTION" msgid "En&coding" msgstr "&Kodlama" #: tfrmviewer.mifile.caption msgctxt "TFRMVIEWER.MIFILE.CAPTION" msgid "&File" msgstr "&Dosya" #: tfrmviewer.miimage.caption msgid "&Image" msgstr "&Resim" #: tfrmviewer.miprint.caption msgid "Print..." msgstr "Yazdır..." #: tfrmviewer.mirotate.caption msgid "Rotate" msgstr "Döndür" #: tfrmviewer.miscreenshot.caption msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION" msgid "Screenshot" msgstr "Ekran görüntüsü" #: tfrmviewer.miseparator.caption msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION" msgid "-" msgstr "-" #: tfrmviewer.miview.caption msgctxt "TFRMVIEWER.MIVIEW.CAPTION" msgid "&View" msgstr "&Göster" #: tfrmviewer.pmiselectall.caption msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION" msgid "Select All" msgstr "Tümünü Seç" #: tfrmviewoperations.btnstartpause.caption #, fuzzy #| msgid "Start" msgctxt "tfrmviewoperations.btnstartpause.caption" msgid "&Start" msgstr "Başlat" #: tfrmviewoperations.btnstop.caption msgid "S&top" msgstr "" #: tfrmviewoperations.caption #, fuzzy msgctxt "tfrmviewoperations.caption" msgid "File operations" msgstr "Dosya işlemleri" #: tfrmviewoperations.cbalwaysontop.caption msgid "Always on top" msgstr "" #: tfrmviewoperations.lblusedragdrop.caption msgid "&Use \"drag && drop\" to move operations between queues" msgstr "" #: tfrmviewoperations.mnucanceloperation.caption #, fuzzy msgctxt "tfrmviewoperations.mnucanceloperation.caption" msgid "Cancel" msgstr "İptal" #: tfrmviewoperations.mnucancelqueue.caption #, fuzzy msgctxt "tfrmviewoperations.mnucancelqueue.caption" msgid "Cancel" msgstr "İptal" #: tfrmviewoperations.mnunewqueue.caption msgctxt "tfrmviewoperations.mnunewqueue.caption" msgid "New queue" msgstr "" #: tfrmviewoperations.mnuoperationshowdetached.caption msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption" msgid "Show in detached window" msgstr "" #: tfrmviewoperations.mnuputfirstinqueue.caption msgid "Put first in queue" msgstr "" #: tfrmviewoperations.mnuputlastinqueue.caption msgid "Put last in queue" msgstr "" #: tfrmviewoperations.mnuqueue.caption msgctxt "tfrmviewoperations.mnuqueue.caption" msgid "Queue" msgstr "" #: tfrmviewoperations.mnuqueue0.caption msgid "Out of queue" msgstr "" #: tfrmviewoperations.mnuqueue1.caption msgctxt "tfrmviewoperations.mnuqueue1.caption" msgid "Queue 1" msgstr "" #: tfrmviewoperations.mnuqueue2.caption msgctxt "tfrmviewoperations.mnuqueue2.caption" msgid "Queue 2" msgstr "" #: tfrmviewoperations.mnuqueue3.caption msgctxt "tfrmviewoperations.mnuqueue3.caption" msgid "Queue 3" msgstr "" #: tfrmviewoperations.mnuqueue4.caption msgctxt "tfrmviewoperations.mnuqueue4.caption" msgid "Queue 4" msgstr "" #: tfrmviewoperations.mnuqueue5.caption msgctxt "tfrmviewoperations.mnuqueue5.caption" msgid "Queue 5" msgstr "" #: tfrmviewoperations.mnuqueueshowdetached.caption msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption" msgid "Show in detached window" msgstr "" #: tfrmviewoperations.tbpauseall.caption msgid "&Pause all" msgstr "" #: tmultiarchivecopyoperationoptionsui.lblfileexists.caption #, fuzzy #| msgid "When file exists" msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption" msgid "When file exists" msgstr "Dosya mevcutsa" #: twcxarchivecopyoperationoptionsui.lblfileexists.caption #, fuzzy #| msgid "When file exists" msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption" msgid "When file exists" msgstr "Dosya mevcutsa" #: twfxplugincopymoveoperationoptionsui.cbcopytime.caption msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption" msgid "Copy d&ate/time" msgstr "" #: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption msgid "Work in background (separate connection)" msgstr "" #: twfxplugincopymoveoperationoptionsui.lblfileexists.caption msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION" msgid "When file exists" msgstr "Dosya mevcutsa" #: uexifreader.rsdatetimeoriginal msgid "Date taken" msgstr "" #: uexifreader.rsimageheight #, fuzzy msgctxt "uexifreader.rsimageheight" msgid "Height" msgstr "Yükseklik" #: uexifreader.rsimagewidth #, fuzzy msgctxt "uexifreader.rsimagewidth" msgid "Width" msgstr "Genişlik" #: uexifreader.rsmake msgid "Manufacturer" msgstr "" #: uexifreader.rsmodel msgid "Camera model" msgstr "" #: uexifreader.rsorientation msgid "Orientation" msgstr "" #: ulng.msgtrytolocatecrcfile msgid "" "This file cannot be found and could help to validate final combination of files:\n" "%s\n" "\n" "Could you make it available and press \"OK\" when ready,\n" "or press \"CANCEL\" to continue without it?\n" msgstr "" #: ulng.rscancelfilter msgid "Cancel Quick Filter" msgstr "" #: ulng.rscanceloperation msgid "Cancel Current Operation" msgstr "" #: ulng.rscaptionforaskingfilename msgid "Enter filename, with extension, for dropped text" msgstr "" #: ulng.rscaptionfortextformattoimport msgid "Text format to import" msgstr "" #: ulng.rschecksumverifybroken msgid "Broken:" msgstr "" #: ulng.rschecksumverifygeneral msgid "General:" msgstr "" #: ulng.rschecksumverifymissing msgid "Missing:" msgstr "" #: ulng.rschecksumverifyreaderror msgid "Read error:" msgstr "" #: ulng.rschecksumverifysuccess msgid "Success:" msgstr "" #: ulng.rschecksumverifytext msgid "Enter checksum and select algorithm:" msgstr "" #: ulng.rschecksumverifytitle msgid "Verify checksum" msgstr "" #: ulng.rschecksumverifytotal msgid "Total:" msgstr "" #: ulng.rsclearfiltersornot msgid "Do you want to clear filters for this new search?" msgstr "" #: ulng.rsclipboardcontainsinvalidtoolbardata msgid "Clipboard doesn't contain any valid toolbar data." msgstr "" #: ulng.rscmdcategorylistinorder msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log" msgstr "" #: ulng.rscmdkindofsort msgid "Legacy sorted;A-Z sorted" msgstr "" #: ulng.rscolattr msgid "Attr" msgstr "Öznitelik" #: ulng.rscoldate msgctxt "ulng.rscoldate" msgid "Date" msgstr "Tarih" #: ulng.rscolext msgid "Ext" msgstr "Dahili" #: ulng.rscolname msgctxt "ulng.rscolname" msgid "Name" msgstr "Adı" #: ulng.rscolsize msgctxt "ulng.rscolsize" msgid "Size" msgstr "Boyutu" #: ulng.rsconfcolalign msgid "Align" msgstr "Hizala" #: ulng.rsconfcolcaption msgid "Caption" msgstr "Altbaşlık" #: ulng.rsconfcoldelete msgctxt "ulng.rsconfcoldelete" msgid "Delete" msgstr "&Sil" #: ulng.rsconfcolfieldcont msgid "Field contents" msgstr "Alan içeriği" #: ulng.rsconfcolmove msgctxt "ulng.rsconfcolmove" msgid "Move" msgstr "Taşı" #: ulng.rsconfcolwidth msgctxt "ulng.rsconfcolwidth" msgid "Width" msgstr "Genişlik" #: ulng.rsconfcustheader msgid "Customize column" msgstr "Sütunları Özelleştir" #: ulng.rsconfigurationfileassociation msgid "Configure file association" msgstr "" #: ulng.rsconfirmexecution msgid "Confirming command line and parameters" msgstr "" #: ulng.rscopynametemplate msgid "Copy (%d) %s" msgstr "Kopyala (%d) %s" #: ulng.rsdefaultimporteddctoolbarhint msgid "Imported DC toolbar" msgstr "" #: ulng.rsdefaultimportedtctoolbarhint msgid "Imported TC toolbar" msgstr "" #: ulng.rsdefaultsuffixdroppedtext msgid "_DroppedText" msgstr "" #: ulng.rsdefaultsuffixdroppedtexthtmlfilename msgid "_DroppedHTMLtext" msgstr "" #: ulng.rsdefaultsuffixdroppedtextrichtextfilename msgid "_DroppedRichtext" msgstr "" #: ulng.rsdefaultsuffixdroppedtextsimplefilename msgid "_DroppedSimpleText" msgstr "" #: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename msgid "_DroppedUnicodeUTF16text" msgstr "" #: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename msgid "_DroppedUnicodeUTF8text" msgstr "" #: ulng.rsdiffadds msgid " Adds: " msgstr "" #: ulng.rsdiffdeletes msgid " Deletes: " msgstr "" #: ulng.rsdifffilesidentical msgid "The two files are identical!" msgstr "" #: ulng.rsdiffmatches msgid " Matches: " msgstr "" #: ulng.rsdiffmodifies msgid " Modifies: " msgstr "" #: ulng.rsdlgbuttonabort msgid "Ab&ort" msgstr "Iptal &et" #: ulng.rsdlgbuttonall msgctxt "ulng.rsdlgbuttonall" msgid "A&ll" msgstr "&Tümü" #: ulng.rsdlgbuttonappend msgid "A&ppend" msgstr "&Ekle" #: ulng.rsdlgbuttonautorenamesource msgid "A&uto-rename source files" msgstr "" #: ulng.rsdlgbuttoncancel msgctxt "ulng.rsdlgbuttoncancel" msgid "&Cancel" msgstr "&İptal" #: ulng.rsdlgbuttoncompare msgid "Compare &by content" msgstr "" #: ulng.rsdlgbuttoncontinue msgid "&Continue" msgstr "" #: ulng.rsdlgbuttoncopyinto #, fuzzy #| msgid "Copy &Into" msgid "&Merge" msgstr "İçine &koplaya" #: ulng.rsdlgbuttoncopyintoall #, fuzzy #| msgid "Copy Into &All" msgid "Mer&ge All" msgstr "Hepsini içine &kopyala" #: ulng.rsdlgbuttonexitprogram msgid "E&xit program" msgstr "" #: ulng.rsdlgbuttonignore msgid "Ig&nore" msgstr "" #: ulng.rsdlgbuttonignoreall msgid "I&gnore All" msgstr "" #: ulng.rsdlgbuttonno msgid "&No" msgstr "&Hayır" #: ulng.rsdlgbuttonnone msgid "Non&e" msgstr "&Hiçbiri" #: ulng.rsdlgbuttonok msgctxt "ulng.rsdlgbuttonok" msgid "&OK" msgstr "&TAMAM" #: ulng.rsdlgbuttonother msgid "Ot&her" msgstr "" #: ulng.rsdlgbuttonoverwrite msgid "&Overwrite" msgstr "&Üzerine yaz" #: ulng.rsdlgbuttonoverwriteall msgid "Overwrite &All" msgstr "Tüm dosyaların &üzerine yaz" #: ulng.rsdlgbuttonoverwritelarger msgid "Overwrite All &Larger" msgstr "" #: ulng.rsdlgbuttonoverwriteolder msgid "Overwrite All Ol&der" msgstr "" #: ulng.rsdlgbuttonoverwritesmaller msgid "Overwrite All S&maller" msgstr "" #: ulng.rsdlgbuttonrename #, fuzzy #| msgid "Rename" msgctxt "ulng.rsdlgbuttonrename" msgid "R&ename" msgstr "Yeniden Adlandır" #: ulng.rsdlgbuttonresume msgid "&Resume" msgstr "" #: ulng.rsdlgbuttonretry msgid "Re&try" msgstr "&Yeniden dene" #: ulng.rsdlgbuttonretryadmin msgid "As Ad&ministrator" msgstr "" #: ulng.rsdlgbuttonskip msgid "&Skip" msgstr "&Atla" #: ulng.rsdlgbuttonskipall msgid "S&kip All" msgstr "Tümünü &Atla" #: ulng.rsdlgbuttonyes msgid "&Yes" msgstr "&Evet" #: ulng.rsdlgcp msgctxt "ulng.rsdlgcp" msgid "Copy file(s)" msgstr "Dosya(ları) Kopyala" #: ulng.rsdlgmv msgid "Move file(s)" msgstr "Dosya(ları) Taşı" #: ulng.rsdlgoppause #, fuzzy #| msgid "Pause" msgctxt "ulng.rsdlgoppause" msgid "Pau&se" msgstr "Duraklat" #: ulng.rsdlgopstart #, fuzzy #| msgid "Start" msgctxt "ulng.rsdlgopstart" msgid "&Start" msgstr "Başlat" #: ulng.rsdlgqueue msgctxt "ulng.rsdlgqueue" msgid "Queue" msgstr "" #: ulng.rsdlgspeed msgid "Speed %s/s" msgstr "Hız %s/s" #: ulng.rsdlgspeedtime msgid "Speed %s/s, time remaining %s" msgstr "Hız %s/s, kalan süre %s" #: ulng.rsdraganddroptextformat msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format" msgstr "" #: ulng.rsdrivenolabel msgid "" msgstr "" #: ulng.rsdrivenomedia msgid "" msgstr "" #: ulng.rseditabouttext msgid "Internal Editor of Double Commander." msgstr "Double Commander İç metin editörü" #: ulng.rseditgotolinequery msgid "Goto line:" msgstr "" #: ulng.rseditgotolinetitle msgctxt "ulng.rseditgotolinetitle" msgid "Goto Line" msgstr "" #: ulng.rseditnewfile msgid "new.txt" msgstr "Yeni.txt" #: ulng.rseditnewfilename msgid "Filename:" msgstr "Dosyaadı:" #: ulng.rseditnewopen msgid "Open file" msgstr "Dosya aç" #: ulng.rseditsearchback msgid "&Backward" msgstr "&Geri" #: ulng.rseditsearchcaption msgctxt "ulng.rseditsearchcaption" msgid "Search" msgstr "Ara" #: ulng.rseditsearchfrw msgid "&Forward" msgstr "&İleri" #: ulng.rseditsearchreplace msgctxt "ulng.rseditsearchreplace" msgid "Replace" msgstr "Değiştir" #: ulng.rseditwithexternaleditor msgid "with external editor" msgstr "" #: ulng.rseditwithinternaleditor msgid "with internal editor" msgstr "" #: ulng.rsexecuteviashell msgctxt "ulng.rsexecuteviashell" msgid "Execute via shell" msgstr "" #: ulng.rsexecuteviaterminalclose msgctxt "ulng.rsexecuteviaterminalclose" msgid "Execute via terminal and close" msgstr "" #: ulng.rsexecuteviaterminalstayopen msgctxt "ulng.rsexecuteviaterminalstayopen" msgid "Execute via terminal and stay open" msgstr "" #: ulng.rsfavtabspanelsideselection msgid "Left;Right;Active;Inactive;Both;None" msgstr "" #: ulng.rsfavtabssavedirhistory msgid "No;Yes" msgstr "" #: ulng.rsfilenameexportedtcbarprefix msgid "Exported_from_DC" msgstr "" #: ulng.rsfileopdirectoryexistsoptions msgid "Ask;Merge;Skip" msgstr "" #: ulng.rsfileopfileexistsoptions msgid "Ask;Overwrite;Overwrite Older;Skip" msgstr "" #: ulng.rsfileopsetpropertyerroroptions msgid "Ask;Don't set anymore;Ignore errors" msgstr "" #: ulng.rsfilterstatus msgid "FILTER" msgstr "Süzgeç" #: ulng.rsfinddefinetemplate msgid "Define template" msgstr "Şablonu tanımla" #: ulng.rsfinddepth msgid "%s level(s)" msgstr "%s Seviye(ler)" #: ulng.rsfinddepthall msgid "all (unlimited depth)" msgstr "Tüm (sınırsız derinlik)" #: ulng.rsfinddepthcurdir msgid "current dir only" msgstr "Yalnızca geçerli dizin" #: ulng.rsfinddirnoex msgid "Directory %s does not exist!" msgstr "Dizin %s mevcut değil!" #: ulng.rsfindfound msgid "Found: %d" msgstr "Bulundu: %d" #: ulng.rsfindsavetemplatecaption msgid "Save search template" msgstr "Arama Şablonunu Kaydet" #: ulng.rsfindsavetemplatetitle msgid "Template name:" msgstr "Şablon adı" #: ulng.rsfindscanned msgid "Scanned: %d" msgstr "Taranan: %d" #: ulng.rsfindscanning msgid "Scanning" msgstr "Tara" #: ulng.rsfindsearchfiles msgctxt "ulng.rsfindsearchfiles" msgid "Find files" msgstr "Dosyaları bul" #: ulng.rsfindtimeofscan msgid "Time of scan: " msgstr "" #: ulng.rsfindwherebeg msgid "Begin at" msgstr "Başlayın" #: ulng.rsfreemsg msgid "Free %s from %s bytes" msgstr "%sBayt %s içermez" #: ulng.rsfreemsgshort msgid "%s bytes free" msgstr "%s boş bayt" #: ulng.rsfuncatime msgid "Access date/time" msgstr "Tarih/saat Erişimi" #: ulng.rsfuncattr msgctxt "ulng.rsfuncattr" msgid "Attributes" msgstr "Öznitelikleri" #: ulng.rsfunccomment msgid "Comment" msgstr "Açıklama" #: ulng.rsfunccompressedsize msgid "Compressed size" msgstr "" #: ulng.rsfuncctime msgid "Creation date/time" msgstr "Tarih/saat oluştur" #: ulng.rsfuncext msgid "Extension" msgstr "Uzantı" #: ulng.rsfuncgroup msgctxt "ulng.rsfuncgroup" msgid "Group" msgstr "Grup" #: ulng.rsfunchtime msgid "Change date/time" msgstr "" #: ulng.rsfunclinkto msgid "Link to" msgstr "Bağlantı" #: ulng.rsfuncmtime msgid "Modification date/time" msgstr "Tarih/saat Son değiştirilme tarihi" #: ulng.rsfuncname msgctxt "ulng.rsfuncname" msgid "Name" msgstr "Adı" #: ulng.rsfuncnamenoext msgid "Name without extension" msgstr "Adı, uzantısı hariç" #: ulng.rsfuncowner msgctxt "ulng.rsfuncowner" msgid "Owner" msgstr "Sahibi" #: ulng.rsfuncpath msgctxt "ulng.rsfuncpath" msgid "Path" msgstr "Yol" #: ulng.rsfuncsize msgctxt "ulng.rsfuncsize" msgid "Size" msgstr "Boyut" #: ulng.rsfunctype msgid "Type" msgstr "Türü" #: ulng.rsharderrcreate msgid "Error creating hardlink." msgstr "Sabit bağlantı oluşturma hatası." #: ulng.rshotdirforcesortingorderchoices msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9" msgstr "" #: ulng.rshotdirwarningabortrestorebackup msgid "" "Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n" "\n" "Are you sure you want to proceed?\n" msgstr "" #: ulng.rshotkeycategorycopymovedialog msgid "Copy/Move Dialog" msgstr "" #: ulng.rshotkeycategorydiffer msgctxt "ulng.rshotkeycategorydiffer" msgid "Differ" msgstr "Karşılaştır" #: ulng.rshotkeycategoryeditcommentdialog msgid "Edit Comment Dialog" msgstr "" #: ulng.rshotkeycategoryeditor #, fuzzy msgctxt "ulng.rshotkeycategoryeditor" msgid "Editor" msgstr "Düzenleyici" #: ulng.rshotkeycategoryfindfiles #, fuzzy msgctxt "ulng.rshotkeycategoryfindfiles" msgid "Find files" msgstr "Dosyaları bul" #: ulng.rshotkeycategorymain msgid "Main" msgstr "" #: ulng.rshotkeycategorysyncdirs msgid "Synchronize Directories" msgstr "" #: ulng.rshotkeycategoryviewer msgctxt "ulng.rshotkeycategoryviewer" msgid "Viewer" msgstr "Göster" #: ulng.rshotkeyfilealreadyexists msgid "" "A setup with that name already exists.\n" "Do you want to overwrite it?\n" msgstr "" #: ulng.rshotkeyfileconfirmdefault msgid "Are you sure you want to restore default?" msgstr "" #: ulng.rshotkeyfileconfirmerasure msgid "Are you sure you want to erase setup \"%s\"?" msgstr "" #: ulng.rshotkeyfilecopyof msgid "Copy of %s" msgstr "" #: ulng.rshotkeyfileinputnewname msgid "Input your new name" msgstr "" #: ulng.rshotkeyfilemustkeepone msgid "You must keep at least one shortcut file." msgstr "" #: ulng.rshotkeyfilenewname msgid "New name" msgstr "" #: ulng.rshotkeyfilesavemodified msgid "" "\"%s\" setup has been modified.\n" "Do you want to save it now?\n" msgstr "" #: ulng.rshotkeynoscenter msgid "No shortcut with \"ENTER\"" msgstr "" #: ulng.rshotkeysortorder msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)" msgstr "" #: ulng.rsimporttoolbarproblem msgid "Cannot find reference to default bar file" msgstr "" #: ulng.rslistoffindfileswindows msgid "List of \"Find files\" windows" msgstr "" #: ulng.rsmarkminus msgid "Unselect mask" msgstr "Maske seçimini kaldır" #: ulng.rsmarkplus msgid "Select mask" msgstr "Maske seç" #: ulng.rsmaskinput msgid "Input mask:" msgstr "Make girişi:" #: ulng.rsmenuconfigurecolumnsalreadyexists msgid "A columns view with that name already exists." msgstr "" #: ulng.rsmenuconfigurecolumnssavetochange msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one" msgstr "" #: ulng.rsmenuconfigurecustomcolumns msgid "Configure custom columns" msgstr "Özel sütunları yapılandır" #: ulng.rsmenuconfigureentercustomcolumnname msgid "Enter new custom columns name" msgstr "" #: ulng.rsmnuactions msgctxt "ulng.rsmnuactions" msgid "Actions" msgstr "Eylemler" #: ulng.rsmnucontentdefault msgid "" msgstr "" #: ulng.rsmnucontentoctal msgid "Octal" msgstr "" #: ulng.rsmnucopynetnamestoclip msgid "Copy names with UNC path" msgstr "" #: ulng.rsmnudisconnectnetworkdrive msgid "Disconnect Network Drive..." msgstr "" #: ulng.rsmnuedit msgctxt "ulng.rsmnuedit" msgid "Edit" msgstr "Düzenle" #: ulng.rsmnueject msgid "Eject" msgstr "Çıkar" #: ulng.rsmnuextracthere msgid "Extract here..." msgstr "" #: ulng.rsmnumapnetworkdrive msgid "Map Network Drive..." msgstr "" #: ulng.rsmnumount msgid "Mount" msgstr "Monte et" #: ulng.rsmnunew msgctxt "ulng.rsmnunew" msgid "New" msgstr "Yeni" #: ulng.rsmnunomedia msgid "No media available" msgstr "Kullanılabilir ortam yok" #: ulng.rsmnuopen #, fuzzy msgctxt "ulng.rsmnuopen" msgid "Open" msgstr "Açık" #: ulng.rsmnuopenwith #, fuzzy #| msgid "Open with ..." msgid "Open with" msgstr "Birlikte aç..." #: ulng.rsmnuopenwithother msgctxt "ulng.rsmnuopenwithother" msgid "Other..." msgstr "" #: ulng.rsmnupackhere msgid "Pack here..." msgstr "" #: ulng.rsmnusortby msgid "Sort by" msgstr "Şuna Göre Sırala" #: ulng.rsmnuumount msgid "Unmount" msgstr "Kaldır" #: ulng.rsmnuview msgctxt "ulng.rsmnuview" msgid "View" msgstr "Göster" #: ulng.rsmsgaccount msgid "Account:" msgstr "Hesap:" #: ulng.rsmsgalldcintcmds msgid "All Double Commander internal commands" msgstr "" #: ulng.rsmsgarchivercustomparams msgid "Additional parameters for archiver command-line:" msgstr "Arşiv komut satırı için ek değişkenler:" #: ulng.rsmsgaskquoteornot msgid "Do you want to enclose between quotes?" msgstr "" #: ulng.rsmsgbadcrc32 msgid "" "Bad CRC32 for resulting file:\n" "\"%s\"\n" "\n" "Do you want to keep the resulting corrupted file anyway?\n" msgstr "" #: ulng.rsmsgcannotcopymoveitself #, fuzzy #| msgid "You can not copy/move a file \"%s\"to itself!\"" msgid "You can not copy/move a file \"%s\" to itself!" msgstr "Dosyayı \"kendisine!\" kopyalayamaz/taşıyamazsınız\"%s\"" #: ulng.rsmsgcannotdeletedirectory msgid "Cannot delete directory %s" msgstr "" #: ulng.rsmsgcannotoverwritedirectory msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\"" msgstr "" #: ulng.rsmsgchdirfailed msgid "ChDir to [%s] failed!" msgstr "Dizin değişikliği [%s]başarısız oldu!" #: ulng.rsmsgcloseallinactivetabs msgid "Remove all inactive tabs?" msgstr "Tüm etkin olmayan sekmeler kaldırılsın mı?" #: ulng.rsmsgcloselockedtab msgid "This tab (%s) is locked! Close anyway?" msgstr "Bu sekme (%s) kilitli! Yine de kapatılsın mı?" #: ulng.rsmsgcofirmuserparam msgid "Confirmation of parameter" msgstr "" #: ulng.rsmsgconfirmquit msgid "Are you sure you want to quit?" msgstr "Çıkmak istediğinizden emin misiniz?" #: ulng.rsmsgcopybackward msgid "The file %s has changed. Do you want to copy it backward?" msgstr "" #: ulng.rsmsgcouldnotcopybackward msgid "Could not copy backward - do you want to keep the changed file?" msgstr "" #: ulng.rsmsgcpfldr msgid "Copy %d selected files/directories?" msgstr "Seçilen %d dosyalar/dizinleri kopyala?" #: ulng.rsmsgcpsel msgid "Copy selected \"%s\"?" msgstr "Kopyalanacakları\"%s\"seç?" #: ulng.rsmsgcreateanewfiletype msgid "< Create a new file type \"%s files\" >" msgstr "" #: ulng.rsmsgdctoolbarwheretosave msgid "Enter location and filename where to save a DC Toolbar file" msgstr "" #: ulng.rsmsgdefaultcustomactionname msgid "Custom action" msgstr "" #: ulng.rsmsgdeletepartiallycopied msgid "Delete the partially copied file ?" msgstr "" #: ulng.rsmsgdelfldr msgid "Delete %d selected files/directories?" msgstr "Seçili %d dosyaları/dizinleri sil ?" #: ulng.rsmsgdelfldrt #, fuzzy #| msgid "Delete %d selected files/directories into trash can?\"" msgid "Delete %d selected files/directories into trash can?" msgstr "seçilen %d dosyaları/dizinleri çöp kutusuna at?" #: ulng.rsmsgdelsel msgid "Delete selected \"%s\"?" msgstr "Seçilenleri sil \"%s\"?" #: ulng.rsmsgdelselt msgid "Delete selected \"%s\" into trash can?" msgstr "Seçilenleri sil\"%s\" çöp kutusuna at?" #: ulng.rsmsgdeltotrashforce msgid "Can not delete \"%s\" to trash! Delete directly?" msgstr "Çöp kutusuna\"%s\" atılamıyor! Doğrudan sil?" #: ulng.rsmsgdisknotavail msgid "Disk is not available" msgstr "Sürücü kullanılamıyo" #: ulng.rsmsgentercustomaction msgid "Enter custom action name:" msgstr "" #: ulng.rsmsgenterfileext msgid "Enter file extension:" msgstr "Dosya uzantısını girin:" #: ulng.rsmsgentername msgid "Enter name:" msgstr "Adını girin:" #: ulng.rsmsgenternewfiletypename msgid "Enter name of new file type to create for extension \"%s\"" msgstr "" #: ulng.rsmsgerrbadarchive msgid "CRC error in archive data" msgstr "Arşiv verisinde CRC hatası" #: ulng.rsmsgerrbaddata msgid "Data is bad" msgstr "Veri kötü" #: ulng.rsmsgerrcannotconnect msgid "Can not connect to server: \"%s\"" msgstr "Sunucuya bağlanamıyor \"%s\"" #: ulng.rsmsgerrcannotcopyfile msgid "Cannot copy file %s to %s" msgstr "Dosya %s kopyalanamıyor %s" #: ulng.rsmsgerrcreatefiledirectoryexists #, fuzzy,badformat msgid "There already exists a directory named \"%s\"." msgstr "Orada zaten o adda bir dizin var" #: ulng.rsmsgerrdatenotsupported msgid "Date %s is not supported" msgstr "Tarih %s desteklenmiyor" #: ulng.rsmsgerrdirexists msgid "Directory %s exists!" msgstr "Dizin %s zaten var!" #: ulng.rsmsgerreaborted msgid "Function aborted by user" msgstr "İşlev kullanıcı tarafından iptal edildi" #: ulng.rsmsgerreclose msgid "Error closing file" msgstr "Dosya kapatma hatası" #: ulng.rsmsgerrecreate msgid "Cannot create file" msgstr "Dosya oluşturulamıyor" #: ulng.rsmsgerrendarchive msgid "No more files in archive" msgstr "Daha fazla arşiv dosyası yok" #: ulng.rsmsgerreopen msgid "Cannot open existing file" msgstr "Varolan dosyayı açamıyor" #: ulng.rsmsgerreread msgid "Error reading from file" msgstr "Dosya okuma hatası" #: ulng.rsmsgerrewrite msgid "Error writing to file" msgstr "Dosya yazma hatası" #: ulng.rsmsgerrforcedir msgid "Can not create directory %s!" msgstr "Dizin oluşturulamıyor %s!" #: ulng.rsmsgerrinvalidlink msgid "Invalid link" msgstr "Geçersiz bağlantı" #: ulng.rsmsgerrnofiles msgid "No files found" msgstr "Dosya bulunamadı" #: ulng.rsmsgerrnomemory msgid "Not enough memory" msgstr "Yeterli bellek yok" #: ulng.rsmsgerrnotsupported msgid "Function not supported!" msgstr "İşlev desteklenmiyor!" #: ulng.rsmsgerrorincontextmenucommand msgid "Error in context menu command" msgstr "" #: ulng.rsmsgerrorloadingconfiguration msgid "Error when loading configuration" msgstr "" #: ulng.rsmsgerrregexpsyntax msgid "Syntax error in regular expression!" msgstr "Syntax(Sözdizim)-normal ifadede hata!" #: ulng.rsmsgerrrename msgid "Cannot rename file %s to %s" msgstr "Dosya yeniden %s adlandırılamıyor %s" #: ulng.rsmsgerrsaveassociation msgid "Can not save association!" msgstr "" #: ulng.rsmsgerrsavefile msgid "Cannot save file" msgstr "Dosya kaydedilemiyor" #: ulng.rsmsgerrsetattribute msgid "Can not set attributes for \"%s\"" msgstr "Öznitelikleri ayarlanabilir değil \"%s\"" #: ulng.rsmsgerrsetdatetime msgid "Can not set date/time for \"%s\"" msgstr "Tarih/saat ayarlanabilir değil \"%s\"" #: ulng.rsmsgerrsetownership msgid "Can not set owner/group for \"%s\"" msgstr "" #: ulng.rsmsgerrsetpermissions msgid "Can not set permissions for \"%s\"" msgstr "" #: ulng.rsmsgerrsmallbuf msgid "Buffer too small" msgstr "Arabellek çok küçük" #: ulng.rsmsgerrtoomanyfiles msgid "Too many files to pack" msgstr "Sıkıştırma için dosya miktarı çok fazla " #: ulng.rsmsgerrunknownformat msgid "Archive format unknown" msgstr "Arşiv biçimi bilinmiyor" #: ulng.rsmsgfavoritetabsdeleteallentries msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)" msgstr "" #: ulng.rsmsgfavoritetabsdraghereentry msgid "Drag here other entries" msgstr "" #: ulng.rsmsgfavoritetabsentername msgid "Enter a name this Favorite Tabs entry" msgstr "" #: ulng.rsmsgfavoritetabsenternametitle msgid "Saving a new Favorite Tabs entry" msgstr "" #: ulng.rsmsgfavoritetabsexportedsuccessfully msgid "Number of Favorite Tabs exported successfully: %d on %d" msgstr "" #: ulng.rsmsgfavoritetabsextramode msgid "Default extra setting for save dir history for new Favorite Tabs:" msgstr "" #: ulng.rsmsgfavoritetabsimportedsuccessfully msgid "Number of file(s) imported successfully: %d on %d" msgstr "" #: ulng.rsmsgfavoritetabsimportsubmenuname msgid "Legacy tabs imported" msgstr "" #: ulng.rsmsgfavoritetabsimporttitle msgid "Select .tab file(s) to import (could be more than one at the time!)" msgstr "" #: ulng.rsmsgfavoritetabsmodifiednoimport msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?" msgstr "" #: ulng.rsmsgfavoritetabssimplemode msgctxt "ulng.rsmsgfavoritetabssimplemode" msgid "Keep saving dir history with Favorite Tabs:" msgstr "" #: ulng.rsmsgfavoritetabssubmenuname msgctxt "ulng.rsmsgfavoritetabssubmenuname" msgid "Submenu name" msgstr "" #: ulng.rsmsgfavoritetabsthiswillloadfavtabs msgid "This will load the Favorite Tabs: \"%s\"" msgstr "" #: ulng.rsmsgfavortietabssaveoverexisting msgid "Save current tabs over existing Favorite Tabs entry" msgstr "" #: ulng.rsmsgfilechangedsave msgid "File %s changed, save?" msgstr "Dosya %s değişikliğini,kaydet?" #: ulng.rsmsgfileexistsfileinfo msgid "%s bytes, %s" msgstr "" #: ulng.rsmsgfileexistsoverwrite msgid "Overwrite:" msgstr "" #: ulng.rsmsgfileexistsrwrt msgid "File %s exists, overwrite?" msgstr "Dosya %s zaten var üzerine yazılsın mı?" #: ulng.rsmsgfileexistswithfile msgid "With file:" msgstr "" #: ulng.rsmsgfilenotfound msgid "File \"%s\" not found." msgstr "" #: ulng.rsmsgfileoperationsactive msgid "File operations active" msgstr "Dosya işlemleri etkin" #: ulng.rsmsgfileoperationsactivelong msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss." msgstr "Bazı dosya işlemleri henüz bitmiş değil .Double Commander´ın kapatılması veri kaybına neden olabilir!" #: ulng.rsmsgfilepathovermaxpath msgid "" "The target name length (%d) is more than %d characters!\n" "%s\n" "Most programs will not be able to access a file/directory with such a long name!\n" msgstr "" #: ulng.rsmsgfilereadonly #, fuzzy #| msgid "File %s is marked as read-only. Delete it?" msgid "File %s is marked as read-only/hidden/system. Delete it?" msgstr "Dosya %s salt okunur olarak işaretlenmiş. Silinsin mi?" #: ulng.rsmsgfilereloadwarning msgid "Are you sure you want to reload the current file and lose the changes?" msgstr "" #: ulng.rsmsgfilesizetoobig msgid "The file size of \"%s\" is too big for destination file system!" msgstr "Dosya boyutu \"%s\" hedef dosya sistemi için çok büyük!" #: ulng.rsmsgfolderexistsrwrt #, fuzzy #| msgid "Folder %s exists, overwrite?" msgid "Folder %s exists, merge?" msgstr "Klasör %s zaten var, üzerine yazılsın mı?" #: ulng.rsmsgfollowsymlink msgid "Follow symlink \"%s\"?" msgstr "Sembolik bağlantıyı izle\"%s\"?" #: ulng.rsmsgfortextformattoimport msgid "Select the text format to import" msgstr "" #: ulng.rsmsghotdiraddselecteddirectories msgid "Add %d selected dirs" msgstr "" #: ulng.rsmsghotdiraddselecteddirectory msgid "Add selected dir: " msgstr "" #: ulng.rsmsghotdiraddthisdirectory msgid "Add current dir: " msgstr "" #: ulng.rsmsghotdircommandname msgid "Do command" msgstr "" #: ulng.rsmsghotdircommandsample msgid "cm_somthing" msgstr "" #: ulng.rsmsghotdirconfighotlist msgctxt "ulng.rsmsghotdirconfighotlist" msgid "Configuration of Directory Hotlist" msgstr "" #: ulng.rsmsghotdirdeleteallentries msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)" msgstr "" #: ulng.rsmsghotdirdemocommand msgid "This will execute the following command:" msgstr "" #: ulng.rsmsghotdirdemoname msgid "This is hot dir named " msgstr "" #: ulng.rsmsghotdirdemopath msgid "This will change active frame to the following path:" msgstr "" #: ulng.rsmsghotdirdemotarget msgid "And inactive frame would change to the following path:" msgstr "" #: ulng.rsmsghotdirerrorbackuping msgid "Error backuping entries..." msgstr "" #: ulng.rsmsghotdirerrorexporting msgid "Error exporting entries..." msgstr "" #: ulng.rsmsghotdirexportall msgid "Export all!" msgstr "" #: ulng.rsmsghotdirexporthotlist msgid "Export Directory Hotlist - Select the entries you want to export" msgstr "" #: ulng.rsmsghotdirexportsel msgid "Export selected" msgstr "" #: ulng.rsmsghotdirimportall msgctxt "ulng.rsmsghotdirimportall" msgid "Import all!" msgstr "" #: ulng.rsmsghotdirimporthotlist msgid "Import Directory Hotlist - Select the entries you want to import" msgstr "" #: ulng.rsmsghotdirimportsel msgctxt "ulng.rsmsghotdirimportsel" msgid "Import selected" msgstr "" #: ulng.rsmsghotdirjustpath msgctxt "ulng.rsmsghotdirjustpath" msgid "&Path:" msgstr "Yol" #: ulng.rsmsghotdirlocatehotlistfile msgid "Locate \".hotlist\" file to import" msgstr "" #: ulng.rsmsghotdirname msgid "Hotdir name" msgstr "" #: ulng.rsmsghotdirnbnewentries msgid "Number of new entries: %d" msgstr "" #: ulng.rsmsghotdirnothingtoexport msgid "Nothing selected to export!" msgstr "" #: ulng.rsmsghotdirpath msgid "Hotdir path" msgstr "" #: ulng.rsmsghotdirreaddselecteddirectory msgid "Re-Add selected dir: " msgstr "" #: ulng.rsmsghotdirreaddthisdirectory msgid "Re-Add current dir: " msgstr "" #: ulng.rsmsghotdirrestorewhat msgid "Enter location and filename of Directory Hotlist to restore" msgstr "" #: ulng.rsmsghotdirsimplecommand #, fuzzy msgctxt "ulng.rsmsghotdirsimplecommand" msgid "Command:" msgstr "Komut:" #: ulng.rsmsghotdirsimpleendofmenu msgctxt "ulng.rsmsghotdirsimpleendofmenu" msgid "(end of sub menu)" msgstr "" #: ulng.rsmsghotdirsimplemenu msgctxt "ulng.rsmsghotdirsimplemenu" msgid "Menu &name:" msgstr "" #: ulng.rsmsghotdirsimplename msgctxt "ulng.rsmsghotdirsimplename" msgid "&Name:" msgstr "Adı:" #: ulng.rsmsghotdirsimpleseparator msgctxt "ulng.rsmsghotdirsimpleseparator" msgid "(separator)" msgstr "" #: ulng.rsmsghotdirsubmenuname msgctxt "ulng.rsmsghotdirsubmenuname" msgid "Submenu name" msgstr "" #: ulng.rsmsghotdirtarget msgid "Hotdir target" msgstr "" #: ulng.rsmsghotdirtiporderpath msgid "Determine if you want the active frame to be sorted in a specified order after changing directory" msgstr "" #: ulng.rsmsghotdirtipordertarget msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory" msgstr "" #: ulng.rsmsghotdirtipspecialdirbut msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc." msgstr "" #: ulng.rsmsghotdirtotalbackuped msgid "" "Total entries saved: %d\n" "\n" "Backup filename: %s\n" msgstr "" #: ulng.rsmsghotdirtotalexported msgid "Total entries exported: " msgstr "" #: ulng.rsmsghotdirwhattodelete msgid "" "Do you want to delete all elements inside the sub-menu [%s]?\n" "Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n" msgstr "" #: ulng.rsmsghotdirwheretosave msgid "Enter location and filename where to save a Directory Hotlist file" msgstr "" #: ulng.rsmsgincorrectfilelength msgid "Incorrect resulting filelength for file : \"%s\"" msgstr "" #: ulng.rsmsginsertnextdisk msgid "" "Please insert next disk or something similar.\n" "\n" "It is to allow writing this file:\n" "\"%s\"\n" "\n" "Number of bytes still to write: %d\n" msgstr "" #: ulng.rsmsginvalidcommandline msgid "Error in command line" msgstr "" #: ulng.rsmsginvalidfilename msgid "Invalid filename" msgstr "Geçersiz dosya adı" #: ulng.rsmsginvalidformatofconfigurationfile msgid "Invalid format of configuration file" msgstr "" #: ulng.rsmsginvalidhexnumber msgid "Invalid hexadecimal number: \"%s\"" msgstr "" #: ulng.rsmsginvalidpath msgid "Invalid path" msgstr "" #: ulng.rsmsginvalidpathlong msgid "Path %s contains forbidden characters." msgstr "" #: ulng.rsmsginvalidplugin msgid "This is not a valid plugin!" msgstr "" #: ulng.rsmsginvalidpluginarchitecture msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!" msgstr "" #: ulng.rsmsginvalidquoting msgid "Invalid quoting" msgstr "" #: ulng.rsmsginvalidselection msgid "Invalid selection." msgstr "Geçersiz seçim." #: ulng.rsmsgloadingfilelist msgid "Loading file list..." msgstr "Dosya listesi yükleniyor..." #: ulng.rsmsglocatetcconfiguation msgid "Locate TC configuration file (wincmd.ini)" msgstr "" #: ulng.rsmsglocatetcexecutable msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)" msgstr "" #: ulng.rsmsglogcopy msgid "Copy file %s" msgstr "Dosyayı kopyala %s" #: ulng.rsmsglogdelete msgid "Delete file %s" msgstr "Dosya Sil %s" #: ulng.rsmsglogerror msgid "Error: " msgstr "Hata:" #: ulng.rsmsglogextcmdlaunch msgid "Launch external" msgstr "" #: ulng.rsmsglogextcmdresult msgid "Result external" msgstr "" #: ulng.rsmsglogextract msgid "Extract file %s" msgstr "Dosya ayıkla %s" #: ulng.rsmsgloginfo msgid "Info: " msgstr "Bilgi" #: ulng.rsmsgloglink msgid "Create link %s" msgstr "Bağlantı oluştur %s" #: ulng.rsmsglogmkdir msgid "Create directory %s" msgstr "Dizin oluştur %s" #: ulng.rsmsglogmove msgid "Move file %s" msgstr "Dosyayı Taşı %s" #: ulng.rsmsglogpack msgid "Pack to file %s" msgstr "Doyayı Sıkıştır %s" #: ulng.rsmsglogrmdir msgid "Remove directory %s" msgstr "Dizini Kaldır %s" #: ulng.rsmsglogsuccess msgid "Done: " msgstr "Bitmiş:" #: ulng.rsmsglogsymlink msgid "Create symlink %s" msgstr "Sembolik bağlantı oluştur %s" #: ulng.rsmsglogtest msgid "Test file integrity %s" msgstr "Dosya bütünlüğünü sına %s" #: ulng.rsmsglogwipe msgid "Wipe file %s" msgstr "" #: ulng.rsmsglogwipedir msgid "Wipe directory %s" msgstr "" #: ulng.rsmsgmasterpassword msgid "Master Password" msgstr "Ana şifre" #: ulng.rsmsgmasterpasswordenter msgid "Please enter the master password:" msgstr "Lütfen ana şifreyi girin:" #: ulng.rsmsgnewfile msgid "New file" msgstr "Yeni dosya" #: ulng.rsmsgnextvolunpack msgid "Next volume will be unpacked" msgstr "Bir Sonraki birim açılmamış" #: ulng.rsmsgnofiles msgid "No files" msgstr "" #: ulng.rsmsgnofilesselected msgid "No files selected." msgstr "Dosya seçilmedi." #: ulng.rsmsgnofreespacecont msgid "No enough free space on target drive, Continue?" msgstr "Hedef sürücüde yeterli boşluk yok.Yine de devam edilsin mi?" #: ulng.rsmsgnofreespaceretry msgid "No enough free space on target drive, Retry?" msgstr "Hedef sürücüde yeterli boşluk yok. Yeniden Dene?" #: ulng.rsmsgnotdelete #, fuzzy,badformat msgid "Can not delete file %s" msgstr "Dosya silinemiyor" #: ulng.rsmsgnotimplemented msgid "Not implemented." msgstr "Uygulanmamış." #: ulng.rsmsgobjectnotexists msgid "Object does not exist!" msgstr "" #: ulng.rsmsgpanelpreview msgctxt "ulng.rsmsgpanelpreview" msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings." msgstr "" #: ulng.rsmsgpassword msgid "Password:" msgstr "Şifre" #: ulng.rsmsgpassworddiff msgid "Passwords are different!" msgstr "" #: ulng.rsmsgpasswordenter msgid "Please enter the password:" msgstr "Lütfen şifreyi girin.:" #: ulng.rsmsgpasswordfirewall msgid "Password (Firewall):" msgstr "Şifre (Güvenlik Duvarı):" #: ulng.rsmsgpasswordverify msgid "Please re-enter the password for verification:" msgstr "" #: ulng.rsmsgpopuphotdelete msgid "&Delete %s" msgstr "&Sil %s" #: ulng.rsmsgpresetalreadyexists msgid "Preset \"%s\" already exists. Overwrite?" msgstr "Ön ayar \"%s\" zaten var.Üzerine yazılsın mı?" #: ulng.rsmsgproblemexecutingcommand msgid "Problem executing command (%s)" msgstr "" #: ulng.rsmsgpromptaskingfilename msgid "Filename for dropped text:" msgstr "" #: ulng.rsmsgprovidethisfile msgid "Please, make this file available. Retry?" msgstr "" #: ulng.rsmsgrenamefavtabs msgid "Enter new friendly name for this Favorite Tabs" msgstr "" #: ulng.rsmsgrenamefavtabsmenu msgid "Enter new name for this menu" msgstr "" #: ulng.rsmsgrenfldr msgid "Rename/move %d selected files/directories?" msgstr "Seçilen %d dosya(ları)/Dizinleri/Yeniden adlandır?" #: ulng.rsmsgrensel msgid "Rename/move selected \"%s\"?" msgstr "Seçilenleri Taşı/Yeniden adlandır\"%s\"?" #: ulng.rsmsgrestartforapplychanges msgid "Please, restart Double Commander in order to apply changes" msgstr "Lütfen,değişiklikleri uygulamak için Double Commander´ı yeniden başlatın" #: ulng.rsmsgsekectfiletype msgid "Select to which file type to add extension \"%s\"" msgstr "" #: ulng.rsmsgselectedinfo msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d" msgstr "" #: ulng.rsmsgselectexecutablefile msgid "Select executable file for" msgstr "" #: ulng.rsmsgselectonlychecksumfiles #, fuzzy #| msgid "Please select only check sum files!" msgid "Please select only checksum files!" msgstr "Lütfen yalnızca sağlama toplamı dosyaları seçin!" #: ulng.rsmsgsellocnextvol msgid "Please select location of next volume" msgstr "Lütfen bir sonraki parçanın konumunu belirtin" #: ulng.rsmsgsetvolumelabel msgid "Set volume label" msgstr "Birim kümesi etiketi" #: ulng.rsmsgspecialdir msgid "Special Dirs" msgstr "" #: ulng.rsmsgspecialdiraddacti msgid "Add path from active frame" msgstr "" #: ulng.rsmsgspecialdiraddnonacti msgid "Add path from inactive frame" msgstr "" #: ulng.rsmsgspecialdirbrowssel msgid "Browse and use selected path" msgstr "" #: ulng.rsmsgspecialdirenvvar msgid "Use environment variable..." msgstr "" #: ulng.rsmsgspecialdirgotodc msgid "Go to Double Commander special path..." msgstr "" #: ulng.rsmsgspecialdirgotoenvvar msgid "Go to environment variable..." msgstr "" #: ulng.rsmsgspecialdirgotoother msgid "Go to other Windows special folder..." msgstr "" #: ulng.rsmsgspecialdirgototc msgid "Go to Windows special folder (TC)..." msgstr "" #: ulng.rsmsgspecialdirmakereltohotdir msgid "Make relative to hotdir path" msgstr "" #: ulng.rsmsgspecialdirmkabso msgid "Make path absolute" msgstr "" #: ulng.rsmsgspecialdirmkdcrel msgid "Make relative to Double Commander special path..." msgstr "" #: ulng.rsmsgspecialdirmkenvrel msgid "Make relative to environment variable..." msgstr "" #: ulng.rsmsgspecialdirmktctel msgid "Make relative to Windows special folder (TC)..." msgstr "" #: ulng.rsmsgspecialdirmkwnrel msgid "Make relative to other Windows special folder..." msgstr "" #: ulng.rsmsgspecialdirusedc msgid "Use Double Commander special path..." msgstr "" #: ulng.rsmsgspecialdirusehotdir msgid "Use hotdir path" msgstr "" #: ulng.rsmsgspecialdiruseother msgid "Use other Windows special folder..." msgstr "" #: ulng.rsmsgspecialdirusetc msgid "Use Windows special folder (TC)..." msgstr "" #: ulng.rsmsgtabforopeninginnewtab msgid "This tab (%s) is locked! Open directory in another tab?" msgstr "" #: ulng.rsmsgtabrenamecaption msgid "Rename tab" msgstr "Sekmeyi yeniden adlandır" #: ulng.rsmsgtabrenameprompt msgid "New tab name:" msgstr "Yni sekme adı" #: ulng.rsmsgtargetdir msgid "Target path:" msgstr "Hedef yol" #: ulng.rsmsgtcconfignotfound msgid "" "Error! Cannot find the TC configuration file:\n" "%s\n" msgstr "" #: ulng.rsmsgtcexecutablenotfound msgid "" "Error! Cannot find the TC configuration executable:\n" "%s\n" msgstr "" #: ulng.rsmsgtcisrunning msgid "" "Error! TC is still running but it should be closed for this operation.\n" "Close it and press OK or press CANCEL to abort.\n" msgstr "" #: ulng.rsmsgtctoolbarnotfound msgid "" "Error! Cannot find the desired wanted TC toolbar output folder:\n" "%s\n" msgstr "" #: ulng.rsmsgtctoolbarwheretosave msgid "Enter location and filename where to save a TC Toolbar file" msgstr "" #: ulng.rsmsgthisisnowinclipboard msgid "\"%s\" is now in the clipboard" msgstr "" #: ulng.rsmsgtitleextnotinfiletype msgid "Extension of selected file is not in any recognized file types" msgstr "" #: ulng.rsmsgtoolbarlocatedctoolbarfile msgid "Locate \".toolbar\" file to import" msgstr "" #: ulng.rsmsgtoolbarlocatetctoolbarfile msgid "Locate \".BAR\" file to import" msgstr "" #: ulng.rsmsgtoolbarrestorewhat msgid "Enter location and filename of Toolbar to restore" msgstr "" #: ulng.rsmsgtoolbarsaved msgid "" "Saved!\n" "Toolbar filename: %s\n" msgstr "" #: ulng.rsmsgtoomanyfilesselected msgid "Too many files selected." msgstr "Çok fazla dosya seçili." #: ulng.rsmsgundeterminednumberoffile msgid "Undetermined" msgstr "" #: ulng.rsmsgunexpectedusagetreeviewmenu msgid "ERROR: Unexpected Tree View Menu usage!" msgstr "" #: ulng.rsmsgurl msgid "URL:" msgstr "URL" #: ulng.rsmsguserdidnotsetextension msgid "" msgstr "" #: ulng.rsmsguserdidnotsetname msgid "" msgstr "" #: ulng.rsmsgusername msgid "User name:" msgstr "Kullanıcı adı:" #: ulng.rsmsgusernamefirewall msgid "User name (Firewall):" msgstr "Kullanıcı adı (Güvenlik duvarı):" #: ulng.rsmsgverify msgid "VERIFICATION:" msgstr "" #: ulng.rsmsgverifywrong msgid "The target file is corrupted, checksum mismatch!" msgstr "" #: ulng.rsmsgvolumelabel msgid "Volume label:" msgstr "Birim etiketi:" #: ulng.rsmsgvolumesizeenter msgid "Please enter the volume size:" msgstr "Lütfen birimin boyutu girin:" #: ulng.rsmsgwipefldr msgid "Wipe %d selected files/directories?" msgstr "Tam sil %d Seçilen dosya/dizinler?" #: ulng.rsmsgwipesel msgid "Wipe selected \"%s\"?" msgstr "Tam silme Seçili \"%s\"?" #: ulng.rsmsgwithactionwith msgid "with" msgstr "" #: ulng.rsmsgwrongpasswordtryagain msgid "" "Wrong password!\n" "Please try again!\n" msgstr "" #: ulng.rsmulrenautorename msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?" msgstr "" #: ulng.rsmulrenfilenamestylelist msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;" msgstr "Değişiklik yok;TÜMÜ BÜYÜK HARF;tümü küçük harf;İlk karakter büyük harfle;Her kelimeyi büyük harflerle" #: ulng.rsmulrenwarningduplicate msgid "Warning, duplicate names!" msgstr "" #: ulng.rsmulrenwronglinesnumber msgid "File contains wrong number of lines: %d, should be %d!" msgstr "" #: ulng.rsnewsearchclearfilteroptions msgid "Keep;Clear;Prompt" msgstr "" #: ulng.rsnoequivalentinternalcommand msgid "No internal equivalent command" msgstr "" #: ulng.rsnofindfileswindowyet msgid "Sorry, no \"Find files\" window yet..." msgstr "" #: ulng.rsnootherfindfileswindowtoclose msgid "Sorry, no other \"Find files\" window to close and free from memory..." msgstr "" #: ulng.rsopenwithdevelopment msgid "Development" msgstr "" #: ulng.rsopenwitheducation msgid "Education" msgstr "" #: ulng.rsopenwithgames msgid "Games" msgstr "" #: ulng.rsopenwithgraphics #, fuzzy msgctxt "ulng.rsopenwithgraphics" msgid "Graphics" msgstr "Teknik çizim" #: ulng.rsopenwithmultimedia msgid "Multimedia" msgstr "" #: ulng.rsopenwithnetwork #, fuzzy msgctxt "ulng.rsopenwithnetwork" msgid "Network" msgstr "Ağ" #: ulng.rsopenwithoffice msgid "Office" msgstr "" #: ulng.rsopenwithother #, fuzzy msgctxt "ulng.rsopenwithother" msgid "Other" msgstr "Diğer" #: ulng.rsopenwithscience msgid "Science" msgstr "" #: ulng.rsopenwithsettings msgid "Settings" msgstr "" #: ulng.rsopenwithsystem #, fuzzy msgctxt "ulng.rsopenwithsystem" msgid "System" msgstr "Sistem" #: ulng.rsopenwithutility msgid "Accessories" msgstr "" #: ulng.rsoperaborted msgid "Aborted" msgstr "İptal edildi" #: ulng.rsopercalculatingchecksum msgid "Calculating checksum" msgstr "" #: ulng.rsopercalculatingchecksumin msgid "Calculating checksum in \"%s\"" msgstr "" #: ulng.rsopercalculatingchecksumof msgid "Calculating checksum of \"%s\"" msgstr "" #: ulng.rsopercalculatingstatictics msgctxt "ulng.rsopercalculatingstatictics" msgid "Calculating" msgstr "Hesaplama" #: ulng.rsopercalculatingstatisticsin msgid "Calculating \"%s\"" msgstr "" #: ulng.rsopercombining msgid "Joining" msgstr "" #: ulng.rsopercombiningfromto msgid "Joining files in \"%s\" to \"%s\"" msgstr "" #: ulng.rsopercopying msgid "Copying" msgstr "" #: ulng.rsopercopyingfromto msgid "Copying from \"%s\" to \"%s\"" msgstr "" #: ulng.rsopercopyingsomethingto msgid "Copying \"%s\" to \"%s\"" msgstr "" #: ulng.rsopercreatingdirectory msgid "Creating directory" msgstr "" #: ulng.rsopercreatingsomedirectory msgid "Creating directory \"%s\"" msgstr "" #: ulng.rsoperdeleting msgctxt "ulng.rsoperdeleting" msgid "Deleting" msgstr "Sil" #: ulng.rsoperdeletingin msgid "Deleting in \"%s\"" msgstr "" #: ulng.rsoperdeletingsomething msgid "Deleting \"%s\"" msgstr "" #: ulng.rsoperexecuting msgid "Executing" msgstr "" #: ulng.rsoperexecutingsomething msgid "Executing \"%s\"" msgstr "" #: ulng.rsoperextracting msgid "Extracting" msgstr "" #: ulng.rsoperextractingfromto msgid "Extracting from \"%s\" to \"%s\"" msgstr "" #: ulng.rsoperfinished msgid "Finished" msgstr "Bitmiş" #: ulng.rsoperlisting msgid "Listing" msgstr "" #: ulng.rsoperlistingin msgid "Listing \"%s\"" msgstr "" #: ulng.rsopermoving msgid "Moving" msgstr "" #: ulng.rsopermovingfromto msgid "Moving from \"%s\" to \"%s\"" msgstr "" #: ulng.rsopermovingsomethingto msgid "Moving \"%s\" to \"%s\"" msgstr "" #: ulng.rsopernotstarted msgid "Not started" msgstr "Başlatılmadı" #: ulng.rsoperpacking msgid "Packing" msgstr "" #: ulng.rsoperpackingfromto msgid "Packing from \"%s\" to \"%s\"" msgstr "" #: ulng.rsoperpackingsomethingto msgid "Packing \"%s\" to \"%s\"" msgstr "" #: ulng.rsoperpaused msgid "Paused" msgstr "Duraklatıldı" #: ulng.rsoperpausing msgid "Pausing" msgstr "Duraklat" #: ulng.rsoperrunning msgid "Running" msgstr "Çalışıyor" #: ulng.rsopersettingproperty msgid "Setting property" msgstr "" #: ulng.rsopersettingpropertyin msgid "Setting property in \"%s\"" msgstr "" #: ulng.rsopersettingpropertyof msgid "Setting property of \"%s\"" msgstr "" #: ulng.rsopersplitting msgid "Splitting" msgstr "" #: ulng.rsopersplittingfromto msgid "Splitting \"%s\" to \"%s\"" msgstr "" #: ulng.rsoperstarting msgid "Starting" msgstr "Başlangıç" #: ulng.rsoperstopped msgid "Stopped" msgstr "Durmuş" #: ulng.rsoperstopping msgid "Stopping" msgstr "Durdur" #: ulng.rsopertesting msgid "Testing" msgstr "" #: ulng.rsopertestingin msgid "Testing in \"%s\"" msgstr "" #: ulng.rsopertestingsomething msgid "Testing \"%s\"" msgstr "" #: ulng.rsoperverifyingchecksum msgid "Verifying checksum" msgstr "" #: ulng.rsoperverifyingchecksumin msgid "Verifying checksum in \"%s\"" msgstr "" #: ulng.rsoperverifyingchecksumof msgid "Verifying checksum of \"%s\"" msgstr "" #: ulng.rsoperwaitingforconnection msgid "Waiting for access to file source" msgstr "Dosya kaynağına erişim için bekleniyor" #: ulng.rsoperwaitingforfeedback msgid "Waiting for user response" msgstr "Kullanıcı yanıtı bekleniyor" #: ulng.rsoperwiping msgid "Wiping" msgstr "" #: ulng.rsoperwipingin msgid "Wiping in \"%s\"" msgstr "" #: ulng.rsoperwipingsomething msgid "Wiping \"%s\"" msgstr "" #: ulng.rsoperworking msgid "Working" msgstr "" #: ulng.rsoptaddfrommainpanel msgid "Add at &beginning;Add at the end;Smart add" msgstr "" #: ulng.rsoptarchiveconfiguresavetochange msgid "To change current editing archive configuration, either APPLY or DELETE current editing one" msgstr "" #: ulng.rsoptarchiveradditonalcmd msgid "Mode dependent, additional command" msgstr "" #: ulng.rsoptarchiveraddonlynotempty msgid "Add if it is non-empty" msgstr "" #: ulng.rsoptarchiverarchivel msgid "Archive File (long name)" msgstr "" #: ulng.rsoptarchiverarchiver msgid "Select archiver executable" msgstr "" #: ulng.rsoptarchiverarchives msgid "Archive file (short name)" msgstr "" #: ulng.rsoptarchiverchangeencoding msgid "Change Archiver Listing Encoding" msgstr "" #: ulng.rsoptarchiverconfirmdelete msgid "Are you sure you want to delete: %s" msgstr "" #: ulng.rsoptarchiverdefaultexportfilename msgid "Exported Archiver Configuration" msgstr "" #: ulng.rsoptarchivererrorlevel msgid "errorlevel" msgstr "" #: ulng.rsoptarchiverexportcaption msgid "Export archiver configuration" msgstr "" #: ulng.rsoptarchiverexportdone msgid "Exportation of %d elements to file \"%s\" completed." msgstr "" #: ulng.rsoptarchiverexportprompt msgid "Select the one(s) you want to export" msgstr "" #: ulng.rsoptarchiverfilelistl msgid "Filelist (long names)" msgstr "" #: ulng.rsoptarchiverfilelists msgid "Filelist (short names)" msgstr "" #: ulng.rsoptarchiverimportcaption msgid "Import archiver configuration" msgstr "" #: ulng.rsoptarchiverimportdone msgid "Importation of %d elements from file \"%s\" completed." msgstr "" #: ulng.rsoptarchiverimportfile msgid "Select the file to import archiver configuration(s)" msgstr "" #: ulng.rsoptarchiverimportprompt msgid "Select the one(s) you want to import" msgstr "" #: ulng.rsoptarchiverjustname msgid "Use name only, without path" msgstr "" #: ulng.rsoptarchiverjustpath msgid "Use path only, without name" msgstr "" #: ulng.rsoptarchiverprograml msgid "Archive Program (long name)" msgstr "" #: ulng.rsoptarchiverprograms msgid "Archive Program (short name)" msgstr "" #: ulng.rsoptarchiverquoteall msgid "Quote all names" msgstr "" #: ulng.rsoptarchiverquotewithspace msgid "Quote names with spaces" msgstr "" #: ulng.rsoptarchiversinglefprocess msgid "Single filename to process" msgstr "" #: ulng.rsoptarchivertargetsubdir msgid "Target subdirecory" msgstr "" #: ulng.rsoptarchiveruseansi msgid "Use ANSI encoding" msgstr "" #: ulng.rsoptarchiveruseutf8 msgid "Use UTF8 encoding" msgstr "" #: ulng.rsoptarchiverwheretosave msgid "Enter location and filename where to save archiver configuration" msgstr "" #: ulng.rsoptarchivetypename msgid "Archive type name:" msgstr "Arşiv tipi adı:" #: ulng.rsoptassocpluginwith msgid "Associate plugin \"%s\" with:" msgstr "Eklentiyi ilişkilendir \"%s\" ile:" #: ulng.rsoptautosizecolumn msgid "First;Last;" msgstr "İlk; Son;" #: ulng.rsoptconfigsortorder msgid "Classic, legacy order;Alphabetic order (but language still first)" msgstr "" #: ulng.rsoptdifferframeposition msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right" msgstr "" #: ulng.rsoptdisable msgid "Disable" msgstr "Devre dışı" #: ulng.rsoptenable msgctxt "ulng.rsoptenable" msgid "Enable" msgstr "Etkinleştir" #: ulng.rsoptenterext msgid "Enter extension" msgstr "Uzantıyı gir" #: ulng.rsoptfavoritetabswheretoaddinlist msgid "Add at beginning;Add at the end;Alphabetical sort" msgstr "" #: ulng.rsoptfileoperationsprogresskind msgid "separate window;minimized separate window;operations panel" msgstr "" #: ulng.rsoptfilesizeformat msgid "float;B;K;M;G" msgstr "" #: ulng.rsopthotkeysadddeleteshortcutlong msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting." msgstr "" #: ulng.rsopthotkeysaddhotkey msgid "Add hotkey for %s" msgstr "" #: ulng.rsopthotkeysaddshortcutbutton msgid "Add shortcut" msgstr "" #: ulng.rsopthotkeyscannotsetshortcut msgid "Cannot set shortcut" msgstr "" #: ulng.rsopthotkeyschangeshortcut msgid "Change shortcut" msgstr "" #: ulng.rsopthotkeyscommand msgctxt "ulng.rsopthotkeyscommand" msgid "Command" msgstr "" #: ulng.rsopthotkeysdeletetrashcanoverrides msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?" msgstr "" #: ulng.rsopthotkeysdeletetrashcanparameterexists msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?" msgstr "" #: ulng.rsopthotkeysdescription msgctxt "ulng.rsopthotkeysdescription" msgid "Description" msgstr "" #: ulng.rsopthotkeysedithotkey msgid "Edit hotkey for %s" msgstr "" #: ulng.rsopthotkeysfixparameter msgid "Fix parameter" msgstr "" #: ulng.rsopthotkeyshotkey msgctxt "ulng.rsopthotkeyshotkey" msgid "Hotkey" msgstr "Kısayol tuşu" #: ulng.rsopthotkeyshotkeys msgctxt "ulng.rsopthotkeyshotkeys" msgid "Hotkeys" msgstr "Kısayol tuşları" #: ulng.rsopthotkeysnohotkey msgid "" msgstr "" #: ulng.rsopthotkeysparameters msgctxt "ulng.rsopthotkeysparameters" msgid "Parameters" msgstr "Değişkenler" #: ulng.rsopthotkeyssetdeleteshortcut msgid "Set shortcut to delete file" msgstr "" #: ulng.rsopthotkeysshortcutfordeletealreadyassigned msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?" msgstr "" #: ulng.rsopthotkeysshortcutfordeleteissequence msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work." msgstr "" #: ulng.rsopthotkeysshortcutused msgid "Shortcut in use" msgstr "Kısayol kullanımı" #: ulng.rsopthotkeysshortcutusedtext1 #, fuzzy,badformat #| msgid "Shortcut %s is already used for %s." msgid "Shortcut %s is already used." msgstr "Kısayol %s zaten kullanılıyor %s." #: ulng.rsopthotkeysshortcutusedtext2 msgid "Change it to %s?" msgstr "Bunu değiştir %s?" #: ulng.rsopthotkeysusedby #, fuzzy,badformat #| msgid "used by" msgid "used for %s in %s" msgstr "tarafından kullanılan" #: ulng.rsopthotkeysusedwithdifferentparams msgid "used for this command but with different parameters" msgstr "" #: ulng.rsoptionseditorarchivers msgctxt "ulng.rsoptionseditorarchivers" msgid "Archivers" msgstr "Sıkıştır" #: ulng.rsoptionseditorautorefresh msgctxt "ulng.rsoptionseditorautorefresh" msgid "Auto refresh" msgstr "Otomatik Yenileme" #: ulng.rsoptionseditorbehavior msgctxt "ulng.rsoptionseditorbehavior" msgid "Behaviors" msgstr "Davranış" #: ulng.rsoptionseditorbriefview msgctxt "ulng.rsoptionseditorbriefview" msgid "Brief" msgstr "" #: ulng.rsoptionseditorcolors msgctxt "ulng.rsoptionseditorcolors" msgid "Colors" msgstr "Renkler" #: ulng.rsoptionseditorcolumnsview msgctxt "ulng.rsoptionseditorcolumnsview" msgid "Columns" msgstr "Sütunlar" #: ulng.rsoptionseditorconfiguration msgctxt "ulng.rsoptionseditorconfiguration" msgid "Configuration" msgstr "Yapılandırma" #: ulng.rsoptionseditorcustomcolumns msgid "Custom columns" msgstr "" #: ulng.rsoptionseditordirectoryhotlist msgctxt "ulng.rsoptionseditordirectoryhotlist" msgid "Directory Hotlist" msgstr "Önemli Liste Dizini" #: ulng.rsoptionseditordraganddrop msgid "Drag & drop" msgstr "" #: ulng.rsoptionseditordriveslistbutton msgid "Drives list button" msgstr "" #: ulng.rsoptionseditorfavoritetabs msgid "Favorite Tabs" msgstr "" #: ulng.rsoptionseditorfileassicextra msgid "File associations extra" msgstr "" #: ulng.rsoptionseditorfileassoc msgctxt "ulng.rsoptionseditorfileassoc" msgid "File associations" msgstr "Dosya ilişkileri" #: ulng.rsoptionseditorfilenewfiletypes #, fuzzy msgctxt "ulng.rsoptionseditorfilenewfiletypes" msgid "New" msgstr "Yeni" #: ulng.rsoptionseditorfileoperations msgctxt "ulng.rsoptionseditorfileoperations" msgid "File operations" msgstr "Dosya işlemleri" #: ulng.rsoptionseditorfilepanels msgctxt "ulng.rsoptionseditorfilepanels" msgid "File panels" msgstr "Dosya penceresi" #: ulng.rsoptionseditorfilesearch #, fuzzy msgctxt "ulng.rsoptionseditorfilesearch" msgid "File search" msgstr "Dosya ara" #: ulng.rsoptionseditorfilesviews msgid "Files views" msgstr "" #: ulng.rsoptionseditorfiletypes msgctxt "ulng.rsoptionseditorfiletypes" msgid "File types" msgstr "Dosya türleri" #: ulng.rsoptionseditorfoldertabs msgctxt "ulng.rsoptionseditorfoldertabs" msgid "Folder tabs" msgstr "Klasör sekmeleri" #: ulng.rsoptionseditorfoldertabsextra msgid "Folder tabs extra" msgstr "" #: ulng.rsoptionseditorfonts msgctxt "ulng.rsoptionseditorfonts" msgid "Fonts" msgstr "Yazı tipleri" #: ulng.rsoptionseditorhighlighters msgid "Highlighters" msgstr "" #: ulng.rsoptionseditorhotkeys msgctxt "ulng.rsoptionseditorhotkeys" msgid "Hot keys" msgstr "Kısayol tuşları" #: ulng.rsoptionseditoricons msgctxt "ulng.rsoptionseditoricons" msgid "Icons" msgstr "Simge" #: ulng.rsoptionseditorignorelist msgctxt "ulng.rsoptionseditorignorelist" msgid "Ignore list" msgstr "Yoksayma listesi" #: ulng.rsoptionseditorkeyboard msgid "Keys" msgstr "" #: ulng.rsoptionseditorlanguage msgctxt "ulng.rsoptionseditorlanguage" msgid "Language" msgstr "lisan " #: ulng.rsoptionseditorlayout msgctxt "ulng.rsoptionseditorlayout" msgid "Layout" msgstr "Düzen" #: ulng.rsoptionseditorlog msgctxt "ulng.rsoptionseditorlog" msgid "Log" msgstr "Günlük" #: ulng.rsoptionseditormiscellaneous msgctxt "ulng.rsoptionseditormiscellaneous" msgid "Miscellaneous" msgstr "Çeşitli" #: ulng.rsoptionseditormouse msgid "Mouse" msgstr "" #: ulng.rsoptionseditoroptionschanged msgid "" "Options have changed in \"%s\"\n" "\n" "Do you want to save modifications?\n" msgstr "" #: ulng.rsoptionseditorplugins msgctxt "ulng.rsoptionseditorplugins" msgid "Plugins" msgstr "Eklentiler" #: ulng.rsoptionseditorquicksearch msgctxt "ulng.rsoptionseditorquicksearch" msgid "Quick search/filter" msgstr "Hızlı arama/süzgeç" #: ulng.rsoptionseditorterminal msgctxt "ulng.rsoptionseditorterminal" msgid "Terminal" msgstr "Komut İstemi F9" #: ulng.rsoptionseditortoolbar msgid "Toolbar" msgstr "" #: ulng.rsoptionseditortools msgctxt "ulng.rsoptionseditortools" msgid "Tools" msgstr "Araçlar" #: ulng.rsoptionseditortooltips msgctxt "ulng.rsoptionseditortooltips" msgid "Tooltips" msgstr "Araç ipuçları" #: ulng.rsoptionseditortreeviewmenu msgctxt "ulng.rsoptionseditortreeviewmenu" msgid "Tree View Menu" msgstr "" #: ulng.rsoptionseditortreeviewmenucolors msgid "Tree View Menu Colors" msgstr "" #: ulng.rsoptletters msgid "None;Command Line;Quick Search;Quick Filter" msgstr "" #: ulng.rsoptmouseselectionbutton msgid "Left button;Right button;" msgstr "Sol düğme;Sağ düğme;" #: ulng.rsoptnewfilesposition msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list" msgstr "" #: ulng.rsoptpluginalreadyassigned msgid "Plugin %s is already assigned for the following extensions:" msgstr "Eklenti %s aşağıdaki uzantıya zaten atanmış :" #: ulng.rsoptpluginsactive msgctxt "ulng.rsoptpluginsactive" msgid "Active" msgstr "Etkin" #: ulng.rsoptpluginsfilename msgctxt "ulng.rsoptpluginsfilename" msgid "File name" msgstr "Dosya adı" #: ulng.rsoptpluginsname msgctxt "ulng.rsoptpluginsname" msgid "Name" msgstr "Adı" #: ulng.rsoptpluginsregisteredfor msgctxt "ulng.rsoptpluginsregisteredfor" msgid "Registered for" msgstr "Kayıtlı" #: ulng.rsoptsearchcase msgid "&Sensitive;&Insensitive" msgstr "" #: ulng.rsoptsearchitems msgid "&Files;Di&rectories;Files a&nd Directories" msgstr "" #: ulng.rsoptsearchopt msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session" msgstr "" #: ulng.rsoptsortcasesens msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)" msgstr "" #: ulng.rsoptsortfoldermode msgid "sort by name and show first;sort like files and show first;sort like files" msgstr "" #: ulng.rsoptsortmethod #, fuzzy #| msgid "\"Alphabetical, considering accents;Natural sorting: alphabetical and numbers" msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers" msgstr "Alfabetik,sıralamayı hesaba katma;Doğal sıralama: alfabetik ve numaraları" #: ulng.rsopttabsposition msgid "Top;Bottom;" msgstr "Üst;Alt;" #: ulng.rsopttoolbarbuttontype msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u" msgstr "" #: ulng.rsopttypeofduplicatedrename msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext" msgstr "" #: ulng.rsoptupdatedfilesposition msgid "don't change position;use the same setting as for new files;to sorted position" msgstr "" #: ulng.rspropscontains msgid "Files: %d, folders: %d" msgstr "" #: ulng.rspropserrchmod msgid "Can not change access rights for \"%s\"" msgstr "Erişim haklarını değiştirmek mümkün değil \"%s\"" #: ulng.rspropserrchown msgid "Can not change owner for \"%s\"" msgstr "Sahibini değiştiremezsiniz \"%s\"" #: ulng.rspropsfile msgctxt "ulng.rspropsfile" msgid "File" msgstr "Dosya" #: ulng.rspropsfolder msgctxt "ulng.rspropsfolder" msgid "Directory" msgstr "Dizin" #: ulng.rspropsnmdpipe msgid "Named pipe" msgstr "Adı konmuş iletişim kanalı" #: ulng.rspropssocket msgid "Socket" msgstr "Terminal adresleme yapısı" #: ulng.rspropsspblkdev msgid "Special block device" msgstr "Özel blok aygıtları" #: ulng.rspropsspchrdev msgid "Special character device" msgstr "Özel karakter çevre birimi" #: ulng.rspropssymlink msgid "Symbolic link" msgstr "Sembolik bağlantı" #: ulng.rspropsunknowntype msgid "Unknown type" msgstr "Bilinmeyen tür" #: ulng.rssearchresult msgid "Search result" msgstr "Arama sonucu" #: ulng.rssearchstatus msgid "SEARCH" msgstr "Ara" #: ulng.rssearchtemplateunnamed msgid "" msgstr "" #: ulng.rssearchwithdsxplugininprogress msgid "" "A file search using DSX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" #: ulng.rssearchwithwdxplugininprogress msgid "" "A file search using WDX plugin is already in progress.\n" "We need that one to be completed before to launch a new one.\n" msgstr "" #: ulng.rsselectdir msgid "Select a directory" msgstr "Bir dizin seçin" #: ulng.rsselectyoufindfileswindow msgid "Select your window" msgstr "" #: ulng.rsshowhelpfor msgid "&Show help for %s" msgstr "" #: ulng.rssimplewordall msgctxt "ulng.rssimplewordall" msgid "All" msgstr "Tüm" #: ulng.rssimplewordcategory msgctxt "ulng.rssimplewordcategory" msgid "Category" msgstr "" #: ulng.rssimplewordcolumnsingular msgid "Column" msgstr "" #: ulng.rssimplewordcommand msgctxt "ulng.rssimplewordcommand" msgid "Command" msgstr "" #: ulng.rssimplewordfilename msgid "Filename" msgstr "" #: ulng.rssimplewordfiles msgid "files" msgstr "" #: ulng.rssimplewordletter msgid "Letter" msgstr "" #: ulng.rssimplewordparameter msgid "Param" msgstr "" #: ulng.rssimplewordresult msgid "Result" msgstr "" #: ulng.rssimplewordworkdir msgid "WorkDir" msgstr "" #: ulng.rssizeunitbytes #, fuzzy #| msgid "bayt" msgid "Bytes" msgstr "bayt" #: ulng.rssizeunitgbytes #, fuzzy #| msgid "Gigabayt" msgctxt "ulng.rssizeunitgbytes" msgid "Gigabytes" msgstr "Gigabayt" #: ulng.rssizeunitkbytes #, fuzzy #| msgid "Kilobayt" msgctxt "ulng.rssizeunitkbytes" msgid "Kilobytes" msgstr "Kilobayt" #: ulng.rssizeunitmbytes #, fuzzy #| msgid "Megabayt" msgctxt "ulng.rssizeunitmbytes" msgid "Megabytes" msgstr "Megabayt" #: ulng.rssizeunittbytes #, fuzzy #| msgid "Terabayt" msgid "Terabytes" msgstr "Terabayt" #: ulng.rsspacemsg msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)" msgstr "Dosya: %d, endeks : %d, Boyut: %s (%s bayt)" #: ulng.rsspliterrdirectory msgid "Unable to create target directory!" msgstr "Hedef dizini oluşturulamadı" #: ulng.rsspliterrfilesize msgid "Incorrect file size format!" msgstr "Yanlış dosya boyutu biçimi!" #: ulng.rsspliterrsplitfile msgid "Unable to split the file!" msgstr "Dosya parçalanması yapılamıyor!" #: ulng.rssplitmsgmanyparts msgid "The number of parts is more than 100! Continue?" msgstr "Parçaların sayısı, 100 'den fazla! Devam edilsin mi?" #: ulng.rssplitpredefinedsizes msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R" msgstr "" #: ulng.rssplitseldir msgid "Select directory:" msgstr "Dizin Seç:" #: ulng.rsstraccents msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ" msgstr "" #: ulng.rsstraccentsstripped msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE" msgstr "" #: ulng.rsstrpreviewjustpreview msgid "Just preview" msgstr "" #: ulng.rsstrpreviewothers msgid "Others" msgstr "" #: ulng.rsstrpreviewsearchingletters msgid "OU" msgstr "" #: ulng.rsstrpreviewsidenote msgid "Side note" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched1 msgid "Flat" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched2 msgid "Limited" msgstr "" #: ulng.rsstrpreviewwordwithoutsearched3 msgid "Simple" msgstr "" #: ulng.rsstrpreviewwordwithsearched1 msgid "Fabulous" msgstr "" #: ulng.rsstrpreviewwordwithsearched2 msgid "Marvelous" msgstr "" #: ulng.rsstrpreviewwordwithsearched3 msgid "Tremendous" msgstr "" #: ulng.rsstrtvmchoosedirhistory msgid "Choose your directory from Dir History" msgstr "" #: ulng.rsstrtvmchoosefavoritetabs msgid "Choose you Favorite Tabs:" msgstr "" #: ulng.rsstrtvmchoosefromcmdlinehistory msgid "Choose your command from Command Line History" msgstr "" #: ulng.rsstrtvmchoosefrommainmenu msgid "Choose your action from Main Menu" msgstr "" #: ulng.rsstrtvmchoosefromtoolbar msgid "Choose your action from Maintool bar" msgstr "" #: ulng.rsstrtvmchoosehotdirectory msgid "Choose your directory from Hot Directory:" msgstr "" #: ulng.rsstrtvmchooseviewhistory msgid "Choose your directory from File View History" msgstr "" #: ulng.rsstrtvmchooseyourfileordir msgid "Choose your file or your directory" msgstr "" #: ulng.rssymerrcreate msgid "Error creating symlink." msgstr "Sembolik bağ oluşturma hatası." #: ulng.rssyndefaulttext msgid "Default text" msgstr "" #: ulng.rssynlangplaintext msgid "Plain text" msgstr "" #: ulng.rstabsactionondoubleclickchoices msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu" msgstr "" #: ulng.rstimeunitday msgctxt "ulng.rstimeunitday" msgid "Day(s)" msgstr "Gün(ler)" #: ulng.rstimeunithour msgid "Hour(s)" msgstr "saat(ler)" #: ulng.rstimeunitminute msgid "Minute(s)" msgstr "Dakika (lar)" #: ulng.rstimeunitmonth msgid "Month(s)" msgstr "Ay(lar)" #: ulng.rstimeunitsecond msgid "Second(s)" msgstr "Saniye (ler)" #: ulng.rstimeunitweek msgid "Week(s)" msgstr "Hafta(lar)" #: ulng.rstimeunityear msgid "Year(s)" msgstr "Yıl(lar)" #: ulng.rstitlerenamefavtabs msgid "Rename Favorite Tabs" msgstr "" #: ulng.rstitlerenamefavtabsmenu msgid "Rename Favorite Tabs sub-menu" msgstr "" #: ulng.rstooldiffer msgctxt "ulng.rstooldiffer" msgid "Differ" msgstr "Karşılaştır" #: ulng.rstooleditor msgctxt "ulng.rstooleditor" msgid "Editor" msgstr "Araç Düzenleyicisi" #: ulng.rstoolerroropeningdiffer msgid "Error opening differ" msgstr "" #: ulng.rstoolerroropeningeditor msgid "Error opening editor" msgstr "" #: ulng.rstoolerroropeningterminal msgid "Error opening terminal" msgstr "" #: ulng.rstoolerroropeningviewer msgid "Error opening viewer" msgstr "" #: ulng.rstoolterminal msgctxt "ulng.rstoolterminal" msgid "Terminal" msgstr "Komut İstemi F9" #: ulng.rstoolviewer msgctxt "ulng.rstoolviewer" msgid "Viewer" msgstr "Göster" #: ulng.rsunhandledexceptionmessage msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program." msgstr "Bu hatayı düzeltebilmemiz için lütfen bu hatayı bildirin Ne yaptığınızın bir açıklaması ve aşağıdaki dosya: %sdevam etmek için %sbasın %s ,iptal etmek için programı tıklayın" #: ulng.rsvarbothpanelactivetoinactive msgid "Both panels, from active to inactive" msgstr "" #: ulng.rsvarbothpanellefttoright msgid "Both panels, from left to right" msgstr "" #: ulng.rsvarcurrentpath msgid "Path of panel" msgstr "" #: ulng.rsvarencloseelement msgid "Enclose each name in brackets or what you want" msgstr "" #: ulng.rsvarfilenamenoext msgid "Just filename, no extension" msgstr "" #: ulng.rsvarfullpath msgid "Complete filename (path+filename)" msgstr "" #: ulng.rsvarhelpwith msgid "Help with \"%\" variables" msgstr "" #: ulng.rsvarinputparam msgid "Will request request user to enter a parameter with a default suggested value" msgstr "" #: ulng.rsvarleftpanel msgid "Left panel" msgstr "" #: ulng.rsvarlistfilename msgid "Temporary filename of list of filenames" msgstr "" #: ulng.rsvarlistfullfilename msgid "Temporary filename of list of complete filenames (path+filename)" msgstr "" #: ulng.rsvarlistinutf16 msgid "Filenames in list in UTF-16 with BOM" msgstr "" #: ulng.rsvarlistinutf16quoted msgid "Filenames in list in UTF-16 with BOM, inside double quotes" msgstr "" #: ulng.rsvarlistinutf8 msgid "Filenames in list in UTF-8" msgstr "" #: ulng.rsvarlistinutf8quoted msgid "Filenames in list in UTF-8, inside double quotes" msgstr "" #: ulng.rsvarlistrelativefilename msgid "Temporary filename of list of filenames with relative path" msgstr "" #: ulng.rsvaronlyextension msgid "Only file extension" msgstr "" #: ulng.rsvaronlyfilename msgid "Only filename" msgstr "" #: ulng.rsvarotherexamples msgid "Other example of what's possible" msgstr "" #: ulng.rsvarpath msgid "Path, without ending delimiter" msgstr "" #: ulng.rsvarpercentchangetopound msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign" msgstr "" #: ulng.rsvarpercentsign msgid "Return the percent sign" msgstr "" #: ulng.rsvarpoundchangetopercent msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign" msgstr "" #: ulng.rsvarprependelement msgid "Prepend each name with \"-a \" or what you want" msgstr "" #: ulng.rsvarpromptuserforparam msgid "%[Prompt user for param;Default value proposed]" msgstr "" #: ulng.rsvarrelativepathandfilename msgid "Filename with relative path" msgstr "" #: ulng.rsvarrightpanel msgid "Right panel" msgstr "" #: ulng.rsvarsecondelementrightpanel msgid "Full path of second selected file in right panel" msgstr "" #: ulng.rsvarshowcommandprior msgid "Show command prior execute" msgstr "" #: ulng.rsvarsimplemessage msgid "%[Simple message]" msgstr "" #: ulng.rsvarsimpleshowmessage msgid "Will show a simple message" msgstr "" #: ulng.rsvarsourcepanel msgid "Active panel (source)" msgstr "" #: ulng.rsvartargetpanel msgid "Inactive panel (target)" msgstr "" #: ulng.rsvarwillbequoted msgid "Filenames will be quoted from here (default)" msgstr "" #: ulng.rsvarwilldointerminal msgid "Command will be done in terminal, remaining opened at the end" msgstr "" #: ulng.rsvarwillhaveendingdelimiter msgid "Paths will have ending delimiter" msgstr "" #: ulng.rsvarwillnotbequoted msgid "Filenames will not be quoted from here" msgstr "" #: ulng.rsvarwillnotdointerminal msgid "Command will be done in terminal, closed at the end" msgstr "" #: ulng.rsvarwillnothaveendingdelimiter msgid "Paths will not have ending delimiter (default)" msgstr "" #: ulng.rsvfsnetwork msgctxt "ulng.rsvfsnetwork" msgid "Network" msgstr "Ağ" #: ulng.rsviewabouttext msgid "Internal Viewer of Double Commander." msgstr "Double Commander dahili Görüntüleyici" #: ulng.rsviewbadquality msgid "Bad Quality" msgstr "" #: ulng.rsviewencoding msgctxt "ulng.rsviewencoding" msgid "Encoding" msgstr "Kodlama" #: ulng.rsviewimagetype msgid "Image Type" msgstr "" #: ulng.rsviewnewsize #, fuzzy msgctxt "ulng.rsviewnewsize" msgid "New Size" msgstr "Yeni Boyut" #: ulng.rsviewnotfound msgid "%s not found!" msgstr "%s bulunamadı!" #: ulng.rsviewwithexternalviewer msgid "with external viewer" msgstr "" #: ulng.rsviewwithinternalviewer msgid "with internal viewer" msgstr "" #: ulng.rsxreplacements msgid "Number of replacement: %d" msgstr "" #: ulng.rszeroreplacement msgid "No replacement took place." msgstr ""