mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-28 10:02:14 +00:00
12344 lines
360 KiB
Text
12344 lines
360 KiB
Text
# Par soucis d'être constant, il n'y a pas d'exception, c'est toujours "Dossier" qui est utilisé.
|
||
# C'est comme ça pour reprendre la même nomenclature que Windows et Apple.
|
||
# Il est vrai que TC utilise le terme "Répertoire" mais on prend le partie de Windows qui lui parle de "dossier".
|
||
# Pour quelqu'un qui a toujours préféré le terme "Répertoire" c'est un peu irritant la première heure d'utiliser le terme "Dossier".
|
||
# Mais courage, après quelques minutes, on fini par s'y habituer et c'est très bien.
|
||
#
|
||
# 2016-02-12:DB-Pour le nom commun, on peut dire "double-clic". Puis pour l'action de le faire, le verbe c'est "double-cliquer".
|
||
# C'est comme ça dans le Larousse en ligne et c'est ce qui a été suivi ici.
|
||
#
|
||
# 2016-02-12:DB-Pour ce qui est du terme "plugin", il y a un peu moins de certitude!
|
||
# La Comission générale de terminologie et de néologie en France en 1999 préconisait "Module d'extension".
|
||
# L'Office québécois de la langue française en 2002 y allait de "plugiciel".
|
||
# TC lui parle en façon de "Module-additionel" ou même de "Additif" sur son site web.
|
||
# Devant ces différences, on préfère ne pas s'éparpiller d'avantage et on va utiliser le même terme qu'en angalis, soit "plugin".
|
||
# On le mettra partout entre guillemet. Puis si c'est au pluriels on ajoutera un "s" genre "plugins" simplement.
|
||
# La seule exception c'est pour "ulng.rsoptionseditorplugins" où il n'estpas entre guillemet. C'est juste pour que dans le menu d'option alors qu'on trie
|
||
# alphabétiquement pour pas que cela ne se retrouve en haut de la liste à cause du guilemet.
|
||
# C'est tout de même très répandu aussi comme terme même en français.
|
||
#
|
||
# 2016-06-15:DB-En français, avant et après le deux points, ça prend un espace.
|
||
# Au fil du temps ce fichier s'est ramassé souvent avec aucun espace après le deux points.
|
||
# Cela vient d'être corrigé partout. Ce fut un peu long et fastidieux. Essayons de continuer cela.
|
||
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: Double Commander 0.5.1 beta\n"
|
||
"Report-Msgid-Bugs-To: \n"
|
||
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
|
||
"PO-Revision-Date: 2016-12-08 20:46-0500\n"
|
||
"Last-Translator: Denis Bisson <denis.bisson@denisbisson.org>\n"
|
||
"Language-Team: Zebulon Tourneboulle <zebulon.tourneboulle@gmail.com>\n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=utf-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Native-Language: Français\n"
|
||
"Language: fr\n"
|
||
"X-Generator: Poedit 1.8.7\n"
|
||
|
||
#: fsyncdirsdlg.rscomparingpercent
|
||
msgid "Comparing... %d%% (ESC to cancel)"
|
||
msgstr "Comparaison... %d%% (ESC pour annuler)"
|
||
|
||
#: fsyncdirsdlg.rsdeleteright
|
||
msgid "Right: Delete %d file(s)"
|
||
msgstr "Droite : Effacement %d fichiers(s)"
|
||
|
||
#: fsyncdirsdlg.rsfilesfound
|
||
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
||
msgstr "Fichiers trouvés : %d (Identique : %d, Différents : %d, Gauche unique : %d, Droit unique : %d)"
|
||
|
||
#: fsyncdirsdlg.rslefttorightcopy
|
||
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
||
msgstr "Gauche vers la droite : Copier %d fichiers, taille totale : %d octets"
|
||
|
||
#: fsyncdirsdlg.rsrighttoleftcopy
|
||
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
||
msgstr "Droite versla gauche : Copier %d fichiers, taille totale : %d octets"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
||
msgid "Choose template..."
|
||
msgstr "Choisir un modèle..."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
||
msgid "C&heck free space"
|
||
msgstr "Vérifier l'espace disponible"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
||
msgid "Cop&y attributes"
|
||
msgstr "Copier les attributs"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
||
msgid "Copy o&wnership"
|
||
msgstr "Copier propriétaire"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
||
msgid "Copy &permissions"
|
||
msgstr "Copier permissions"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Copier date et heure"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
||
msgid "Correct lin&ks"
|
||
msgstr "Liens valides"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "Drop readonly fla&g"
|
||
msgstr "Ne pas tenir compte du marqueur \"lecture seule\""
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
||
msgid "E&xclude empty directories"
|
||
msgstr "Exclure les dossiers vides"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
||
msgid "Fo&llow links"
|
||
msgstr "Suivre les liens"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
||
msgid "&Reserve space"
|
||
msgstr "Réserver l'espace"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
||
msgid "&Verify"
|
||
msgstr "Vérification"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
||
msgid "What to do when cannot set file time, attributes, etc."
|
||
msgstr "Quoi faire lorsqu'on ne peut ajuster la date, les attributs, etc. du fichier"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
||
msgid "Use file template"
|
||
msgstr "Utiliser un fichier-modèle"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
||
msgid "When dir&ectory exists"
|
||
msgstr "Quand le dossier existe"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When &file exists"
|
||
msgstr "Quand le fichier existe"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
||
msgid "When ca&nnot set property"
|
||
msgstr "Quand on ne peut ajuste les propriétés"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
||
msgid "<no template>"
|
||
msgstr "<pas de modèle>"
|
||
|
||
#: tfrmabout.btnclose.caption
|
||
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Fermer"
|
||
|
||
#: tfrmabout.btncopytoclipboard.caption
|
||
msgid "Copy to clipboard"
|
||
msgstr "Copier vers le presse-papier"
|
||
|
||
#: tfrmabout.caption
|
||
msgctxt "TFRMABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "A propos"
|
||
|
||
#: tfrmabout.lblbuild.caption
|
||
msgctxt "tfrmabout.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Date révision"
|
||
|
||
#: tfrmabout.lblfreepascalver.caption
|
||
msgctxt "tfrmabout.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmabout.lblhomepage.caption
|
||
msgid "Home Page:"
|
||
msgstr "Page de démarrage :"
|
||
|
||
#: tfrmabout.lblhomepageaddress.caption
|
||
msgid "http://doublecmd.sourceforge.net"
|
||
msgstr "http://doublecmd.sourceforge.net"
|
||
|
||
#: tfrmabout.lbllazarusver.caption
|
||
msgctxt "tfrmabout.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmabout.lblrevision.caption
|
||
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
|
||
msgid "Revision"
|
||
msgstr "Révision"
|
||
|
||
#: tfrmabout.lbltitle.caption
|
||
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmabout.lblversion.caption
|
||
msgctxt "tfrmabout.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Version"
|
||
|
||
#: tfrmattributesedit.btncancel.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Annuler"
|
||
|
||
#: tfrmattributesedit.btnok.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmattributesedit.btnreset.caption
|
||
msgid "&Reset"
|
||
msgstr "&Reset"
|
||
|
||
#: tfrmattributesedit.caption
|
||
msgid "Choose attributes"
|
||
msgstr "Choisir les attributs"
|
||
|
||
#: tfrmattributesedit.cbarchive.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
|
||
msgid "&Archive"
|
||
msgstr "Archive"
|
||
|
||
#: tfrmattributesedit.cbcompressed.caption
|
||
msgid "Co&mpressed"
|
||
msgstr "Compressé"
|
||
|
||
#: tfrmattributesedit.cbdirectory.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
|
||
msgid "&Directory"
|
||
msgstr "Dossier"
|
||
|
||
#: tfrmattributesedit.cbencrypted.caption
|
||
msgid "&Encrypted"
|
||
msgstr "Archive cryptée"
|
||
|
||
#: tfrmattributesedit.cbhidden.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
|
||
msgid "&Hidden"
|
||
msgstr "Caché"
|
||
|
||
#: tfrmattributesedit.cbreadonly.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
|
||
msgid "Read o&nly"
|
||
msgstr "Lecture seule"
|
||
|
||
#: tfrmattributesedit.cbsgid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmattributesedit.cbsparse.caption
|
||
msgid "S&parse"
|
||
msgstr "Clairesemé"
|
||
|
||
#: tfrmattributesedit.cbsticky.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Collant"
|
||
|
||
#: tfrmattributesedit.cbsuid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmattributesedit.cbsymlink.caption
|
||
msgid "&Symlink"
|
||
msgstr "Lien symbolique"
|
||
|
||
#: tfrmattributesedit.cbsystem.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
|
||
msgid "S&ystem"
|
||
msgstr "Système"
|
||
|
||
#: tfrmattributesedit.cbtemporary.caption
|
||
msgid "&Temporary"
|
||
msgstr "Temporaire"
|
||
|
||
#: tfrmattributesedit.gbntfsattributes.caption
|
||
msgid "NTFS attributes"
|
||
msgstr "Attributs NTFS"
|
||
|
||
#: tfrmattributesedit.gbwingeneral.caption
|
||
msgid "General attributes"
|
||
msgstr "Attributs généraux"
|
||
|
||
#: tfrmattributesedit.lblattrbitsstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Bits :"
|
||
|
||
#: tfrmattributesedit.lblattrgroupstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Groupe"
|
||
|
||
#: tfrmattributesedit.lblattrotherstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Autres"
|
||
|
||
#: tfrmattributesedit.lblattrownerstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Propriétaire"
|
||
|
||
#: tfrmattributesedit.lblexec.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Exécuter"
|
||
|
||
#: tfrmattributesedit.lblread.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Lire"
|
||
|
||
#: tfrmattributesedit.lbltextattrs.caption
|
||
msgid "As te&xt:"
|
||
msgstr "Comme texte :"
|
||
|
||
#: tfrmattributesedit.lblwrite.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Écrire"
|
||
|
||
#: tfrmchecksumcalc.caption
|
||
msgctxt "tfrmchecksumcalc.caption"
|
||
msgid "Calculate checksum..."
|
||
msgstr "Calculer une signature..."
|
||
|
||
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
||
msgid "Open checksum file after job is completed"
|
||
msgstr "Ouvre le fichier de signature à la fin de la tâche"
|
||
|
||
#: tfrmchecksumcalc.cbseparatefile.caption
|
||
msgid "C&reate separate checksum file for each file"
|
||
msgstr "Créer une signature séparée pour chaque fichier"
|
||
|
||
#: tfrmchecksumcalc.lblsaveto.caption
|
||
msgid "&Save checksum file(s) to:"
|
||
msgstr "Sauvegarder le fichier de signature dans :"
|
||
|
||
#: tfrmchecksumverify.btnclose.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Fermer"
|
||
|
||
#: tfrmchecksumverify.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
|
||
msgid "Verify checksum..."
|
||
msgstr "Vérification de signature..."
|
||
|
||
#: tfrmconnectionmanager.btnadd.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Ajouter"
|
||
|
||
#: tfrmconnectionmanager.btncancel.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmconnectionmanager.btnconnect.caption
|
||
msgid "C&onnect"
|
||
msgstr "Se connecter"
|
||
|
||
#: tfrmconnectionmanager.btndelete.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmconnectionmanager.btnedit.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmconnectionmanager.caption
|
||
msgid "Connection manager"
|
||
msgstr "Connexion manager"
|
||
|
||
#: tfrmconnectionmanager.gbconnectto.caption
|
||
msgid "Connect to:"
|
||
msgstr "Se connecter à :"
|
||
|
||
#: tfrmcopydlg.btnaddtoqueue.caption
|
||
msgid "A&dd To Queue"
|
||
msgstr "Ajoute à la file d'attente"
|
||
|
||
#: tfrmcopydlg.btncancel.caption
|
||
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmcopydlg.btnoptions.caption
|
||
msgid "O&ptions"
|
||
msgstr "O&ptions"
|
||
|
||
#: tfrmcopydlg.btnsaveoptions.caption
|
||
msgid "Sa&ve these options as default"
|
||
msgstr "Sauvegarder les valeurs des options comme celles par défaut"
|
||
|
||
#: tfrmcopydlg.caption
|
||
msgctxt "TFRMCOPYDLG.CAPTION"
|
||
msgid "Copy file(s)"
|
||
msgstr "Copier le(s) fichier(s)"
|
||
|
||
#: tfrmcopydlg.mnunewqueue.caption
|
||
msgctxt "tfrmcopydlg.mnunewqueue.caption"
|
||
msgid "New queue"
|
||
msgstr "Nouvelle file d'attente"
|
||
|
||
#: tfrmcopydlg.mnuqueue1.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue1.caption"
|
||
msgid "Queue 1"
|
||
msgstr "File d'attente 1"
|
||
|
||
#: tfrmcopydlg.mnuqueue2.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue2.caption"
|
||
msgid "Queue 2"
|
||
msgstr "File d'attente 2"
|
||
|
||
#: tfrmcopydlg.mnuqueue3.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue3.caption"
|
||
msgid "Queue 3"
|
||
msgstr "File d'attente 3"
|
||
|
||
#: tfrmcopydlg.mnuqueue4.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue4.caption"
|
||
msgid "Queue 4"
|
||
msgstr "File d'attente 4"
|
||
|
||
#: tfrmcopydlg.mnuqueue5.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue5.caption"
|
||
msgid "Queue 5"
|
||
msgstr "File d'attente 5"
|
||
|
||
#: tfrmdescredit.actsavedescription.caption
|
||
msgid "Save Description"
|
||
msgstr "Sauvegarder la description"
|
||
|
||
#: tfrmdescredit.btncancel.caption
|
||
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmdescredit.btnok.caption
|
||
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmdescredit.caption
|
||
msgid "File/folder comment"
|
||
msgstr "Commentaires liés aux fichiers/dossiers"
|
||
|
||
#: tfrmdescredit.lbleditcommentfor.caption
|
||
msgid "E&dit comment for:"
|
||
msgstr "Éditer le commentaire pour :"
|
||
|
||
#: tfrmdescredit.lblencoding.caption
|
||
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
|
||
msgid "&Encoding:"
|
||
msgstr "Encodage :"
|
||
|
||
#: tfrmdescredit.lblfilename.caption
|
||
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmdiffer.actabout.caption
|
||
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "A propos"
|
||
|
||
#: tfrmdiffer.actautocompare.caption
|
||
msgid "Auto Compare"
|
||
msgstr "Comparaison automatique"
|
||
|
||
#: tfrmdiffer.actbinarycompare.caption
|
||
msgid "Binary Mode"
|
||
msgstr "Mode binaire"
|
||
|
||
#: tfrmdiffer.actcancelcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmdiffer.actcancelcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
|
||
msgid "Copy Block Right"
|
||
msgstr "Copier le bloc vers la droite"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
||
msgid "Copy Block Right"
|
||
msgstr "Copier le bloc vers la droite"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
|
||
msgid "Copy Block Left"
|
||
msgstr "Copier le bloc vers la gauche"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
||
msgid "Copy Block Left"
|
||
msgstr "Copier le bloc vers la gauche"
|
||
|
||
#: tfrmdiffer.acteditcopy.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmdiffer.acteditcut.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: tfrmdiffer.acteditdelete.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmdiffer.acteditpaste.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: tfrmdiffer.acteditredo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Refaire"
|
||
|
||
#: tfrmdiffer.acteditselectall.caption
|
||
msgid "Select &All"
|
||
msgstr "&Tout sélectionner"
|
||
|
||
#: tfrmdiffer.acteditundo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Annuler (en arrière)"
|
||
|
||
#: tfrmdiffer.actexit.caption
|
||
msgctxt "tfrmdiffer.actexit.caption"
|
||
msgid "E&xit"
|
||
msgstr "&Quitter"
|
||
|
||
#: tfrmdiffer.actfirstdifference.caption
|
||
msgctxt "tfrmdiffer.actfirstdifference.caption"
|
||
msgid "First Difference"
|
||
msgstr "Première différence"
|
||
|
||
#: tfrmdiffer.actfirstdifference.hint
|
||
msgctxt "tfrmdiffer.actfirstdifference.hint"
|
||
msgid "First Difference"
|
||
msgstr "Première différence"
|
||
|
||
#: tfrmdiffer.actignorecase.caption
|
||
msgid "Ignore Case"
|
||
msgstr "Ignorer la casse"
|
||
|
||
#: tfrmdiffer.actignorewhitespace.caption
|
||
msgid "Ignore Blanks"
|
||
msgstr "Ignorer les espaces"
|
||
|
||
#: tfrmdiffer.actkeepscrolling.caption
|
||
msgid "Keep Scrolling"
|
||
msgstr "Défilement simultané des deux côtés à la fois"
|
||
|
||
#: tfrmdiffer.actlastdifference.caption
|
||
msgctxt "tfrmdiffer.actlastdifference.caption"
|
||
msgid "Last Difference"
|
||
msgstr "Dernière différence"
|
||
|
||
#: tfrmdiffer.actlastdifference.hint
|
||
msgctxt "tfrmdiffer.actlastdifference.hint"
|
||
msgid "Last Difference"
|
||
msgstr "Dernière différence"
|
||
|
||
#: tfrmdiffer.actlinedifferences.caption
|
||
msgid "Line Differences"
|
||
msgstr "Différences de la ligne en cours"
|
||
|
||
#: tfrmdiffer.actnextdifference.caption
|
||
msgctxt "tfrmdiffer.actnextdifference.caption"
|
||
msgid "Next Difference"
|
||
msgstr "Prochaine différence"
|
||
|
||
#: tfrmdiffer.actnextdifference.hint
|
||
msgctxt "tfrmdiffer.actnextdifference.hint"
|
||
msgid "Next Difference"
|
||
msgstr "Prochaine différence"
|
||
|
||
#: tfrmdiffer.actopenleft.caption
|
||
msgid "Open Left..."
|
||
msgstr "Ouvrir à Gauche"
|
||
|
||
#: tfrmdiffer.actopenright.caption
|
||
msgid "Open Right..."
|
||
msgstr "Ouvrir à Droite"
|
||
|
||
#: tfrmdiffer.actpaintbackground.caption
|
||
msgid "Paint Background"
|
||
msgstr "Colorer l'arrière-plan"
|
||
|
||
#: tfrmdiffer.actprevdifference.caption
|
||
msgctxt "tfrmdiffer.actprevdifference.caption"
|
||
msgid "Previous Difference"
|
||
msgstr "Précédente différence"
|
||
|
||
#: tfrmdiffer.actprevdifference.hint
|
||
msgctxt "tfrmdiffer.actprevdifference.hint"
|
||
msgid "Previous Difference"
|
||
msgstr "Précédente différence"
|
||
|
||
#: tfrmdiffer.actreload.caption
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
|
||
msgid "&Reload"
|
||
msgstr "Recharger"
|
||
|
||
#: tfrmdiffer.actreload.hint
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
|
||
msgid "Reload"
|
||
msgstr "Recharger"
|
||
|
||
#: tfrmdiffer.actsave.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: tfrmdiffer.actsave.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: tfrmdiffer.actsaveas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
|
||
msgid "Save as..."
|
||
msgstr "Enregistrer sous... "
|
||
|
||
#: tfrmdiffer.actsaveas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
||
msgid "Save as..."
|
||
msgstr "Enregistrer sous... "
|
||
|
||
#: tfrmdiffer.actsaveleft.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
|
||
msgid "Save Left"
|
||
msgstr "Sauvegarder la gauche"
|
||
|
||
#: tfrmdiffer.actsaveleft.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
||
msgid "Save Left"
|
||
msgstr "Sauvegarder la gauche"
|
||
|
||
#: tfrmdiffer.actsaveleftas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
|
||
msgid "Save Left As..."
|
||
msgstr "Sauvegarder la gauche sous..."
|
||
|
||
#: tfrmdiffer.actsaveleftas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
||
msgid "Save Left As..."
|
||
msgstr "Sauvegarder la gauche sous..."
|
||
|
||
#: tfrmdiffer.actsaveright.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
|
||
msgid "Save Right"
|
||
msgstr "Sauvegarder la droite"
|
||
|
||
#: tfrmdiffer.actsaveright.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
||
msgid "Save Right"
|
||
msgstr "Sauvegarder la droite"
|
||
|
||
#: tfrmdiffer.actsaverightas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
|
||
msgid "Save Right As..."
|
||
msgstr "Sauvegarder la droite sous..."
|
||
|
||
#: tfrmdiffer.actsaverightas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
||
msgid "Save Right As..."
|
||
msgstr "Sauvegarder la droite sous..."
|
||
|
||
#: tfrmdiffer.actstartcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Comparer"
|
||
|
||
#: tfrmdiffer.actstartcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
||
msgid "Compare"
|
||
msgstr "Comparer"
|
||
|
||
#: tfrmdiffer.btnleftencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Encodage"
|
||
|
||
#: tfrmdiffer.btnrightencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Encodage"
|
||
|
||
#: tfrmdiffer.caption
|
||
msgctxt "TFRMDIFFER.CAPTION"
|
||
msgid "Compare files"
|
||
msgstr "Comparer les fichiers"
|
||
|
||
#: tfrmdiffer.midivider1.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider10.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider2.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider3.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider4.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider5.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider6.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider7.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider8.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider9.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miencodingleft.caption
|
||
msgid "&Left"
|
||
msgstr "Gauche"
|
||
|
||
#: tfrmdiffer.miencodingright.caption
|
||
msgid "&Right"
|
||
msgstr "Droite"
|
||
|
||
#: tfrmdiffer.miseparator1.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miseparator2.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.mnuactions.caption
|
||
msgid "&Actions"
|
||
msgstr "&Actions"
|
||
|
||
#: tfrmdiffer.mnuedit.caption
|
||
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmdiffer.mnuencoding.caption
|
||
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Encodage"
|
||
|
||
#: tfrmdiffer.mnufile.caption
|
||
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "Fichier"
|
||
|
||
#: tfrmdiffer.mnuoptions.caption
|
||
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
|
||
msgid "&Options"
|
||
msgstr "&Options"
|
||
|
||
#: tfrmedithotkey.btnaddshortcut.hint
|
||
msgid "Add new shortcut to sequence"
|
||
msgstr "Ajouter un nouveau raccourcis à la séquence"
|
||
|
||
#: tfrmedithotkey.btncancel.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Annuler"
|
||
|
||
#: tfrmedithotkey.btnok.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmedithotkey.btnremoveshortcut.hint
|
||
msgid "Remove last shortcut from sequence"
|
||
msgstr "Retirer le dernier raccourcis de la séquence"
|
||
|
||
#: tfrmedithotkey.btnselectfromlist.hint
|
||
msgid "Select shortcut from list of remaining free available keys"
|
||
msgstr "Choisissiez votre raccourci-clavier de la liste des touches disponibles"
|
||
|
||
#: tfrmedithotkey.cghkcontrols.caption
|
||
msgctxt "tfrmedithotkey.cghkcontrols.caption"
|
||
msgid "Only for these controls"
|
||
msgstr "Seulement pour ces sections"
|
||
|
||
#: tfrmedithotkey.lblparameters.caption
|
||
msgid "&Parameters (each in a separate line):"
|
||
msgstr "Paramètre (chacun sur sa ligne unique)"
|
||
|
||
#: tfrmedithotkey.lblshortcuts.caption
|
||
msgid "Shortcuts:"
|
||
msgstr "Raccourcis :"
|
||
|
||
#: tfrmeditor.actabout.caption
|
||
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "A propos"
|
||
|
||
#: tfrmeditor.actabout.hint
|
||
msgctxt "tfrmeditor.actabout.hint"
|
||
msgid "About"
|
||
msgstr "A propos"
|
||
|
||
#: tfrmeditor.actconfhigh.caption
|
||
msgid "&Configuration"
|
||
msgstr "&Configuration"
|
||
|
||
#: tfrmeditor.actconfhigh.hint
|
||
msgctxt "tfrmeditor.actconfhigh.hint"
|
||
msgid "Configuration"
|
||
msgstr "Configuration"
|
||
|
||
#: tfrmeditor.acteditcopy.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmeditor.acteditcopy.hint
|
||
msgctxt "tfrmeditor.acteditcopy.hint"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmeditor.acteditcut.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: tfrmeditor.acteditcut.hint
|
||
msgctxt "tfrmeditor.acteditcut.hint"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: tfrmeditor.acteditdelete.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmeditor.acteditdelete.hint
|
||
msgctxt "tfrmeditor.acteditdelete.hint"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmeditor.acteditfind.caption
|
||
msgctxt "tfrmeditor.acteditfind.caption"
|
||
msgid "&Find"
|
||
msgstr "&Rechercher"
|
||
|
||
#: tfrmeditor.acteditfind.hint
|
||
msgctxt "tfrmeditor.acteditfind.hint"
|
||
msgid "Find"
|
||
msgstr "Rechercher"
|
||
|
||
#: tfrmeditor.acteditfindnext.caption
|
||
msgctxt "tfrmeditor.acteditfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Rechercher le suivant"
|
||
|
||
#: tfrmeditor.acteditfindnext.hint
|
||
msgctxt "tfrmeditor.acteditfindnext.hint"
|
||
msgid "Find next"
|
||
msgstr "Rechercher le suivant"
|
||
|
||
#: tfrmeditor.acteditfindprevious.caption
|
||
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
||
msgid "Find previous"
|
||
msgstr "Recherche précédent"
|
||
|
||
#: tfrmeditor.acteditgotoline.caption
|
||
msgctxt "tfrmeditor.acteditgotoline.caption"
|
||
msgid "Goto Line..."
|
||
msgstr "Allez à la ligne..."
|
||
|
||
#: tfrmeditor.acteditlineendcr.caption
|
||
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcr.hint
|
||
msgctxt "tfrmeditor.acteditlineendcr.hint"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.hint
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Window (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.hint
|
||
msgctxt "tfrmeditor.acteditlineendlf.hint"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditpaste.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: tfrmeditor.acteditpaste.hint
|
||
msgctxt "tfrmeditor.acteditpaste.hint"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: tfrmeditor.acteditredo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Refaire"
|
||
|
||
#: tfrmeditor.acteditredo.hint
|
||
msgctxt "tfrmeditor.acteditredo.hint"
|
||
msgid "Redo"
|
||
msgstr "Refaire"
|
||
|
||
#: tfrmeditor.acteditrplc.caption
|
||
msgid "&Replace"
|
||
msgstr "R&emplacer"
|
||
|
||
#: tfrmeditor.acteditrplc.hint
|
||
msgctxt "tfrmeditor.acteditrplc.hint"
|
||
msgid "Replace"
|
||
msgstr "Remplacer"
|
||
|
||
#: tfrmeditor.acteditselectall.caption
|
||
msgid "Select&All"
|
||
msgstr "&Tout sélectionner"
|
||
|
||
#: tfrmeditor.acteditselectall.hint
|
||
msgctxt "tfrmeditor.acteditselectall.hint"
|
||
msgid "Select All"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: tfrmeditor.acteditundo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmeditor.acteditundo.hint
|
||
msgctxt "tfrmeditor.acteditundo.hint"
|
||
msgid "Undo"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmeditor.actfileclose.caption
|
||
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Fermer"
|
||
|
||
#: tfrmeditor.actfileclose.hint
|
||
msgctxt "tfrmeditor.actfileclose.hint"
|
||
msgid "Close"
|
||
msgstr "Fermer"
|
||
|
||
#: tfrmeditor.actfileexit.caption
|
||
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "&Quitter"
|
||
|
||
#: tfrmeditor.actfileexit.hint
|
||
msgctxt "tfrmeditor.actfileexit.hint"
|
||
msgid "Exit"
|
||
msgstr "Sortie"
|
||
|
||
#: tfrmeditor.actfilenew.caption
|
||
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
|
||
msgid "&New"
|
||
msgstr "&Nouveau"
|
||
|
||
#: tfrmeditor.actfilenew.hint
|
||
msgctxt "tfrmeditor.actfilenew.hint"
|
||
msgid "New"
|
||
msgstr "Nouveau"
|
||
|
||
#: tfrmeditor.actfileopen.caption
|
||
msgid "&Open"
|
||
msgstr "&Ouvrir"
|
||
|
||
#: tfrmeditor.actfileopen.hint
|
||
msgctxt "tfrmeditor.actfileopen.hint"
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: tfrmeditor.actfilesave.caption
|
||
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Enregistrer"
|
||
|
||
#: tfrmeditor.actfilesave.hint
|
||
msgctxt "tfrmeditor.actfilesave.hint"
|
||
msgid "Save"
|
||
msgstr "Enregister"
|
||
|
||
#: tfrmeditor.actfilesaveas.caption
|
||
msgid "Save &As..."
|
||
msgstr "Enregistrer &sous"
|
||
|
||
#: tfrmeditor.actfilesaveas.hint
|
||
msgid "Save As"
|
||
msgstr "Sauvegarder sous"
|
||
|
||
#: tfrmeditor.actsaveall.caption
|
||
msgid "Sa&ve All"
|
||
msgstr "T&out enregistrer"
|
||
|
||
#: tfrmeditor.actsaveall.hint
|
||
msgid "Save All"
|
||
msgstr "Sauvegarder tout"
|
||
|
||
#: tfrmeditor.caption
|
||
msgctxt "tfrmeditor.caption"
|
||
msgid "Editor"
|
||
msgstr "Éditeur"
|
||
|
||
#: tfrmeditor.help1.caption
|
||
msgctxt "TFRMEDITOR.HELP1.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Ai&de"
|
||
|
||
#: tfrmeditor.menuitem1.caption
|
||
msgctxt "tfrmeditor.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.midiv.caption
|
||
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miedit.caption
|
||
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Édit&er"
|
||
|
||
#: tfrmeditor.miencoding.caption
|
||
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "En&codage"
|
||
|
||
#: tfrmeditor.miencodingin.caption
|
||
msgid "Open as"
|
||
msgstr "Ouvrir en :"
|
||
|
||
#: tfrmeditor.miencodingout.caption
|
||
msgctxt "tfrmeditor.miencodingout.caption"
|
||
msgid "Save as"
|
||
msgstr "Enregistrer en :"
|
||
|
||
#: tfrmeditor.mifile.caption
|
||
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Fichier"
|
||
|
||
#: tfrmeditor.mihighlight.caption
|
||
msgid "Syntax highlight"
|
||
msgstr "Coloration syntaxique"
|
||
|
||
#: tfrmeditor.milineendtype.caption
|
||
msgid "End Of Line"
|
||
msgstr "Fin de ligne"
|
||
|
||
#: tfrmeditor.miseparator1.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miseparator2.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n1.caption
|
||
msgctxt "TFRMEDITOR.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n3.caption
|
||
msgctxt "TFRMEDITOR.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n4.caption
|
||
msgctxt "TFRMEDITOR.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n5.caption
|
||
msgctxt "TFRMEDITOR.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
|
||
msgid "C&ase sensitivity"
|
||
msgstr "Sensibilité à la c&asse"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
|
||
msgid "S&earch from caret"
|
||
msgstr "Chercher à partir du curseur"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
|
||
msgid "&Regular expressions"
|
||
msgstr "Expression &régulière"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
|
||
msgid "Selected &text only"
|
||
msgstr "Seulement le &texte sélectionné"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
|
||
msgid "&Whole words only"
|
||
msgstr "Mots entiers uniquement"
|
||
|
||
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
|
||
msgid "Option"
|
||
msgstr "Option"
|
||
|
||
#: tfrmeditsearchreplace.lblreplacewith.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
|
||
msgid "&Replace with:"
|
||
msgstr "&remplacer avec :"
|
||
|
||
#: tfrmeditsearchreplace.lblsearchfor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
|
||
msgid "&Search for:"
|
||
msgstr "Chaine à R&echercher :"
|
||
|
||
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
|
||
msgid "Direction"
|
||
msgstr "Direction"
|
||
|
||
#: tfrmextractdlg.caption
|
||
msgctxt "TFRMEXTRACTDLG.CAPTION"
|
||
msgid "Unpack files"
|
||
msgstr "Extraire les fichiers"
|
||
|
||
#: tfrmextractdlg.cbextractpath.caption
|
||
msgid "&Unpack path names if stored with files"
|
||
msgstr "Extraire en utilisant les chemins des dossiers dans l'archive"
|
||
|
||
#: tfrmextractdlg.cbfilemask.text
|
||
msgctxt "tfrmextractdlg.cbfilemask.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmextractdlg.cbinseparatefolder.caption
|
||
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
||
msgstr "Extraire chaque archive dans un sous-dossier séparé (au nom de l'archive)"
|
||
|
||
#: tfrmextractdlg.cboverwrite.caption
|
||
msgid "O&verwrite existing files"
|
||
msgstr "&Écraser les fichier existants"
|
||
|
||
#: tfrmextractdlg.lblextractto.caption
|
||
msgid "To the &directory:"
|
||
msgstr "Dans le dossier :"
|
||
|
||
#: tfrmextractdlg.lblfilemask.caption
|
||
msgid "&Extract files matching file mask:"
|
||
msgstr "Extraire les fichiers correspondant au masque :"
|
||
|
||
#: tfrmextractdlg.lblpassword.caption
|
||
msgid "&Password for encrypted files:"
|
||
msgstr "Mot de passe pour les fichiers cryptés :"
|
||
|
||
#: tfrmfileexecuteyourself.btnclose.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Fermer"
|
||
|
||
#: tfrmfileexecuteyourself.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
|
||
msgid "Wait..."
|
||
msgstr "Attendre..."
|
||
|
||
#: tfrmfileexecuteyourself.lblfilename.caption
|
||
msgid "File name:"
|
||
msgstr "Nom de fichier :"
|
||
|
||
#: tfrmfileexecuteyourself.lblfrompath.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
|
||
msgid "From:"
|
||
msgstr "De :"
|
||
|
||
#: tfrmfileexecuteyourself.lblprompt.caption
|
||
msgid "Click on Close when the temporary file can be deleted!"
|
||
msgstr "Cliquer sur Fermer quand le fichier temporaire ne peut pas être supprimé !"
|
||
|
||
#: tfrmfileop.btncancel.caption
|
||
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmfileop.btnminimizetopanel.caption
|
||
msgid "&To panel"
|
||
msgstr "Vers le panneau"
|
||
|
||
#: tfrmfileop.btnviewoperations.caption
|
||
msgid "&View all"
|
||
msgstr "Voir tous"
|
||
|
||
#: tfrmfileop.lblcurrentoperation.caption
|
||
msgid "Current operation:"
|
||
msgstr "Opération courante :"
|
||
|
||
#: tfrmfileop.lblfrom.caption
|
||
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
||
msgid "From:"
|
||
msgstr "De :"
|
||
|
||
#: tfrmfileop.lblto.caption
|
||
msgid "To:"
|
||
msgstr "A :"
|
||
|
||
#: tfrmfileproperties.btnclose.caption
|
||
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Fermer"
|
||
|
||
#: tfrmfileproperties.btnsetproperties.caption
|
||
msgid "&Set properties"
|
||
msgstr "Ajuster les propriétés"
|
||
|
||
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
||
msgid "Set to &all selected files"
|
||
msgstr "Ajuster pour tous les fichiers sélectionnés"
|
||
|
||
#: tfrmfileproperties.btnskipfile.caption
|
||
msgid "Ski&p this file"
|
||
msgstr "Sauter ce fichier"
|
||
|
||
#: tfrmfileproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Propriétés"
|
||
|
||
#: tfrmfileproperties.cbsgid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmfileproperties.cbsticky.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Collant"
|
||
|
||
#: tfrmfileproperties.cbsuid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmfileproperties.chkexecutable.caption
|
||
msgid "Allow &executing file as program"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.gbowner.caption
|
||
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Propriétaire"
|
||
|
||
#: tfrmfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Bits :"
|
||
|
||
#: tfrmfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Groupe"
|
||
|
||
#: tfrmfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Autres"
|
||
|
||
#: tfrmfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Propriétaire"
|
||
|
||
#: tfrmfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Texte :"
|
||
|
||
#: tfrmfileproperties.lblcontains.caption
|
||
msgctxt "tfrmfileproperties.lblcontains.caption"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblcontainsstr.caption
|
||
msgid "Contains:"
|
||
msgstr "Contient :"
|
||
|
||
#: tfrmfileproperties.lblexec.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Exécuter"
|
||
|
||
#: tfrmfileproperties.lblexecutable.caption
|
||
msgid "Execute:"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.lblfile.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Nom du fichier"
|
||
|
||
#: tfrmfileproperties.lblfilename.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfilestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Nom du fichier : "
|
||
|
||
#: tfrmfileproperties.lblfolder.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfolderstr.caption
|
||
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
||
msgid "Path:"
|
||
msgstr "Chemin :"
|
||
|
||
#: tfrmfileproperties.lblgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
|
||
msgid "&Group"
|
||
msgstr "Groupe"
|
||
|
||
#: tfrmfileproperties.lbllastaccess.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastaccessstr.caption
|
||
msgid "Last access:"
|
||
msgstr "Dernier accès :"
|
||
|
||
#: tfrmfileproperties.lbllastmodif.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastmodifstr.caption
|
||
msgid "Last modification:"
|
||
msgstr "Dernière modification :"
|
||
|
||
#: tfrmfileproperties.lbllaststchange.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllaststchangestr.caption
|
||
msgid "Last status change:"
|
||
msgstr "Dernier changement de statut :"
|
||
|
||
#: tfrmfileproperties.lbloctal.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Octal :"
|
||
|
||
#: tfrmfileproperties.lblownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
|
||
msgid "O&wner"
|
||
msgstr "Propriétaire"
|
||
|
||
#: tfrmfileproperties.lblread.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Lecture"
|
||
|
||
#: tfrmfileproperties.lblsize.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsizestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
|
||
msgid "Size:"
|
||
msgstr "Taille :"
|
||
|
||
#: tfrmfileproperties.lblsymlink.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsymlinkstr.caption
|
||
msgid "Symlink to:"
|
||
msgstr "Lien symbolique vers :"
|
||
|
||
#: tfrmfileproperties.lbltype.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbltypestr.caption
|
||
msgid "Type:"
|
||
msgstr "Type :"
|
||
|
||
#: tfrmfileproperties.lblwrite.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Écriture"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: tfrmfileproperties.tsattributes.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Attributs"
|
||
|
||
#: tfrmfileproperties.tsimage.caption
|
||
msgid "Image"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.tsproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Propriétés"
|
||
|
||
#: tfrmfinddlg.actcancel.caption
|
||
msgctxt "tfrmfinddlg.actcancel.caption"
|
||
msgid "C&ancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmfinddlg.actcancelclose.caption
|
||
msgid "Cancel search and close window"
|
||
msgstr "&Fermer"
|
||
|
||
#: tfrmfinddlg.actclose.caption
|
||
msgctxt "tfrmfinddlg.actclose.caption"
|
||
msgid "&Close"
|
||
msgstr "Fermer"
|
||
|
||
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
||
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Configurations des raccourcis-clavier"
|
||
|
||
#: tfrmfinddlg.actedit.caption
|
||
msgctxt "tfrmfinddlg.actedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmfinddlg.actfeedtolistbox.caption
|
||
msgid "Feed to &listbox"
|
||
msgstr "Envoyer vers un &onglet"
|
||
|
||
#: tfrmfinddlg.actfreefrommem.caption
|
||
msgid "Cancel search, close and free from memory"
|
||
msgstr "Annule la recherche, ferme la fenêtre et oublie cette recherche"
|
||
|
||
#: tfrmfinddlg.actfreefrommemallothers.caption
|
||
msgid "For all other \"Find files\", cancel, close and free from memory"
|
||
msgstr "Pour toutes les autres recherches, annule-les, ferme-les et oublie-les"
|
||
|
||
#: tfrmfinddlg.actgotofile.caption
|
||
msgid "&Go to file"
|
||
msgstr "&Aller au fichier"
|
||
|
||
#: tfrmfinddlg.actintellifocus.caption
|
||
msgctxt "tfrmfinddlg.actintellifocus.caption"
|
||
msgid "Find Data"
|
||
msgstr "Cherche donnée"
|
||
|
||
#: tfrmfinddlg.actlastsearch.caption
|
||
msgid "&Last search"
|
||
msgstr "Dernière recherche"
|
||
|
||
#: tfrmfinddlg.actnewsearch.caption
|
||
msgid "&New search"
|
||
msgstr "&Nouvelle recherche"
|
||
|
||
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
||
msgid "New search (clear filters)"
|
||
msgstr "Nouvelle recherche (réinitialise les filtres)"
|
||
|
||
#: tfrmfinddlg.actpageadvanced.caption
|
||
msgid "Go to page \"Advanced\""
|
||
msgstr "Allez à la page \"Avancé\""
|
||
|
||
#: tfrmfinddlg.actpageloadsave.caption
|
||
msgid "Go to page \"Load/Save\""
|
||
msgstr "Aller à la page \"Charger/Sauvegarder\""
|
||
|
||
#: tfrmfinddlg.actpageplugins.caption
|
||
msgid "Go to page \"Plugins\""
|
||
msgstr "Aller à la page \"Plugins\""
|
||
|
||
#: tfrmfinddlg.actpageresults.caption
|
||
msgid "Go to page \"Results\""
|
||
msgstr "Aller à la page des résultats"
|
||
|
||
#: tfrmfinddlg.actpagestandard.caption
|
||
msgid "Go to page \"Standard\""
|
||
msgstr "Aller à la page \"Normal\""
|
||
|
||
#: tfrmfinddlg.actstart.caption
|
||
msgctxt "tfrmfinddlg.actstart.caption"
|
||
msgid "&Start"
|
||
msgstr "Démarrer"
|
||
|
||
#: tfrmfinddlg.actview.caption
|
||
msgctxt "tfrmfinddlg.actview.caption"
|
||
msgid "&View"
|
||
msgstr "&Vue"
|
||
|
||
#: tfrmfinddlg.btnaddattribute.caption
|
||
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Ajouter"
|
||
|
||
#: tfrmfinddlg.btnattrshelp.caption
|
||
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Ai&de"
|
||
|
||
#: tfrmfinddlg.btnsavetemplate.caption
|
||
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Enregister"
|
||
|
||
#: tfrmfinddlg.btnsearchdelete.caption
|
||
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Supprimer"
|
||
|
||
#: tfrmfinddlg.btnsearchload.caption
|
||
msgid "L&oad"
|
||
msgstr "&Charger"
|
||
|
||
#: tfrmfinddlg.btnsearchsave.caption
|
||
msgid "S&ave"
|
||
msgstr "&Enregistrer"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
||
msgid "Sa&ve with \"Start in directory\""
|
||
msgstr "Sauvegarder avec le nom du dossier de début de recherche"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
||
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
||
msgstr "Si sauvegardé, alors le dossier de début de recherche sera restitué lorsqu'on chargera le modèle. Utilisez cela si vous voulez chercher à nouveau dans un même dossier."
|
||
|
||
#: tfrmfinddlg.btnusetemplate.caption
|
||
msgid "Use template"
|
||
msgstr "Utiliser un modèle"
|
||
|
||
#: tfrmfinddlg.caption
|
||
msgctxt "tfrmfinddlg.caption"
|
||
msgid "Find files"
|
||
msgstr "Rechercher les fichiers"
|
||
|
||
#: tfrmfinddlg.cbcasesens.caption
|
||
msgid "Case sens&itive"
|
||
msgstr "Sensible à la &casse"
|
||
|
||
#: tfrmfinddlg.cbdatefrom.caption
|
||
msgid "&Date from:"
|
||
msgstr "Date début :"
|
||
|
||
#: tfrmfinddlg.cbdateto.caption
|
||
msgid "Dat&e to:"
|
||
msgstr "Date fin :"
|
||
|
||
#: tfrmfinddlg.cbfilesizefrom.caption
|
||
msgid "S&ize from:"
|
||
msgstr "Taille mini :"
|
||
|
||
#: tfrmfinddlg.cbfilesizeto.caption
|
||
msgid "Si&ze to:"
|
||
msgstr "Taille maxi :"
|
||
|
||
#: tfrmfinddlg.cbfindinarchive.caption
|
||
msgid "Search in &archives"
|
||
msgstr "Recherche dans les archives"
|
||
|
||
#: tfrmfinddlg.cbfindtext.caption
|
||
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
|
||
msgid "Find &text in file"
|
||
msgstr "Rechercher le &texte dans les fichiers"
|
||
|
||
#: tfrmfinddlg.cbfollowsymlinks.caption
|
||
msgctxt "tfrmfinddlg.cbfollowsymlinks.caption"
|
||
msgid "Follow s&ymlinks"
|
||
msgstr "Suivre les liens symboliques"
|
||
|
||
#: tfrmfinddlg.cbnotcontainingtext.caption
|
||
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
|
||
msgid "Find files N&OT containing the text"
|
||
msgstr "Rechercher les fichiers &ne contenant PAS le texte"
|
||
|
||
#: tfrmfinddlg.cbnotolderthan.caption
|
||
msgid "N&ot older than:"
|
||
msgstr "Pas plus vieux que :"
|
||
|
||
#: tfrmfinddlg.cbopenedtabs.caption
|
||
msgid "Opened tabs"
|
||
msgstr "Onglets ouverts"
|
||
|
||
#: tfrmfinddlg.cbpartialnamesearch.caption
|
||
msgid "Searc&h for part of file name"
|
||
msgstr "Recherche pour les parties de noms"
|
||
|
||
#: tfrmfinddlg.cbregexp.caption
|
||
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
|
||
msgid "&Regular expression"
|
||
msgstr "Expressions &régulières"
|
||
|
||
#: tfrmfinddlg.cbreplacetext.caption
|
||
msgid "Re&place by"
|
||
msgstr "Rem&placer par"
|
||
|
||
#: tfrmfinddlg.cbselectedfiles.caption
|
||
msgid "Selected directories and &files"
|
||
msgstr "Dossiers et fichiers sélectionnés"
|
||
|
||
#: tfrmfinddlg.cbtextregexp.caption
|
||
msgid "Regular &expression"
|
||
msgstr "Expression régulière"
|
||
|
||
#: tfrmfinddlg.cbtimefrom.caption
|
||
msgid "&Time from:"
|
||
msgstr "H. début :"
|
||
|
||
#: tfrmfinddlg.cbtimeto.caption
|
||
msgid "Ti&me to:"
|
||
msgstr "H. fin :"
|
||
|
||
#: tfrmfinddlg.cbuseplugin.caption
|
||
msgid "&Use search plugin:"
|
||
msgstr "&Utiliser le \"plugin\" de recherche :"
|
||
|
||
#: tfrmfinddlg.cmbexcludedirectories.hint
|
||
msgid "Enter directories names that should be excluded from search separated with \";\""
|
||
msgstr "Entrer les noms de dossiers à exclure de la recherche et les séparer par un point-virgule"
|
||
|
||
#: tfrmfinddlg.cmbexcludefiles.hint
|
||
msgid "Enter files names that should be excluded from search separated with \";\""
|
||
msgstr "Entrer les noms de fichiers à exclure de la recherche et les séparer par un point-virgule"
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.hint
|
||
msgid "Enter files names separated with \";\""
|
||
msgstr "Entrer les noms de fichiers séparés par un point-virgule"
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.text
|
||
msgctxt "TFRMFINDDLG.CMBFINDFILEMASK.TEXT"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmfinddlg.gbdirectories.caption
|
||
msgctxt "tfrmfinddlg.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Dossiers"
|
||
|
||
#: tfrmfinddlg.gbfiles.caption
|
||
msgctxt "tfrmfinddlg.gbfiles.caption"
|
||
msgid "Files"
|
||
msgstr "Fichiers"
|
||
|
||
#: tfrmfinddlg.gbfinddata.caption
|
||
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
||
msgid "Find Data"
|
||
msgstr "Chercher les données"
|
||
|
||
#: tfrmfinddlg.lblattributes.caption
|
||
msgid "Attri&butes"
|
||
msgstr "Attributs"
|
||
|
||
#: tfrmfinddlg.lblencoding.caption
|
||
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
|
||
msgid "Encodin&g:"
|
||
msgstr "Encodage :"
|
||
|
||
#: tfrmfinddlg.lblexcludedirectories.caption
|
||
msgid "E&xclude subdirectories"
|
||
msgstr "Exclure les sous-dossiers"
|
||
|
||
#: tfrmfinddlg.lblexcludefiles.caption
|
||
msgid "&Exclude files"
|
||
msgstr "Exclures les fichiers"
|
||
|
||
#: tfrmfinddlg.lblfindfilemask.caption
|
||
msgid "&File mask"
|
||
msgstr "Masque de &fichiers"
|
||
|
||
#: tfrmfinddlg.lblfindpathstart.caption
|
||
msgid "Start in &directory"
|
||
msgstr "Démarre la recherche dans le dossier"
|
||
|
||
#: tfrmfinddlg.lblsearchdepth.caption
|
||
msgid "Search su&bdirectories:"
|
||
msgstr "Rechercher dans les sous-dossiers :"
|
||
|
||
#: tfrmfinddlg.lbltemplateheader.caption
|
||
msgid "&Previous searches:"
|
||
msgstr "Recherches &précédentes :"
|
||
|
||
#: tfrmfinddlg.miaction.caption
|
||
msgid "&Action"
|
||
msgstr "&Action"
|
||
|
||
#: tfrmfinddlg.mifreefrommemallothers.caption
|
||
msgid "For all others, cancel, close and free from memory"
|
||
msgstr "Pour toutes les autres, annule-les, ferme-les et oublie-les"
|
||
|
||
#: tfrmfinddlg.miopeninnewtab.caption
|
||
msgid "Open In New Tab(s)"
|
||
msgstr "Ovrir dans un nouvel onglet"
|
||
|
||
#: tfrmfinddlg.mioptions.caption
|
||
msgctxt "tfrmfinddlg.mioptions.caption"
|
||
msgid "Options"
|
||
msgstr "Options"
|
||
|
||
#: tfrmfinddlg.miremovefromllist.caption
|
||
msgid "Remove from list"
|
||
msgstr "Supprimer de la liste"
|
||
|
||
#: tfrmfinddlg.miresult.caption
|
||
msgid "&Result"
|
||
msgstr "&Résultat"
|
||
|
||
#: tfrmfinddlg.miseparator1.caption
|
||
msgctxt "tfrmfinddlg.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.miseparator2.caption
|
||
msgctxt "tfrmfinddlg.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.mishowallfound.caption
|
||
msgid "Show all found items"
|
||
msgstr "Afficher tous les éléments trouvés"
|
||
|
||
#: tfrmfinddlg.mishowineditor.caption
|
||
msgid "Show In Editor"
|
||
msgstr "Ouvrir dans l'éditeur"
|
||
|
||
#: tfrmfinddlg.mishowinviewer.caption
|
||
msgid "Show In Viewer"
|
||
msgstr "Afficher dans la visionneuse"
|
||
|
||
#: tfrmfinddlg.miviewtab.caption
|
||
msgctxt "tfrmfinddlg.miviewtab.caption"
|
||
msgid "&View"
|
||
msgstr "&Vue"
|
||
|
||
#: tfrmfinddlg.tsadvanced.caption
|
||
msgid "Advanced"
|
||
msgstr "Avancé"
|
||
|
||
#: tfrmfinddlg.tsloadsave.caption
|
||
msgid "Load/Save"
|
||
msgstr "Charger/Sauvegarder"
|
||
|
||
#: tfrmfinddlg.tsplugins.caption
|
||
msgctxt "tfrmfinddlg.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "\"Plugins\""
|
||
|
||
#: tfrmfinddlg.tsresults.caption
|
||
msgid "Results"
|
||
msgstr "Résultat"
|
||
|
||
#: tfrmfinddlg.tsstandard.caption
|
||
msgid "Standard"
|
||
msgstr "Standard"
|
||
|
||
#: tfrmfindview.btnclose.caption
|
||
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmfindview.btnfind.caption
|
||
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
||
msgid "&Find"
|
||
msgstr "Rechercher"
|
||
|
||
#: tfrmfindview.caption
|
||
msgctxt "TFRMFINDVIEW.CAPTION"
|
||
msgid "Find"
|
||
msgstr "Rechercher"
|
||
|
||
#: tfrmfindview.cbcasesens.caption
|
||
msgid "C&ase sensitive"
|
||
msgstr "Sensible à la casse"
|
||
|
||
#: tfrmhardlink.btncancel.caption
|
||
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmhardlink.btnok.caption
|
||
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmhardlink.caption
|
||
msgid "Create hard link"
|
||
msgstr "Créer un lien dur (hardlink)"
|
||
|
||
#: tfrmhardlink.lblexistingfile.caption
|
||
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "Destination sur laquelle le lien va pointer"
|
||
|
||
#: tfrmhardlink.lbllinktocreate.caption
|
||
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "Nom du lien"
|
||
|
||
#: tfrmhotdirexportimport.btnselectall.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
|
||
msgid "Import all!"
|
||
msgstr "Importer tout!"
|
||
|
||
#: tfrmhotdirexportimport.btnselectiondone.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
|
||
msgid "Import selected"
|
||
msgstr "Importer ce qui est sélectionné"
|
||
|
||
#: tfrmhotdirexportimport.caption
|
||
msgctxt "tfrmhotdirexportimport.caption"
|
||
msgid "Select the entries your want to import"
|
||
msgstr "Choissiez l'entrée à importer"
|
||
|
||
#: tfrmhotdirexportimport.lbhint.caption
|
||
msgctxt "tfrmhotdirexportimport.lbhint.caption"
|
||
msgid "When clicking a sub-menu, it will select the whole menu"
|
||
msgstr "Lorsqu'on clique un sous-menu, cela le sélectionnera au complet"
|
||
|
||
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
||
msgid "Hold CTRL and click entries to select multiple ones"
|
||
msgstr "Maintenant la touche CTRL enfoncé et cliquez les entrées pour en choisir plus d'une à la fois"
|
||
|
||
#: tfrmlinker.btnsave.caption
|
||
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmlinker.caption
|
||
msgctxt "TFRMLINKER.CAPTION"
|
||
msgid "Linker"
|
||
msgstr "Concaténeur"
|
||
|
||
#: tfrmlinker.gbsaveto.caption
|
||
msgid "Save to..."
|
||
msgstr "Enregistrer sous..."
|
||
|
||
#: tfrmlinker.grbxcontrol.caption
|
||
msgid "Item"
|
||
msgstr "Élément"
|
||
|
||
#: tfrmlinker.lblfilename.caption
|
||
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
|
||
msgid "&File name"
|
||
msgstr "Nom du fichier"
|
||
|
||
#: tfrmlinker.spbtndown.caption
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
|
||
msgid "Do&wn"
|
||
msgstr "En dessous"
|
||
|
||
#: tfrmlinker.spbtndown.hint
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
|
||
msgid "Down"
|
||
msgstr "En dessous"
|
||
|
||
#: tfrmlinker.spbtnrem.caption
|
||
msgctxt "tfrmlinker.spbtnrem.caption"
|
||
msgid "&Remove"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmlinker.spbtnrem.hint
|
||
msgctxt "tfrmlinker.spbtnrem.hint"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmlinker.spbtnup.caption
|
||
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
|
||
msgid "&Up"
|
||
msgstr "Au dessus"
|
||
|
||
#: tfrmlinker.spbtnup.hint
|
||
msgctxt "TFRMLINKER.SPBTNUP.HINT"
|
||
msgid "Up"
|
||
msgstr "Au dessus"
|
||
|
||
#: tfrmmain.actabout.caption
|
||
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
|
||
msgid "&About"
|
||
msgstr "&A propos"
|
||
|
||
#: tfrmmain.actaddfilenametocmdline.caption
|
||
msgid "Add file name to command line"
|
||
msgstr "Ajouter le nom du fichier dans la ligne de commande"
|
||
|
||
#: tfrmmain.actaddnewsearch.caption
|
||
msgid "New search instance..."
|
||
msgstr "Nouvelle instance de recherche..."
|
||
|
||
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
||
msgid "Add path and file name to command line"
|
||
msgstr "Ajouter le chemin complet et le nom du fichier dans la ligne de commande"
|
||
|
||
#: tfrmmain.actaddpathtocmdline.caption
|
||
msgid "Copy path to command line"
|
||
msgstr "Copier le chemin vers la ligne de commande"
|
||
|
||
#: tfrmmain.actbriefview.caption
|
||
msgctxt "tfrmmain.actbriefview.caption"
|
||
msgid "Brief view"
|
||
msgstr "Vue résumée"
|
||
|
||
#: tfrmmain.actbriefview.hint
|
||
msgid "Brief View"
|
||
msgstr "Vue résumée"
|
||
|
||
#: tfrmmain.actcalculatespace.caption
|
||
msgid "Calculate &Occupied Space"
|
||
msgstr "Calcul de l'espace &occupé"
|
||
|
||
#: tfrmmain.actchangedir.caption
|
||
msgid "Change directory"
|
||
msgstr "Changer de dossier"
|
||
|
||
#: tfrmmain.actchangedirtohome.caption
|
||
msgid "Change directory to home"
|
||
msgstr "Aller au dossier d'accueil"
|
||
|
||
#: tfrmmain.actchangedirtoparent.caption
|
||
msgid "Change Directory To Parent"
|
||
msgstr "Aller au dossier parent"
|
||
|
||
#: tfrmmain.actchangedirtoroot.caption
|
||
msgid "Change directory to root"
|
||
msgstr "Aller au dossier racine"
|
||
|
||
#: tfrmmain.actchecksumcalc.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
|
||
msgid "Calculate Check&sum..."
|
||
msgstr "Calculer la &somme de contrôle..."
|
||
|
||
#: tfrmmain.actchecksumverify.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
|
||
msgid "&Verify Checksum..."
|
||
msgstr "&Vérifier la somme de contrôle..."
|
||
|
||
#: tfrmmain.actclearlogfile.caption
|
||
msgid "Clear log file"
|
||
msgstr "Effacer le fichier journal"
|
||
|
||
#: tfrmmain.actclearlogwindow.caption
|
||
msgid "Clear log window"
|
||
msgstr "Effacer la fenêtre du journal"
|
||
|
||
#: tfrmmain.actclosealltabs.caption
|
||
msgctxt "tfrmmain.actclosealltabs.caption"
|
||
msgid "Close &All Tabs"
|
||
msgstr "Fermer &tous les onglets"
|
||
|
||
#: tfrmmain.actcloseduplicatetabs.caption
|
||
msgid "Close Duplicate Tabs"
|
||
msgstr "Fermer les onglets doublons"
|
||
|
||
#: tfrmmain.actclosetab.caption
|
||
msgctxt "tfrmmain.actclosetab.caption"
|
||
msgid "&Close Tab"
|
||
msgstr "&Fermer l'onglet"
|
||
|
||
#: tfrmmain.actcmdlinenext.caption
|
||
msgid "Next Command Line"
|
||
msgstr "Prochaine ligne de commande"
|
||
|
||
#: tfrmmain.actcmdlinenext.hint
|
||
msgid "Set command line to next command in history"
|
||
msgstr "Ajuster la ligne de commande pour la suivante dans l'historique"
|
||
|
||
#: tfrmmain.actcmdlineprev.caption
|
||
msgid "Previous Command Line"
|
||
msgstr "Ligne de commande précédente"
|
||
|
||
#: tfrmmain.actcmdlineprev.hint
|
||
msgid "Set command line to previous command in history"
|
||
msgstr "Ajuster la ligne de commande pour la précédente dans l'historique"
|
||
|
||
#: tfrmmain.actcolumnsview.caption
|
||
msgid "Full"
|
||
msgstr "Complet"
|
||
|
||
#: tfrmmain.actcolumnsview.hint
|
||
msgid "Columns View"
|
||
msgstr "Vue colonne"
|
||
|
||
#: tfrmmain.actcomparecontents.caption
|
||
msgid "Compare by &Contents"
|
||
msgstr "Comparer le contenu"
|
||
|
||
#: tfrmmain.actcomparedirectories.caption
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
|
||
msgid "Compare Directories"
|
||
msgstr "Compare dossiers"
|
||
|
||
#: tfrmmain.actcomparedirectories.hint
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
||
msgid "Compare Directories"
|
||
msgstr "Compare dossiers."
|
||
|
||
#: tfrmmain.actconfigdirhotlist.caption
|
||
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Configuration de la liste des dossiers favoris"
|
||
|
||
#: tfrmmain.actconfigfavoritetabs.caption
|
||
msgid "Configuration of Favorite Tabs"
|
||
msgstr "Configuration des groupes d'onglets favoris"
|
||
|
||
#: tfrmmain.actconfigfoldertabs.caption
|
||
msgid "Configuration of folder tabs"
|
||
msgstr "Configuration des options reliées aux onlgets"
|
||
|
||
#: tfrmmain.actconfighotkeys.caption
|
||
msgctxt "tfrmmain.actconfighotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Configurations des raccourcis-clavier"
|
||
|
||
#: tfrmmain.actconfigsavesettings.caption
|
||
msgid "Save Settings"
|
||
msgstr "Enregistre la configuration"
|
||
|
||
#: tfrmmain.actconfigsearches.caption
|
||
msgid "Configuration of searches"
|
||
msgstr "Configuration de la recherche de fichiers"
|
||
|
||
#: tfrmmain.actconfigtoolbars.caption
|
||
msgid "Toolbar..."
|
||
msgstr "Configuation de la barre d'outils"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenus.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Configuration du menu en arbre"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Configuration des couleurs du menu en arbre"
|
||
|
||
#: tfrmmain.actcontextmenu.caption
|
||
msgid "Show context menu"
|
||
msgstr "Afficher le menu contextuel"
|
||
|
||
#: tfrmmain.actcopy.caption
|
||
msgctxt "tfrmmain.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmmain.actcopyalltabstoopposite.caption
|
||
msgid "Copy all tabs to opposite side"
|
||
msgstr "Copier tous les onglets sur le panneau opposé"
|
||
|
||
#: tfrmmain.actcopyfiledetailstoclip.caption
|
||
msgid "Copy all shown &columns"
|
||
msgstr "Copier toutes les colonnes affichées"
|
||
|
||
#: tfrmmain.actcopyfullnamestoclip.caption
|
||
msgid "Copy Filename(s) with Full &Path"
|
||
msgstr "Copier les fichiers avec l'&arborescence complète"
|
||
|
||
#: tfrmmain.actcopynamestoclip.caption
|
||
msgid "Copy &Filename(s) to Clipboard"
|
||
msgstr "Copier le &nom du(des) fichier(s) dans le presse-papier"
|
||
|
||
#: tfrmmain.actcopynoask.caption
|
||
msgid "Copy files without asking for confirmation"
|
||
msgstr "Copier les fichiers sans demander de confirmation"
|
||
|
||
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
||
msgstr "Copier le chemin complet de la sélection sans le séparateur de dossier final"
|
||
|
||
#: tfrmmain.actcopypathoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s)"
|
||
msgstr "Copier le chemin au complet des fichiers sélectionnés"
|
||
|
||
#: tfrmmain.actcopysamepanel.caption
|
||
msgid "Copy to same panel"
|
||
msgstr "Copier dans le même panneau"
|
||
|
||
#: tfrmmain.actcopytoclipboard.caption
|
||
msgid "&Copy"
|
||
msgstr "&Copier"
|
||
|
||
#: tfrmmain.actcountdircontent.caption
|
||
msgid "Sho&w Occupied Space"
|
||
msgstr "Afficher l'espace &occupé"
|
||
|
||
#: tfrmmain.actcuttoclipboard.caption
|
||
msgid "Cu&t"
|
||
msgstr "Co&uper"
|
||
|
||
#: tfrmmain.actdebugshowcommandparameters.caption
|
||
msgid "Show Command Parameters"
|
||
msgstr "Affiche les paramètres des commandes"
|
||
|
||
#: tfrmmain.actdelete.caption
|
||
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmmain.actdeletesearches.caption
|
||
msgid "For all searches, cancel, close and free memory"
|
||
msgstr "Pour toutes les recherches, annule-les, ferme-les et oublie-les"
|
||
|
||
#: tfrmmain.actdirhistory.caption
|
||
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
|
||
msgid "Directory history"
|
||
msgstr "Historique des dossiers"
|
||
|
||
#: tfrmmain.actdirhotlist.caption
|
||
msgid "Directory &Hotlist"
|
||
msgstr "Dossiers &favoris"
|
||
|
||
#: tfrmmain.actdoanycmcommand.caption
|
||
msgid "Select any command and execute it"
|
||
msgstr "Choisissez n'importe quelle commande et l'exécuter"
|
||
|
||
#: tfrmmain.actedit.caption
|
||
msgctxt "tfrmmain.actedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmmain.acteditcomment.caption
|
||
msgid "Edit Co&mment..."
|
||
msgstr "Éditer le commentaire"
|
||
|
||
#: tfrmmain.acteditnew.caption
|
||
msgid "Edit new file"
|
||
msgstr "Éditer le nouveau fichier"
|
||
|
||
#: tfrmmain.acteditpath.caption
|
||
msgid "Edit path field above file list"
|
||
msgstr "Éditer le champ du chemin au dessus de la liste des fichiers"
|
||
|
||
#: tfrmmain.actexchange.caption
|
||
msgid "Swap &Panels"
|
||
msgstr "&Permuter les panneaux"
|
||
|
||
#: tfrmmain.actexecutescript.caption
|
||
msgid "Execute Script"
|
||
msgstr "Exécute le script"
|
||
|
||
#: tfrmmain.actexit.caption
|
||
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "&Quitter"
|
||
|
||
#: tfrmmain.actextractfiles.caption
|
||
msgid "&Extract Files..."
|
||
msgstr "&Extraire les fichiers..."
|
||
|
||
#: tfrmmain.actfileassoc.caption
|
||
msgid "Configuration of File &Associations"
|
||
msgstr "Configuration des associations d'extension de fichiers"
|
||
|
||
#: tfrmmain.actfilelinker.caption
|
||
msgid "Com&bine Files..."
|
||
msgstr "Conca&téner les fichiers..."
|
||
|
||
#: tfrmmain.actfileproperties.caption
|
||
msgid "Show &File Properties"
|
||
msgstr "Afficher les &propriétés des fichiers"
|
||
|
||
#: tfrmmain.actfilespliter.caption
|
||
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
|
||
msgid "Spl&it File..."
|
||
msgstr "&Découper un fichier..."
|
||
|
||
#: tfrmmain.actflatview.caption
|
||
msgid "&Flat view"
|
||
msgstr "Vue à plat"
|
||
|
||
#: tfrmmain.actfocuscmdline.caption
|
||
msgid "Focus command line"
|
||
msgstr "Mettre la contrôle actif sur la ligne de commande"
|
||
|
||
#: tfrmmain.actfocusswap.caption
|
||
msgid "Swap focus"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actfocusswap.hint
|
||
msgid "Switch between left and right file list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actgotofirstfile.caption
|
||
msgid "Place cursor on first file in list"
|
||
msgstr "Placer le curseur sur le premier fichier de la liste"
|
||
|
||
#: tfrmmain.actgotolastfile.caption
|
||
msgid "Place cursor on last file in list"
|
||
msgstr "Placer le curseur sur le dernier fichier de la liste"
|
||
|
||
#: tfrmmain.acthardlink.caption
|
||
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
|
||
msgid "Create &Hard Link..."
|
||
msgstr "Créer un lien d&ur (hardlink)"
|
||
|
||
#: tfrmmain.acthelpindex.caption
|
||
msgid "&Contents"
|
||
msgstr "&Index de l'aide"
|
||
|
||
#: tfrmmain.acthorizontalfilepanels.caption
|
||
msgid "&Horizontal Panels Mode"
|
||
msgstr "Mode &horizontal pour les panneaux"
|
||
|
||
#: tfrmmain.actkeyboard.caption
|
||
msgid "&Keyboard"
|
||
msgstr "Raccourcis &clavier"
|
||
|
||
#: tfrmmain.actleftbriefview.caption
|
||
msgid "Brief view on left panel"
|
||
msgstr "Vue résumée dans le panneau de gauche"
|
||
|
||
#: tfrmmain.actleftcolumnsview.caption
|
||
msgid "Columns view on left panel"
|
||
msgstr "Vue colonne sur le panneau de gauche"
|
||
|
||
#: tfrmmain.actleftequalright.caption
|
||
msgid "Left &= Right"
|
||
msgstr "Gauche &= Droite"
|
||
|
||
#: tfrmmain.actleftflatview.caption
|
||
msgid "&Flat view on left panel"
|
||
msgstr "Vue à plat sur le panneau de gauche"
|
||
|
||
#: tfrmmain.actleftopendrives.caption
|
||
msgid "Open left drive list"
|
||
msgstr "Ouvrir la liste des volumes de gauche"
|
||
|
||
#: tfrmmain.actleftreverseorder.caption
|
||
msgid "Re&verse order on left panel"
|
||
msgstr "Inverse l'ordre dans le panneau de gauche"
|
||
|
||
#: tfrmmain.actleftsortbyattr.caption
|
||
msgid "Sort left panel by &Attributes"
|
||
msgstr "Trier le panneau de gauche par attribut"
|
||
|
||
#: tfrmmain.actleftsortbydate.caption
|
||
msgid "Sort left panel by &Date"
|
||
msgstr "Trier le panneau de gauche par date"
|
||
|
||
#: tfrmmain.actleftsortbyext.caption
|
||
msgid "Sort left panel by &Extension"
|
||
msgstr "Trier le panneau de gauche par extension"
|
||
|
||
#: tfrmmain.actleftsortbyname.caption
|
||
msgid "Sort left panel by &Name"
|
||
msgstr "Trier le panneau de gauche par nom"
|
||
|
||
#: tfrmmain.actleftsortbysize.caption
|
||
msgid "Sort left panel by &Size"
|
||
msgstr "Trier le panneau de gauche par taille"
|
||
|
||
#: tfrmmain.actleftthumbview.caption
|
||
msgid "Thumbnails view on left panel"
|
||
msgstr "Vue vignette sur le panneau gauche"
|
||
|
||
#: tfrmmain.actloadfavoritetabs.caption
|
||
msgid "Load tabs from Favorite Tabs"
|
||
msgstr "Charger un groupe d'onglets favoris"
|
||
|
||
#: tfrmmain.actloadselectionfromclip.caption
|
||
msgid "Load Selection from Clip&board"
|
||
msgstr "Charger la sélection depuis le &presse-papier"
|
||
|
||
#: tfrmmain.actloadselectionfromfile.caption
|
||
msgid "&Load Selection from File..."
|
||
msgstr "&Charger la sélection depuis un fichier..."
|
||
|
||
#: tfrmmain.actloadtabs.caption
|
||
msgid "&Load Tabs from File"
|
||
msgstr "Charger les onglets d'un fichier"
|
||
|
||
#: tfrmmain.actmakedir.caption
|
||
msgid "Create &Directory"
|
||
msgstr "Nouveau dossier"
|
||
|
||
#: tfrmmain.actmarkcurrentextension.caption
|
||
msgid "Select All with the Same E&xtension"
|
||
msgstr "Sélectionner tous les fichiers avec la même &extension"
|
||
|
||
#: tfrmmain.actmarkcurrentname.caption
|
||
msgid "Select all files with same name"
|
||
msgstr "Sélectionne tous les fichiers du même nom"
|
||
|
||
#: tfrmmain.actmarkcurrentnameext.caption
|
||
msgid "Select all files with same name and extension"
|
||
msgstr "Sélectionne tous les fichiers du même nom et la même extension"
|
||
|
||
#: tfrmmain.actmarkcurrentpath.caption
|
||
msgid "Select all in same path"
|
||
msgstr "Sélectionne tous les fichiers avec le même chemin"
|
||
|
||
#: tfrmmain.actmarkinvert.caption
|
||
msgid "&Invert Selection"
|
||
msgstr "&Inverser la sélection"
|
||
|
||
#: tfrmmain.actmarkmarkall.caption
|
||
msgid "&Select All"
|
||
msgstr "&Tout sélectionner"
|
||
|
||
#: tfrmmain.actmarkminus.caption
|
||
msgid "Unselect a Gro&up..."
|
||
msgstr "Désélectionner un &groupe"
|
||
|
||
#: tfrmmain.actmarkplus.caption
|
||
msgid "Select a &Group..."
|
||
msgstr "&Sélectionner un groupe"
|
||
|
||
#: tfrmmain.actmarkunmarkall.caption
|
||
msgid "&Unselect All"
|
||
msgstr "Tout &désélectionner"
|
||
|
||
#: tfrmmain.actminimize.caption
|
||
msgid "Minimize window"
|
||
msgstr "Minimiser la fenêtre"
|
||
|
||
#: tfrmmain.actmultirename.caption
|
||
msgid "Multi &Rename Tool"
|
||
msgstr "Outil pour &renommer par lot"
|
||
|
||
#: tfrmmain.actnetworkconnect.caption
|
||
msgid "Network &Connect..."
|
||
msgstr "&Connexion au réseau"
|
||
|
||
#: tfrmmain.actnetworkdisconnect.caption
|
||
msgid "Network &Disconnect"
|
||
msgstr "&Déconnexion du réseau"
|
||
|
||
#: tfrmmain.actnetworkquickconnect.caption
|
||
msgid "Network &Quick Connect..."
|
||
msgstr "Connexion &rapide au réseau..."
|
||
|
||
#: tfrmmain.actnewtab.caption
|
||
msgid "&New Tab"
|
||
msgstr "&Nouvel onglet"
|
||
|
||
#: tfrmmain.actnextfavoritetabs.caption
|
||
msgid "Load the Next Favorite Tabs in the list"
|
||
msgstr "Charger le groupe suivant d'onglets favoris"
|
||
|
||
#: tfrmmain.actnexttab.caption
|
||
msgid "Switch to Nex&t Tab"
|
||
msgstr "Onglet &suivant"
|
||
|
||
#: tfrmmain.actopen.caption
|
||
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: tfrmmain.actopenarchive.caption
|
||
msgid "Try open archive"
|
||
msgstr "Tentative d'ouverture de l'archive"
|
||
|
||
#: tfrmmain.actopenbar.caption
|
||
msgid "Open bar file"
|
||
msgstr "Ouvre un fichier de barre"
|
||
|
||
#: tfrmmain.actopendirinnewtab.caption
|
||
msgid "Open &Folder in a New Tab"
|
||
msgstr "Ouvrir le &dossier dans un nouvel onglet"
|
||
|
||
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
||
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
|
||
msgid "Open &VFS List"
|
||
msgstr "Ouvrir la liste des VFS"
|
||
|
||
#: tfrmmain.actoperationsviewer.caption
|
||
msgid "Operations &Viewer"
|
||
msgstr "&Voir les opérations en cours"
|
||
|
||
#: tfrmmain.actoptions.caption
|
||
msgid "&Options..."
|
||
msgstr "&Options..."
|
||
|
||
#: tfrmmain.actpackfiles.caption
|
||
msgid "&Pack Files..."
|
||
msgstr "&Compresser les fichiers..."
|
||
|
||
#: tfrmmain.actpanelssplitterperpos.caption
|
||
msgid "Set splitter position"
|
||
msgstr "Définir la position du séparateur de panneau"
|
||
|
||
#: tfrmmain.actpastefromclipboard.caption
|
||
msgid "&Paste"
|
||
msgstr "Co&ller"
|
||
|
||
#: tfrmmain.actpreviousfavoritetabs.caption
|
||
msgid "Load the Previous Favorite Tabs in the list"
|
||
msgstr "Charger le groupe précédent d'onglets favoris"
|
||
|
||
#: tfrmmain.actprevtab.caption
|
||
msgid "Switch to &Previous Tab"
|
||
msgstr "Onglet &précédent"
|
||
|
||
#: tfrmmain.actquickfilter.caption
|
||
msgid "Quick filter"
|
||
msgstr "Filtre rapide"
|
||
|
||
#: tfrmmain.actquicksearch.caption
|
||
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
|
||
msgid "Quick search"
|
||
msgstr "Recherche rapide"
|
||
|
||
#: tfrmmain.actquickview.caption
|
||
msgid "&Quick View Panel"
|
||
msgstr "&Panneau de visualisation rapide"
|
||
|
||
#: tfrmmain.actrefresh.caption
|
||
msgid "&Refresh"
|
||
msgstr "&Rafraichir"
|
||
|
||
#: tfrmmain.actreloadfavoritetabs.caption
|
||
msgid "Reload the last Favorite Tabs loaded"
|
||
msgstr "Recharger le groupe courant d'onglets favoris"
|
||
|
||
#: tfrmmain.actrename.caption
|
||
msgctxt "tfrmmain.actrename.caption"
|
||
msgid "Move"
|
||
msgstr "Déplacer"
|
||
|
||
#: tfrmmain.actrenamenoask.caption
|
||
msgid "Move/Rename files without asking for confirmation"
|
||
msgstr "Déplacer/Renommer les fichiers sans demande de confirmation"
|
||
|
||
#: tfrmmain.actrenameonly.caption
|
||
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: tfrmmain.actrenametab.caption
|
||
msgid "&Rename Tab"
|
||
msgstr "Re&nommer l'onglet"
|
||
|
||
#: tfrmmain.actresavefavoritetabs.caption
|
||
msgid "Resave on the last Favorite Tabs loaded"
|
||
msgstr "Resauvegarder les onglets courants dans un groupe d'onglets favoris"
|
||
|
||
#: tfrmmain.actrestoreselection.caption
|
||
msgid "&Restore Selection"
|
||
msgstr "&Restaurer la sélection"
|
||
|
||
#: tfrmmain.actreverseorder.caption
|
||
msgid "Re&verse Order"
|
||
msgstr "Inverser l'ordre"
|
||
|
||
#: tfrmmain.actrightbriefview.caption
|
||
msgid "Brief view on right panel"
|
||
msgstr "Vue résumée dans le panneau de droite"
|
||
|
||
#: tfrmmain.actrightcolumnsview.caption
|
||
msgid "Columns view on right panel"
|
||
msgstr "Vue colonne sur le panneau de droite"
|
||
|
||
#: tfrmmain.actrightequalleft.caption
|
||
msgid "Right &= Left"
|
||
msgstr "Droite &= Gauche"
|
||
|
||
#: tfrmmain.actrightflatview.caption
|
||
msgid "&Flat view on right panel"
|
||
msgstr "Vue à plat sur le panneau de droite"
|
||
|
||
#: tfrmmain.actrightopendrives.caption
|
||
msgid "Open right drive list"
|
||
msgstr "Ouvrir la liste des volumes/disques de droite"
|
||
|
||
#: tfrmmain.actrightreverseorder.caption
|
||
msgid "Re&verse order on right panel"
|
||
msgstr "Iverser l'ordre de tri sur le panneau de droite"
|
||
|
||
#: tfrmmain.actrightsortbyattr.caption
|
||
msgid "Sort right panel by &Attributes"
|
||
msgstr "Trier le panneau de droite par attribut"
|
||
|
||
#: tfrmmain.actrightsortbydate.caption
|
||
msgid "Sort right panel by &Date"
|
||
msgstr "Trier le panneau de droite par date"
|
||
|
||
#: tfrmmain.actrightsortbyext.caption
|
||
msgid "Sort right panel by &Extension"
|
||
msgstr "Trier le panneau de droite par extension"
|
||
|
||
#: tfrmmain.actrightsortbyname.caption
|
||
msgid "Sort right panel by &Name"
|
||
msgstr "Trier le panneau de droite par nom"
|
||
|
||
#: tfrmmain.actrightsortbysize.caption
|
||
msgid "Sort right panel by &Size"
|
||
msgstr "Trier le panneau de droite par taille"
|
||
|
||
#: tfrmmain.actrightthumbview.caption
|
||
msgid "Thumbnails view on right panel"
|
||
msgstr "Vue \"Vignette\" dans le panneau de droite"
|
||
|
||
#: tfrmmain.actrunterm.caption
|
||
msgid "Run &Terminal"
|
||
msgstr "Ouvrir un &terminal"
|
||
|
||
#: tfrmmain.actsavefavoritetabs.caption
|
||
msgid "Save current tabs to a New Favorite Tabs"
|
||
msgstr "Sauvegarder les onglets courants dans un groupe d'onglets favoris"
|
||
|
||
#: tfrmmain.actsaveselection.caption
|
||
msgid "Sa&ve Selection"
|
||
msgstr "Sau&vegarder la sélection"
|
||
|
||
#: tfrmmain.actsaveselectiontofile.caption
|
||
msgid "Save S&election to File..."
|
||
msgstr "Sauv&egarder la sélection dans un fichier..."
|
||
|
||
#: tfrmmain.actsavetabs.caption
|
||
msgid "&Save Tabs to File"
|
||
msgstr "Sauvegarde des onglets dans un fichier"
|
||
|
||
#: tfrmmain.actsearch.caption
|
||
msgid "&Search..."
|
||
msgstr "&Chercher..."
|
||
|
||
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
||
msgid "All tabs Locked with Dir Opened in New Tabs"
|
||
msgstr "Tous les onglets verrouillés avec les dossiers ouverts dans des nouveaux onglets"
|
||
|
||
#: tfrmmain.actsetalltabsoptionnormal.caption
|
||
msgid "Set all tabs to Normal"
|
||
msgstr "Tous les onglets déverrouillés"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
||
msgid "Set all tabs to Locked"
|
||
msgstr "Tous les onglets verrouillés"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
||
msgid "All tabs Locked with Dir Changes Allowed"
|
||
msgstr "Tous les onglets verrouillés avec les changements de &dossiers autorisés"
|
||
|
||
#: tfrmmain.actsetfileproperties.caption
|
||
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change &Attributes..."
|
||
msgstr "Changer les &attributs..."
|
||
|
||
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
||
msgid "Locked with Directories Opened in New &Tabs"
|
||
msgstr "Verrouillé avec les dossiers ouverts dans des nouveaux &onglets"
|
||
|
||
#: tfrmmain.actsettaboptionnormal.caption
|
||
msgid "&Normal"
|
||
msgstr "&Normal"
|
||
|
||
#: tfrmmain.actsettaboptionpathlocked.caption
|
||
msgid "&Locked"
|
||
msgstr "&Verrouillé"
|
||
|
||
#: tfrmmain.actsettaboptionpathresets.caption
|
||
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
|
||
msgid "Locked with &Directory Changes Allowed"
|
||
msgstr "Verrouillé avec les changements de &dossiers autorisés"
|
||
|
||
#: tfrmmain.actshellexecute.caption
|
||
msgctxt "tfrmmain.actshellexecute.caption"
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: tfrmmain.actshellexecute.hint
|
||
msgid "Open using system associations"
|
||
msgstr "Ouvrir en utilisant les associations-système"
|
||
|
||
#: tfrmmain.actshowbuttonmenu.caption
|
||
msgid "Show button menu"
|
||
msgstr "Afficher les boutons dans le menu"
|
||
|
||
#: tfrmmain.actshowcmdlinehistory.caption
|
||
msgid "Show command line history"
|
||
msgstr "Afficher l'historique des commandes"
|
||
|
||
#: tfrmmain.actshowmainmenu.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
|
||
msgid "Menu"
|
||
msgstr "Menu"
|
||
|
||
#: tfrmmain.actshowsysfiles.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
|
||
msgid "Show &Hidden/System Files"
|
||
msgstr "Afficher les fichiers &cachés et système"
|
||
|
||
#: tfrmmain.actsortbyattr.caption
|
||
msgid "Sort by &Attributes"
|
||
msgstr "Trier par &Attributs"
|
||
|
||
#: tfrmmain.actsortbydate.caption
|
||
msgid "Sort by &Date"
|
||
msgstr "Trier par &Date"
|
||
|
||
#: tfrmmain.actsortbyext.caption
|
||
msgid "Sort by &Extension"
|
||
msgstr "Trier par &Extension"
|
||
|
||
#: tfrmmain.actsortbyname.caption
|
||
msgid "Sort by &Name"
|
||
msgstr "Trier par &Nom"
|
||
|
||
#: tfrmmain.actsortbysize.caption
|
||
msgid "Sort by &Size"
|
||
msgstr "Trier par &Taille"
|
||
|
||
#: tfrmmain.actsrcopendrives.caption
|
||
msgid "Open drive list"
|
||
msgstr "Ouvre la liste des lecteurs"
|
||
|
||
#: tfrmmain.actswitchignorelist.caption
|
||
msgid "Enable/disable ignore list file to not show file names"
|
||
msgstr "Activer/désactiver la liste des fichiers/dossiers ignorés"
|
||
|
||
#: tfrmmain.actsymlink.caption
|
||
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
|
||
msgid "Create Symbolic &Link..."
|
||
msgstr "Créer un &lien symbolique..."
|
||
|
||
#: tfrmmain.actsyncdirs.caption
|
||
msgid "Synchronize dirs..."
|
||
msgstr "Appairer les dossiers..."
|
||
|
||
#: tfrmmain.acttargetequalsource.caption
|
||
msgid "Target &= Source"
|
||
msgstr "Cible &= Source"
|
||
|
||
#: tfrmmain.acttestarchive.caption
|
||
msgid "&Test Archive(s)"
|
||
msgstr "&Tester une(des) archive(s)"
|
||
|
||
#: tfrmmain.actthumbnailsview.caption
|
||
msgctxt "tfrmmain.actthumbnailsview.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Vignettes"
|
||
|
||
#: tfrmmain.actthumbnailsview.hint
|
||
msgid "Thumbnails View"
|
||
msgstr "Vue \"Vignette\""
|
||
|
||
#: tfrmmain.acttogglefullscreenconsole.caption
|
||
msgid "Toggle fullscreen mode console"
|
||
msgstr "Alterner la vue plein écran du mode console"
|
||
|
||
#: tfrmmain.acttransferleft.caption
|
||
msgid "Transfer dir under cursor to left window"
|
||
msgstr "Ouvrir le dossier sous le curseur dans l'onglet du panneau de gauche"
|
||
|
||
#: tfrmmain.acttransferright.caption
|
||
msgid "Transfer dir under cursor to right window"
|
||
msgstr "Ouvrir le dossier sous le curseur dans l'onglet du panneau de droite"
|
||
|
||
#: tfrmmain.acttreeview.caption
|
||
msgid "&Tree View Panel"
|
||
msgstr "Vue du panneau d'arborescence"
|
||
|
||
#: tfrmmain.actuniversalsingledirectsort.caption
|
||
msgid "Sort according to parameters"
|
||
msgstr "Trier selon les paramètres"
|
||
|
||
#: tfrmmain.actunmarkcurrentextension.caption
|
||
msgid "Unselect All with the Same Ex&tension"
|
||
msgstr "Désélectionner tous les fichiers avec la &même extension"
|
||
|
||
#: tfrmmain.actunmarkcurrentname.caption
|
||
msgid "Unselect all files with same name"
|
||
msgstr "Désélectionne tous les fichiers du même nom"
|
||
|
||
#: tfrmmain.actunmarkcurrentnameext.caption
|
||
msgid "Unselect all files with same name and extension"
|
||
msgstr "Désélectionne tous les fichiers du même nom et la même extension"
|
||
|
||
#: tfrmmain.actunmarkcurrentpath.caption
|
||
msgid "Unselect all in same path"
|
||
msgstr "Désélectionne tous les fichiers avec le même chemin"
|
||
|
||
#: tfrmmain.actview.caption
|
||
msgctxt "tfrmmain.actview.caption"
|
||
msgid "View"
|
||
msgstr "Voir"
|
||
|
||
#: tfrmmain.actviewhistory.caption
|
||
msgid "Show history of visited paths for active view"
|
||
msgstr "Afficher l'historique des chemins visités pour la vue active"
|
||
|
||
#: tfrmmain.actviewhistorynext.caption
|
||
msgid "Go to next entry in history"
|
||
msgstr "Aller à l'entrée suivante de l'historique"
|
||
|
||
#: tfrmmain.actviewhistoryprev.caption
|
||
msgid "Go to previous entry in history"
|
||
msgstr "Aller à l'entrée précédente de l'historique"
|
||
|
||
#: tfrmmain.actviewlogfile.caption
|
||
msgid "View log file"
|
||
msgstr "Regarder le fichier journal"
|
||
|
||
#: tfrmmain.actviewsearches.caption
|
||
msgid "View current search instances"
|
||
msgstr "Voir la liste des instances de recherche de fichiers"
|
||
|
||
#: tfrmmain.actvisithomepage.caption
|
||
msgid "&Visit Double Commander Website"
|
||
msgstr "&Visiter le site Web de Double Commander"
|
||
|
||
#: tfrmmain.actwipe.caption
|
||
msgid "Wipe"
|
||
msgstr "Effacement Sécurisé"
|
||
|
||
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
||
msgid "Work with Directory Hotlist and parameters"
|
||
msgstr "Work with Directory Hotlist and parameters"
|
||
|
||
#: tfrmmain.btnf10.caption
|
||
msgctxt "tfrmmain.btnf10.caption"
|
||
msgid "Exit"
|
||
msgstr "Quitter"
|
||
|
||
#: tfrmmain.btnf7.caption
|
||
msgctxt "tfrmmain.btnf7.caption"
|
||
msgid "Directory"
|
||
msgstr "Dossier"
|
||
|
||
#: tfrmmain.btnf8.caption
|
||
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmmain.btnf9.caption
|
||
msgctxt "tfrmmain.btnf9.caption"
|
||
msgid "Terminal"
|
||
msgstr "Terminal"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Liste des dossiers favoris"
|
||
|
||
#: tfrmmain.btnleftequalright.caption
|
||
msgctxt "tfrmmain.btnleftequalright.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmmain.btnleftequalright.hint
|
||
msgid "Show current directory of the right panel in the left panel"
|
||
msgstr "Afficher le même dossier que celui actif dans le panneau opposé"
|
||
|
||
#: tfrmmain.btnlefthome.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnlefthome.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
|
||
msgid "Go to home directory"
|
||
msgstr "Aller au dossier personnel"
|
||
|
||
#: tfrmmain.btnleftroot.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnleftroot.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
|
||
msgid "Go to root directory"
|
||
msgstr "Aller au dossier racine"
|
||
|
||
#: tfrmmain.btnleftup.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.btnleftup.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
|
||
msgid "Go to parent directory"
|
||
msgstr "Aller au dossier parent"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.hint
|
||
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Dossiers favoris"
|
||
|
||
#: tfrmmain.btnrightequalleft.caption
|
||
msgctxt "tfrmmain.btnrightequalleft.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmmain.btnrightequalleft.hint
|
||
msgid "Show current directory of the left panel in the right panel"
|
||
msgstr "Afficher le même dossier que celui actif dans le panneau opposé"
|
||
|
||
#: tfrmmain.btnrighthome.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnrightroot.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnrightup.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.caption
|
||
msgctxt "tfrmmain.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmain.lblcommandpath.caption
|
||
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
|
||
msgid "Path"
|
||
msgstr "Chemin"
|
||
|
||
#: tfrmmain.menuitem2.caption
|
||
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mi2080.caption
|
||
msgid "&20/80"
|
||
msgstr "&20/80"
|
||
|
||
#: tfrmmain.mi3070.caption
|
||
msgid "&30/70"
|
||
msgstr "&30/70"
|
||
|
||
#: tfrmmain.mi4060.caption
|
||
msgid "&40/60"
|
||
msgstr "&40/60"
|
||
|
||
#: tfrmmain.mi5050.caption
|
||
msgid "&50/50"
|
||
msgstr "&50/50"
|
||
|
||
#: tfrmmain.mi6040.caption
|
||
msgid "&60/40"
|
||
msgstr "&60/40"
|
||
|
||
#: tfrmmain.mi7030.caption
|
||
msgid "&70/30"
|
||
msgstr "&70/30"
|
||
|
||
#: tfrmmain.mi8020.caption
|
||
msgid "&80/20"
|
||
msgstr "&80/20"
|
||
|
||
#: tfrmmain.micancel.caption
|
||
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmmain.micopy.caption
|
||
msgid "Copy..."
|
||
msgstr "Copier..."
|
||
|
||
#: tfrmmain.mihardlink.caption
|
||
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
|
||
msgid "Create link..."
|
||
msgstr "Créer un lien..."
|
||
|
||
#: tfrmmain.miline1.caption
|
||
msgctxt "TFRMMAIN.MILINE1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline10.caption
|
||
msgctxt "tfrmmain.miline10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline11.caption
|
||
msgctxt "tfrmmain.miline11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline12.caption
|
||
msgctxt "TFRMMAIN.MILINE12.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline13.caption
|
||
msgctxt "TFRMMAIN.MILINE13.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline14.caption
|
||
msgctxt "TFRMMAIN.MILINE14.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline15.caption
|
||
msgctxt "TFRMMAIN.MILINE15.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline16.caption
|
||
msgctxt "TFRMMAIN.MILINE16.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline17.caption
|
||
msgctxt "TFRMMAIN.MILINE17.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline18.caption
|
||
msgctxt "TFRMMAIN.MILINE18.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline19.caption
|
||
msgctxt "TFRMMAIN.MILINE19.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline2.caption
|
||
msgctxt "TFRMMAIN.MILINE2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline20.caption
|
||
msgctxt "TFRMMAIN.MILINE20.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline21.caption
|
||
msgctxt "tfrmmain.miline21.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline22.caption
|
||
msgctxt "TFRMMAIN.MILINE22.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline23.caption
|
||
msgctxt "tfrmmain.miline23.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline24.caption
|
||
msgctxt "TFRMMAIN.MILINE24.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline25.caption
|
||
msgctxt "TFRMMAIN.MILINE25.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline26.caption
|
||
msgctxt "tfrmmain.miline26.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline3.caption
|
||
msgctxt "TFRMMAIN.MILINE3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline32.caption
|
||
msgctxt "TFRMMAIN.MILINE32.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline33.caption
|
||
msgctxt "tfrmmain.miline33.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline37.caption
|
||
msgctxt "TFRMMAIN.MILINE37.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline38.caption
|
||
msgctxt "tfrmmain.miline38.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline39.caption
|
||
msgctxt "tfrmmain.miline39.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline4.caption
|
||
msgctxt "TFRMMAIN.MILINE4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline40.caption
|
||
msgctxt "tfrmmain.miline40.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline47.caption
|
||
msgctxt "TFRMMAIN.MILINE47.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline5.caption
|
||
msgctxt "TFRMMAIN.MILINE5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline50.caption
|
||
msgctxt "tfrmmain.miline50.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline55.caption
|
||
msgctxt "tfrmmain.miline55.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline6.caption
|
||
msgctxt "TFRMMAIN.MILINE6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline7.caption
|
||
msgctxt "TFRMMAIN.MILINE7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline8.caption
|
||
msgctxt "TFRMMAIN.MILINE8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline9.caption
|
||
msgctxt "TFRMMAIN.MILINE9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.milogclear.caption
|
||
msgid "Clear"
|
||
msgstr "Effacer"
|
||
|
||
#: tfrmmain.milogcopy.caption
|
||
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmmain.miloghide.caption
|
||
msgid "Hide"
|
||
msgstr "Cacher"
|
||
|
||
#: tfrmmain.milogselectall.caption
|
||
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: tfrmmain.mimove.caption
|
||
msgid "Move..."
|
||
msgstr "Déplacer..."
|
||
|
||
#: tfrmmain.misymlink.caption
|
||
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
|
||
msgid "Create symlink..."
|
||
msgstr "Créer un lien symbolique"
|
||
|
||
#: tfrmmain.mitaboptions.caption
|
||
msgid "Tab options"
|
||
msgstr "Options des onglets"
|
||
|
||
#: tfrmmain.mitrayiconexit.caption
|
||
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "&Quitter"
|
||
|
||
#: tfrmmain.mitrayiconrestore.caption
|
||
msgid "Restore"
|
||
msgstr "Restaurer"
|
||
|
||
#: tfrmmain.mnualloperpause.caption
|
||
msgctxt "tfrmmain.mnualloperpause.caption"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmmain.mnualloperstart.caption
|
||
msgctxt "tfrmmain.mnualloperstart.caption"
|
||
msgid "Start"
|
||
msgstr "Démarrer"
|
||
|
||
#: tfrmmain.mnualloperstop.caption
|
||
msgctxt "tfrmmain.mnualloperstop.caption"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmmain.mnucmd.caption
|
||
msgid "&Commands"
|
||
msgstr "&Commandes"
|
||
|
||
#: tfrmmain.mnuconfig.caption
|
||
msgid "C&onfiguration"
|
||
msgstr "Confi&guration"
|
||
|
||
#: tfrmmain.mnucontextline1.caption
|
||
msgctxt "tfrmmain.mnucontextline1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnucontextline2.caption
|
||
msgctxt "tfrmmain.mnucontextline2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnufavoritetabs.caption
|
||
msgid "Favorites"
|
||
msgstr "Onglets favoris"
|
||
|
||
#: tfrmmain.mnufiles.caption
|
||
msgid "&Files"
|
||
msgstr "&Fichiers"
|
||
|
||
#: tfrmmain.mnuhelp.caption
|
||
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Ai&de"
|
||
|
||
#: tfrmmain.mnumark.caption
|
||
msgid "&Mark"
|
||
msgstr "&Sélection"
|
||
|
||
#: tfrmmain.mnunetwork.caption
|
||
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
|
||
msgid "Network"
|
||
msgstr "Réseau"
|
||
|
||
#: tfrmmain.mnushow.caption
|
||
msgid "&Show"
|
||
msgstr "&Affichage"
|
||
|
||
#: tfrmmain.mnutaboptions.caption
|
||
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
|
||
msgid "Tab &Options"
|
||
msgstr "Options des onglets"
|
||
|
||
#: tfrmmain.mnutabs.caption
|
||
msgid "&Tabs"
|
||
msgstr "&Onglets"
|
||
|
||
#: tfrmmain.tbchangedir.caption
|
||
msgid "CD"
|
||
msgstr "CD"
|
||
|
||
#: tfrmmain.tbcopy.caption
|
||
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmmain.tbcut.caption
|
||
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: tfrmmain.tbdelete.caption
|
||
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmmain.tbedit.caption
|
||
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmmain.tbpaste.caption
|
||
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: tfrmmain.tbseparator.caption
|
||
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmaincommandsdlg.btncancel.caption
|
||
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmmaincommandsdlg.btnok.caption
|
||
msgctxt "tfrmmaincommandsdlg.btnok.caption"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmmaincommandsdlg.caption
|
||
msgid "Select your internal command"
|
||
msgstr "Choisissez vore commande interne"
|
||
|
||
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr "Ordonné de manière classique"
|
||
|
||
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr "Ordonné de manière classique"
|
||
|
||
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
||
msgid "Select all categories by default"
|
||
msgstr "Choisissez toutes les catégories par défaut"
|
||
|
||
#: tfrmmaincommandsdlg.gbselection.caption
|
||
msgid "Selection:"
|
||
msgstr "Sélection :"
|
||
|
||
#: tfrmmaincommandsdlg.lblcategory.caption
|
||
msgid "&Categories:"
|
||
msgstr "Catégories :"
|
||
|
||
#: tfrmmaincommandsdlg.lblcommandname.caption
|
||
msgid "Command &name:"
|
||
msgstr "Nom de commande :"
|
||
|
||
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
||
msgid "&Filter:"
|
||
msgstr "Filtre :"
|
||
|
||
#: tfrmmaincommandsdlg.lblhint.caption
|
||
msgid "Hint:"
|
||
msgstr "Indice :"
|
||
|
||
#: tfrmmaincommandsdlg.lblhotkey.caption
|
||
msgid "Hotkey:"
|
||
msgstr "Raccourci clavier"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
||
msgid "cm_name"
|
||
msgstr "cm_name"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
||
msgid "Category"
|
||
msgstr "Catégorie"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
||
msgid "Help"
|
||
msgstr "Aide"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
||
msgid "Hint"
|
||
msgstr "Indice"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
||
msgid "Hotkey"
|
||
msgstr "Raccourci clavier"
|
||
|
||
#: tfrmmaskinputdlg.btnaddattribute.caption
|
||
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Ajouter"
|
||
|
||
#: tfrmmaskinputdlg.btnattrshelp.caption
|
||
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Ai&de"
|
||
|
||
#: tfrmmaskinputdlg.btncancel.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
||
msgid "&Define..."
|
||
msgstr "Définir..."
|
||
|
||
#: tfrmmaskinputdlg.btnok.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
||
msgid "Case sensitive"
|
||
msgstr "Sensibilité à la casse"
|
||
|
||
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
||
msgid "Ignore accents and ligatures"
|
||
msgstr "Ignorer les accents et les ligatures"
|
||
|
||
#: tfrmmaskinputdlg.lblattributes.caption
|
||
msgid "Attri&butes:"
|
||
msgstr "Attributs:"
|
||
|
||
#: tfrmmaskinputdlg.lblprompt.caption
|
||
msgid "Input Mask:"
|
||
msgstr "Masque de saisie :"
|
||
|
||
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
||
msgid "O&r select predefined selection type:"
|
||
msgstr "Ou choisissez un type de sélection prédéfinie :"
|
||
|
||
#: tfrmmkdir.btncancel.caption
|
||
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmmkdir.btnok.caption
|
||
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmmkdir.caption
|
||
msgid "Create new directory"
|
||
msgstr "Créer un nouveau dossier"
|
||
|
||
#: tfrmmkdir.lblmakedir.caption
|
||
msgid "&Input new directory name:"
|
||
msgstr "Nom du nouveau dossier :"
|
||
|
||
#: tfrmmodview.btnpath1.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath2.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath3.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath4.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath5.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.caption
|
||
msgctxt "TFRMMODVIEW.CAPTION"
|
||
msgid "New Size"
|
||
msgstr "Nouvelle Taille"
|
||
|
||
#: tfrmmodview.lblheight.caption
|
||
msgid "Height :"
|
||
msgstr "Hauteur :"
|
||
|
||
#: tfrmmodview.lblpath1.caption
|
||
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmodview.lblpath2.caption
|
||
msgctxt "tfrmmodview.lblpath2.caption"
|
||
msgid "2"
|
||
msgstr "2"
|
||
|
||
#: tfrmmodview.lblpath3.caption
|
||
msgctxt "tfrmmodview.lblpath3.caption"
|
||
msgid "3"
|
||
msgstr "3"
|
||
|
||
#: tfrmmodview.lblpath4.caption
|
||
msgid "4"
|
||
msgstr "4"
|
||
|
||
#: tfrmmodview.lblpath5.caption
|
||
msgid "5"
|
||
msgstr "5"
|
||
|
||
#: tfrmmodview.lblquality.caption
|
||
msgid "Quality of compress to Jpg"
|
||
msgstr "Qualité de la compression JPEG"
|
||
|
||
#: tfrmmodview.lblwidth.caption
|
||
msgid "Width :"
|
||
msgstr "Largeur :"
|
||
|
||
#: tfrmmodview.rbbmp.caption
|
||
msgid "BMP"
|
||
msgstr "BMP"
|
||
|
||
#: tfrmmodview.rbico.caption
|
||
msgid "ICO"
|
||
msgstr "ICO"
|
||
|
||
#: tfrmmodview.rbjpg.caption
|
||
msgid "JPG"
|
||
msgstr "JPG"
|
||
|
||
#: tfrmmodview.rbpng.caption
|
||
msgid "PNG"
|
||
msgstr "PNG"
|
||
|
||
#: tfrmmodview.rbpnm.caption
|
||
msgid "PNM"
|
||
msgstr "PNM"
|
||
|
||
#: tfrmmodview.teheight.text
|
||
msgctxt "tfrmmodview.teheight.text"
|
||
msgid "Height"
|
||
msgstr "Hauteur"
|
||
|
||
#: tfrmmodview.tequality.text
|
||
msgid "80"
|
||
msgstr "80"
|
||
|
||
#: tfrmmodview.tewidth.text
|
||
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
|
||
msgid "Width"
|
||
msgstr "Largeur"
|
||
|
||
#: tfrmmsg.lblmsg.caption
|
||
msgid "456456465465465"
|
||
msgstr "456456465465465"
|
||
|
||
#: tfrmmultirename.btnclose.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Fermer"
|
||
|
||
#: tfrmmultirename.btndeletepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Supprimer"
|
||
|
||
#: tfrmmultirename.btnedit.caption
|
||
msgctxt "tfrmmultirename.btnedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmmultirename.btnextmenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnloadpreset.caption
|
||
msgid "&Load"
|
||
msgstr "&Charger"
|
||
|
||
#: tfrmmultirename.btnnamemenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnrename.caption
|
||
msgctxt "tfrmmultirename.btnrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "&Renommer"
|
||
|
||
#: tfrmmultirename.btnrestore.caption
|
||
msgid "Reset &all"
|
||
msgstr "Réinitialiser tout"
|
||
|
||
#: tfrmmultirename.btnsavepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Enregister"
|
||
|
||
#: tfrmmultirename.caption
|
||
msgctxt "tfrmmultirename.caption"
|
||
msgid "MultiRename"
|
||
msgstr "Renommer par lot"
|
||
|
||
#: tfrmmultirename.cblog.caption
|
||
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
|
||
msgid "Ena&ble"
|
||
msgstr "Activer"
|
||
|
||
#: tfrmmultirename.cbregexp.caption
|
||
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
|
||
msgid "Regular e&xpressions"
|
||
msgstr "E&xpression régulière"
|
||
|
||
#: tfrmmultirename.cbusesubs.caption
|
||
msgid "&Use substitution"
|
||
msgstr "&Utiliser la substitution"
|
||
|
||
#: tfrmmultirename.cmbxwidth.text
|
||
msgid "01"
|
||
msgstr "01"
|
||
|
||
#: tfrmmultirename.edinterval.text
|
||
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.edpoc.text
|
||
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.extension.caption
|
||
msgid "[E] Extension"
|
||
msgstr "[E] Extension"
|
||
|
||
#: tfrmmultirename.gbcounter.caption
|
||
msgid "Counter"
|
||
msgstr "Compteur"
|
||
|
||
#: tfrmmultirename.gbfindreplace.caption
|
||
msgid "Find && Replace"
|
||
msgstr "Chercher && Remplacer"
|
||
|
||
#: tfrmmultirename.gblog.caption
|
||
msgid "Log Result"
|
||
msgstr "Journaliser le résultat"
|
||
|
||
#: tfrmmultirename.gbmaska.caption
|
||
msgid "Mask"
|
||
msgstr "Masque"
|
||
|
||
#: tfrmmultirename.gbpresets.caption
|
||
msgid "Presets"
|
||
msgstr "Présélections"
|
||
|
||
#: tfrmmultirename.lbext.caption
|
||
msgid "&Extension"
|
||
msgstr "&Extension"
|
||
|
||
#: tfrmmultirename.lbfind.caption
|
||
msgid "&Find..."
|
||
msgstr "&Chercher..."
|
||
|
||
#: tfrmmultirename.lbinterval.caption
|
||
msgid "&Interval"
|
||
msgstr "Intervalle"
|
||
|
||
#: tfrmmultirename.lbname.caption
|
||
msgid "File &Name"
|
||
msgstr "&Nom de fichier"
|
||
|
||
#: tfrmmultirename.lbreplace.caption
|
||
msgid "Re&place..."
|
||
msgstr "Rem&placer"
|
||
|
||
#: tfrmmultirename.lbstnb.caption
|
||
msgid "S&tart Number"
|
||
msgstr "Nombre de départ"
|
||
|
||
#: tfrmmultirename.lbwidth.caption
|
||
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
|
||
msgid "&Width"
|
||
msgstr "Largeur"
|
||
|
||
#: tfrmmultirename.micounter.caption
|
||
msgid "[C] Counter"
|
||
msgstr "[C] Compteur"
|
||
|
||
#: tfrmmultirename.miday.caption
|
||
msgid "[D] Day"
|
||
msgstr "[J] Jour"
|
||
|
||
#: tfrmmultirename.miday1.caption
|
||
msgid "[DD] Day (2 digits)"
|
||
msgstr "[JJ] Jour (2 digits)"
|
||
|
||
#: tfrmmultirename.miday2.caption
|
||
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
||
msgstr "[DDD] Jour de la semaine (court, ex : \"lun\")"
|
||
|
||
#: tfrmmultirename.miday3.caption
|
||
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
||
msgstr "[DDDD] Jour de la semaine (long, ex : \"lundi\")"
|
||
|
||
#: tfrmmultirename.miextensionx.caption
|
||
msgid "[Ex] Character at position x"
|
||
msgstr "[Ex] Caractère à la position x"
|
||
|
||
#: tfrmmultirename.miextensionxx.caption
|
||
msgid "[Ex:y] Characters from position x to y"
|
||
msgstr "[Ex:y] Caractère de la position x à y"
|
||
|
||
#: tfrmmultirename.mihour.caption
|
||
msgid "[h] Hour"
|
||
msgstr "[h] Heure"
|
||
|
||
#: tfrmmultirename.mihour1.caption
|
||
msgid "[hh] Hour (2 digits)"
|
||
msgstr "[hh] Heure (2 digits)"
|
||
|
||
#: tfrmmultirename.miminute.caption
|
||
msgid "[n] Minute"
|
||
msgstr "[n] Minute"
|
||
|
||
#: tfrmmultirename.miminute1.caption
|
||
msgid "[nn] Minute (2 digits)"
|
||
msgstr "[nn] Minute (2 digits)"
|
||
|
||
#: tfrmmultirename.mimonth.caption
|
||
msgid "[M] Month"
|
||
msgstr "[M] Mois"
|
||
|
||
#: tfrmmultirename.mimonth1.caption
|
||
msgid "[MM] Month (2 digits)"
|
||
msgstr "[MM] Mois (2 digits)"
|
||
|
||
#: tfrmmultirename.mimonth2.caption
|
||
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
||
msgstr "[MMM] Nom du mois (court, ex : \"jan\")"
|
||
|
||
#: tfrmmultirename.mimonth3.caption
|
||
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
||
msgstr "[MMMM] Nom du mois (long, ex : \"janvier\")"
|
||
|
||
#: tfrmmultirename.miname.caption
|
||
msgid "[N] Name"
|
||
msgstr "[N] Nom"
|
||
|
||
#: tfrmmultirename.minamex.caption
|
||
msgid "[Nx] Character at position x"
|
||
msgstr "[Ex] Caractère à la position x"
|
||
|
||
#: tfrmmultirename.minamexx.caption
|
||
msgid "[Nx:y] Characters from position x to y"
|
||
msgstr "[Ex:y] Caractère de la position x à y"
|
||
|
||
#: tfrmmultirename.minext.caption
|
||
msgid "Time..."
|
||
msgstr "Heure..."
|
||
|
||
#: tfrmmultirename.minextextension.caption
|
||
msgid "Extension..."
|
||
msgstr "Extension..."
|
||
|
||
#: tfrmmultirename.minextname.caption
|
||
msgid "Name..."
|
||
msgstr "Nom..."
|
||
|
||
#: tfrmmultirename.miplugin.caption
|
||
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "\"Plugin\""
|
||
|
||
#: tfrmmultirename.misecond.caption
|
||
msgid "[s] Second"
|
||
msgstr "[s] Seconde"
|
||
|
||
#: tfrmmultirename.misecond1.caption
|
||
msgid "[ss] Second (2 digits)"
|
||
msgstr "[ss] Seconde (2 digits)"
|
||
|
||
#: tfrmmultirename.miyear.caption
|
||
msgid "[Y] Year (2 digits)"
|
||
msgstr "[Y] Année (2 digits)"
|
||
|
||
#: tfrmmultirename.miyear1.caption
|
||
msgid "[YYYY] Year (4 digits)"
|
||
msgstr "[YYYY] Année (4 digits)"
|
||
|
||
#: tfrmmultirename.mnueditnames.caption
|
||
msgid "Edit names..."
|
||
msgstr "Édite les noms..."
|
||
|
||
#: tfrmmultirename.mnuloadfromfile.caption
|
||
msgid "Load names from file..."
|
||
msgstr "Charge les noms des fichiers..."
|
||
|
||
#: tfrmmultirename.n1.caption
|
||
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n2.caption
|
||
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n3.caption
|
||
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n4.caption
|
||
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n5.caption
|
||
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
|
||
msgid "Old File Name"
|
||
msgstr "Ancien nom du fichier"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
|
||
msgid "New File Name"
|
||
msgstr "Nouveau nom du fichier"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
|
||
msgid "File Path"
|
||
msgstr "Chemin du Fichier"
|
||
|
||
#: tfrmmultirenamewait.caption
|
||
msgctxt "tfrmmultirenamewait.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmultirenamewait.lblmessage.caption
|
||
msgid "Click OK when you have closed the editor to load the changed names!"
|
||
msgstr "Clique OK quand vous aurez fermé l'éditeur pour charger les noms à changer!"
|
||
|
||
#: tfrmopenwith.caption
|
||
msgid "Choose an application"
|
||
msgstr "Choisir une application"
|
||
|
||
#: tfrmopenwith.chkcustomcommand.caption
|
||
msgid "Custom command"
|
||
msgstr "Commande personalisée"
|
||
|
||
#: tfrmopenwith.chksaveassociation.caption
|
||
msgid "Save association"
|
||
msgstr "Sauvegarder l'association"
|
||
|
||
#: tfrmopenwith.chkuseasdefault.caption
|
||
msgid "Set selected application as default action"
|
||
msgstr "Ajuster l'application à utiliser par défaut"
|
||
|
||
#: tfrmopenwith.lblmimetype.caption
|
||
msgid "File type to be opened: %s"
|
||
msgstr "Type de fichier à être ouvert : %s"
|
||
|
||
#: tfrmopenwith.milistoffiles.caption
|
||
msgid "Multiple file names"
|
||
msgstr "Noms de fichiers multiple"
|
||
|
||
#: tfrmopenwith.milistoffiles.hint
|
||
msgid "%F"
|
||
msgstr "%F"
|
||
|
||
#: tfrmopenwith.milistofurls.caption
|
||
msgid "Multiple URIs"
|
||
msgstr "Plusieurs URI"
|
||
|
||
#: tfrmopenwith.milistofurls.hint
|
||
msgid "%U"
|
||
msgstr "%U"
|
||
|
||
#: tfrmopenwith.misinglefilename.caption
|
||
msgid "Single file name"
|
||
msgstr "Nom de fichier unique"
|
||
|
||
#: tfrmopenwith.misinglefilename.hint
|
||
msgid "%f"
|
||
msgstr "%f"
|
||
|
||
#: tfrmopenwith.misingleurl.caption
|
||
msgid "Single URI"
|
||
msgstr "Identifiant de ressource unique"
|
||
|
||
#: tfrmopenwith.misingleurl.hint
|
||
msgid "%u"
|
||
msgstr "%u"
|
||
|
||
#: tfrmoptions.btnapply.caption
|
||
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
|
||
msgid "&Apply"
|
||
msgstr "Appliquer"
|
||
|
||
#: tfrmoptions.btncancel.caption
|
||
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmoptions.btnok.caption
|
||
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmoptions.caption
|
||
msgctxt "tfrmoptions.caption"
|
||
msgid "Options"
|
||
msgstr "Options"
|
||
|
||
#: tfrmoptions.lblemptyeditor.caption
|
||
msgid "Please select one of the subpages, this page does not contain any settings."
|
||
msgstr "Choisissez une sous-page, celle-ci ne contient aucun ajustements."
|
||
|
||
#: tfrmoptionsarchivers.btnautoconfig.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNAUTOCONFIG.CAPTION"
|
||
msgid "A&uto Configure"
|
||
msgstr "Configuration automatique"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcadd.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Ajouter"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcapply.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Appliquer"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCDELETE.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcrename.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
|
||
msgid "&Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: tfrmoptionsarchivers.btnrelativearchiver.hint
|
||
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Quelques fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCDEBUG.CAPTION"
|
||
msgid "De&bug mode"
|
||
msgstr "Mode de débbogage"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCENABLED.CAPTION"
|
||
msgid "E&nabled"
|
||
msgstr "Activé"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCOUTPUT.CAPTION"
|
||
msgid "S&how console output"
|
||
msgstr "Afficher la sortie de la console"
|
||
|
||
#: tfrmoptionsarchivers.gbarchiveroptions.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Options"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveadd.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEADD.CAPTION"
|
||
msgid "Add&ing:"
|
||
msgstr "Ajouter :"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextension.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTENSION.CAPTION"
|
||
msgid "E&xtension:"
|
||
msgstr "Extension :"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextract.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTRACT.CAPTION"
|
||
msgid "Ex&tract:"
|
||
msgstr "Extraire :"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelist.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELIST.CAPTION"
|
||
msgid "&List:"
|
||
msgstr "Liste :"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistend.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTEND.CAPTION"
|
||
msgid "Listing &finish (optional):"
|
||
msgstr "Fin de liste (optionnel) :"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistformat.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTFORMAT.CAPTION"
|
||
msgid "Listing for&mat:"
|
||
msgstr "Format de liste :"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveliststart.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTSTART.CAPTION"
|
||
msgid "Listin&g start (optional):"
|
||
msgstr "Fin de liste (optionnel) :"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiver.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVER.CAPTION"
|
||
msgid "Arc&hiver:"
|
||
msgstr "Programme gérant les archives :"
|
||
|
||
#: tfrmoptionsarchivers.lbldescription.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLDESCRIPTION.CAPTION"
|
||
msgid "De&scription:"
|
||
msgstr "Description :"
|
||
|
||
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
|
||
msgid "Additional"
|
||
msgstr "Avancé"
|
||
|
||
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
|
||
msgid "General"
|
||
msgstr "Général"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
|
||
msgid "When &size, date or attributes change"
|
||
msgstr "Quand la &taille, la date ou les attributs changent"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Pour les chemins suivants et leurs sous-dossiers :"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
|
||
msgid "When &files are created, deleted or renamed"
|
||
msgstr "Quand les fichiers sont &créés, supprimés ou renommés"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
|
||
msgid "When application is in the &background"
|
||
msgstr "Quand l'application est en &arrière-plan"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
|
||
msgid "Disable auto-refresh"
|
||
msgstr "Désactiver le rafraichissement automatique"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
|
||
msgid "Refresh file list"
|
||
msgstr "Rafraichir la liste des fichiers"
|
||
|
||
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
|
||
msgid "Al&ways show tray icon"
|
||
msgstr "Toujours afficher l'icône dans la zone de notification"
|
||
|
||
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
||
msgid "Automatically &hide unmounted devices"
|
||
msgstr "Cache lenom automatiquement des disque non montés"
|
||
|
||
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
|
||
msgid "Mo&ve icon to system tray when minimized"
|
||
msgstr "Icône dans la zone de notification lorsque la fenêtre est minimisée"
|
||
|
||
#: tfrmoptionsbehavior.cbonlyonce.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
|
||
msgid "A&llow only one copy of DC at a time"
|
||
msgstr "Autoriser une seule instance de Double Commander à la fois"
|
||
|
||
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
||
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
||
msgstr "Ici vous pouvez entrer un ou plus lecteur ou point de montage, séparés par \";\"."
|
||
|
||
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
||
msgid "Drives &blacklist"
|
||
msgstr "Liste noire des lecteurs :"
|
||
|
||
#: tfrmoptionsbriefview.gbcolumns.caption
|
||
msgid "Columns size"
|
||
msgstr "Taille des colonnes"
|
||
|
||
#: tfrmoptionsbriefview.gbshowfileext.caption
|
||
msgid "Show file extensions"
|
||
msgstr "Affiche l'extension des fichiers"
|
||
|
||
#: tfrmoptionsbriefview.rbaligned.caption
|
||
msgid "ali&gned (with Tab)"
|
||
msgstr "aligne (avec tabulation)"
|
||
|
||
#: tfrmoptionsbriefview.rbdirectly.caption
|
||
msgid "di&rectly after filename"
|
||
msgstr "directement après le nom du fichier"
|
||
|
||
#: tfrmoptionsbriefview.rbuseautosize.caption
|
||
msgid "Auto"
|
||
msgstr "Auto"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
||
msgid "Fixed columns count"
|
||
msgstr "Nombre de colonne fixe"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
||
msgid "Fixed columns width"
|
||
msgstr "Largeur de colonne fixe"
|
||
|
||
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBCUTTEXTTOCOLWIDTH.CAPTION"
|
||
msgid "Cut &text to column width"
|
||
msgstr "Couper le texte à la largeur de la colonne"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDHORZLINE.CAPTION"
|
||
msgid "&Horizontal lines"
|
||
msgstr "Lignes horizontales"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDVERTLINE.CAPTION"
|
||
msgid "&Vertical lines"
|
||
msgstr "Lignes verticales"
|
||
|
||
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CHKAUTOFILLCOLUMNS.CAPTION"
|
||
msgid "A&uto fill columns"
|
||
msgstr "Remplissage automatique des colonnes"
|
||
|
||
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
||
msgid "Show grid"
|
||
msgstr "Affiche la grille"
|
||
|
||
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
||
msgid "Auto-size columns"
|
||
msgstr "Dimensionne automatiquement les colonnes"
|
||
|
||
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.LBLAUTOSIZECOLUMN.CAPTION"
|
||
msgid "Auto si&ze column:"
|
||
msgstr "Largeur des colonnes automatique :"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Appliquer"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBCMDLINEHISTORY.CAPTION"
|
||
msgid "Co&mmand line history"
|
||
msgstr "Historique des commandes"
|
||
|
||
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
|
||
msgid "&Directory history"
|
||
msgstr "Historique des dossiers"
|
||
|
||
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBFILEMASKHISTORY.CAPTION"
|
||
msgid "&File mask history"
|
||
msgstr "Historique des masques de fichier"
|
||
|
||
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSAVECONFIGURATION.CAPTION"
|
||
msgid "Sa&ve configuration"
|
||
msgstr "Sauvegarder la configuration"
|
||
|
||
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSEARCHREPLACEHISTORY.CAPTION"
|
||
msgid "Searc&h/Replace history"
|
||
msgstr "Historique des Recherches/Remplacements"
|
||
|
||
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.GBLOCCONFIGFILES.CAPTION"
|
||
msgid "Location of configuration files"
|
||
msgstr "Emplacement des fichiers de configuration"
|
||
|
||
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.GBSAVEONEXIT.CAPTION"
|
||
msgid "Save on exit"
|
||
msgstr "Sauvegarder en quittant"
|
||
|
||
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
||
msgid "Sort order of configuration order in left tree"
|
||
msgstr "Classement des éléments de configuration de l'arbre de gauche"
|
||
|
||
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.LBLCMDLINECONFIGDIR.CAPTION"
|
||
msgid "Set on command line"
|
||
msgstr "Ajuster sur la ligne de commande"
|
||
|
||
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.RBPROGRAMDIR.CAPTION"
|
||
msgid "P&rogram directory (portable version)"
|
||
msgstr "Dossier où se trouve l'exécutable (version portable)"
|
||
|
||
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.RBUSERHOMEDIR.CAPTION"
|
||
msgid "&User home directory"
|
||
msgstr "Dossier personnel de l'utilisateur"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Applique la modification à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Applique la modification à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Applique la modification à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Applique la modification à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Applique la modification à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Applique la modification à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Appliquer les modifications à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Appliquer les modifications à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Appliquer les modifications à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Appliquer les modifications à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Appliquer les modifications à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Appliquer les modifications à toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
|
||
msgid "&Delete"
|
||
msgstr "&Supprimer"
|
||
|
||
#: tfrmoptionscustomcolumns.btnfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
||
msgid "Go to set default"
|
||
msgstr "Aller à ajuster le défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valuers par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
|
||
msgid "New"
|
||
msgstr "Nouveau"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnext.caption
|
||
msgid "Next"
|
||
msgstr "Prochain"
|
||
|
||
#: tfrmoptionscustomcolumns.btnprev.caption
|
||
msgid "Previous"
|
||
msgstr "Précédent"
|
||
|
||
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
|
||
msgid "Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Réinitialise aux valeurs par défaut"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
|
||
msgid "Save as"
|
||
msgstr "Enregistrer sous"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Autoriser la superposition des couleurs"
|
||
|
||
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
||
msgid "When clicking to change something, change for all columns"
|
||
msgstr "Lorsqu'on clique pour changer quelque chose, le faire pour toutes les colonnes"
|
||
|
||
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
||
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
|
||
msgid "General"
|
||
msgstr "Général"
|
||
|
||
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Bordure du curseur"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
||
msgid "Use Frame Cursor"
|
||
msgstr "Utilise le curseur avec le cadre"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Selection Color"
|
||
msgstr "Utiliser une couleur pour la sélection inactive"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
||
msgid "Use Inverted Selection"
|
||
msgstr "Utiliser la couleur inversé"
|
||
|
||
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
||
msgid "Use custom font and color for this view"
|
||
msgstr "Personnaliser la police et couleur pour cette vue"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
|
||
msgid "BackGround:"
|
||
msgstr "Arrière-plan"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
|
||
msgid "Background 2:"
|
||
msgstr "Arrière-plan 2 :"
|
||
|
||
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCONFIGCOLUMNS.CAPTION"
|
||
msgid "Con&figure columns view:"
|
||
msgstr "Configurer les colonnes pour l'affichage des dossiers/fichiers"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
||
msgid "[Current Column Name]"
|
||
msgstr "[Nom de colonne courante]"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
|
||
msgid "Cursor Color:"
|
||
msgstr "Couleur du curseur :"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
|
||
msgid "Cursor Text:"
|
||
msgstr "Caractère du curseur :"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontname.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
|
||
msgid "Font:"
|
||
msgstr "Police :"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
|
||
msgid "Size:"
|
||
msgstr "Taille :"
|
||
|
||
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
|
||
msgid "Text Color:"
|
||
msgstr "Couleur du texte :"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Couleur curseur inactif"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Couleur sélection inactive"
|
||
|
||
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
|
||
msgid "Mark Color:"
|
||
msgstr "Couleur de marque :"
|
||
|
||
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Ci-dessus en un aperçu. Vous pouvez promener le cuseur et sélectionner des fichiers. Ça vous donne un aperçu immédiate de l'effet des ajustements."
|
||
|
||
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
||
msgid "Settings for column:"
|
||
msgstr "Option pour colonne :"
|
||
|
||
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
||
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
|
||
msgid "Add column"
|
||
msgstr "Ajouter une colonne"
|
||
|
||
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
||
msgid "Position of frame panel after the comparison:"
|
||
msgstr "Position des panneaux après la comparaison :"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
||
msgid "Add..."
|
||
msgstr "Ajouter..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
||
msgid "Backup..."
|
||
msgstr "Archiver..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
||
msgid "Delete..."
|
||
msgstr "Effacer..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Exportr..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
|
||
msgid "Help"
|
||
msgstr "Aide"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Importer..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
||
msgid "Insert..."
|
||
msgstr "Insérer..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
||
msgid "Miscellaneous..."
|
||
msgstr "Divers..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
|
||
msgid "Some functions to select appropriate target"
|
||
msgstr "Quelques fonctions pour choisir le chemin approprié pour la cible"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
||
msgid "Sort..."
|
||
msgstr "Trier..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
||
msgid "When adding directory, add also target"
|
||
msgstr "Lorsqu'on ajoute un dossier, ajouter aussi une cible"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
||
msgid "Always expand tree"
|
||
msgstr "Toujours déployer tout l'arbre"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
||
msgid "Show only valid environment variables"
|
||
msgstr "Afficher seulement les variables d'environnement qui semblent valides"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
||
msgid "In popup, show [path also]"
|
||
msgstr "Dans le menu, afficher [le chemin]"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Nom, a-z"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Nom, a-z"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
||
msgid "Directory Hotlist (reorder by drag && drop)"
|
||
msgstr "Liste des dossiers favoris (utilisez le glisser et déposer pour changer l'ordre)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Autre options"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
|
||
msgid "Name:"
|
||
msgstr "Nom :"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
|
||
msgid "Path:"
|
||
msgstr "Chemin :"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
|
||
msgid "Target:"
|
||
msgstr "Cible :"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miactiveframedirectory.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miactiveframedirectory.caption"
|
||
msgid "directory of the active frame"
|
||
msgstr "dossier du panneau actif"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miactiveinactiveframedirectory.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miactiveinactiveframedirectory.caption"
|
||
msgid "directories of the active && inactive frames"
|
||
msgstr "dossiers des panneaux actifs et inactifs"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcommand.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddcommand.caption"
|
||
msgid "a command"
|
||
msgstr "une commande"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcommand2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddcommand2.caption"
|
||
msgid "Add a command"
|
||
msgstr "Ajouter une commande"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddcopyofselected.caption"
|
||
msgid "a copy of the selected entry"
|
||
msgstr "un copie de l'entrée sélectionnée"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddcopyofselected2.caption"
|
||
msgid "Add a copy of the selected entry"
|
||
msgstr "Ajoute une copie de l'entrée sélectionnée"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddseparator.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddseparator.caption"
|
||
msgid "a separator"
|
||
msgstr "un séparateur"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddseparator2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddseparator2.caption"
|
||
msgid "Add a separator"
|
||
msgstr "Ajoute un séparateur"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddsubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu.caption"
|
||
msgid "sub-menu"
|
||
msgstr "sous-menu"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption"
|
||
msgid "Add sub-menu"
|
||
msgstr "Ajoute un sous-menu"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mibrowsetodirectory.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mibrowsetodirectory.caption"
|
||
msgid "directory I will browse to"
|
||
msgstr "un dossier que je vais parcourir"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micollapseall.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Compacte le tout"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr "...au niveau de l'élément sélectionné seulement"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentselectedoractivedirectories.caption
|
||
msgid "current selected or active directories of active frame"
|
||
msgstr "ce qui est choisis présentement dans le dossier actif"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micutselection.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micutselection.caption"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption"
|
||
msgid "delete all!"
|
||
msgstr "efface tout!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "sous-menu et tous ses éléments"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "juste le sous-menu mais en conservant ses éléments"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption"
|
||
msgid "selected item"
|
||
msgstr "élément sélectionné"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Efface l'élément sélectionné"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
|
||
msgid "Scan all hotdir's path to validate the ones that actually exist"
|
||
msgstr "Parcourir tous les chemins source des dossiers favoris et valider ceux qui existent réellement"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
|
||
msgid "Scan all hotdir's path && target to validate the ones that actually exist"
|
||
msgstr "Parcourir tous les chemins source et de cible des dossiers favoris et valider ceux qui existent réellement"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
||
msgid "to a Directory Hotlist file (.hotlist)"
|
||
msgstr "vers le fichier des dossiers favoris (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "vers le fichier \"wincmd.ini\" de TC (en conservant les dossiers favoris existants)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "vers le fichier \"wincmd.ini\" de TC (efface les dossiers favoris existants)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
||
msgid "Go to configure TC related info"
|
||
msgstr "Aller configurer les options relié à TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
|
||
msgid "Go to configure TC related info"
|
||
msgstr "Aller configurer les options relié à TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
||
msgid "HotDirTestMenu"
|
||
msgstr "Menu de test pour les dossiers favoris"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
||
msgid "from a Directory Hotlist file (.hotlist)"
|
||
msgstr "d'un fichier de dossiers favoris (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
||
msgid "from \"wincmd.ini\" of TC"
|
||
msgstr "de \"wincmd.ini\" de TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miopenallbranches.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Déploie toutes les branches"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mipasteselection.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mipasteselection.caption"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
||
msgid "Restore a backup of Directory Hotlist"
|
||
msgstr "Ramène un fichier de backup d'une liste de dossiers favoris"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
||
msgid "Save a backup of current Directory Hotlist"
|
||
msgstr "Sauvegarder un backup de la liste courante de dossiers favoris"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
||
msgid "Search and replace..."
|
||
msgstr "Recherche et remplace..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplaceinpath.caption
|
||
msgid "in path..."
|
||
msgstr "dans tous les chemins..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplaceintargetpath.caption
|
||
msgid "in target path..."
|
||
msgstr "dans tous les chemins-cible"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchinreplaceinbothpaths.caption
|
||
msgid "in path and target path..."
|
||
msgstr "dans tout les chemins et les chemins-cible"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator10.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator11.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator12.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator12.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator13.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator13.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator3.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator4.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator4.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator5.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator5.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator6.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator6.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator7.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator8.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator9.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "...tout, de A à Z!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr "...simple groupe d'items seulement"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr "Tri un seul groupe d'items"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr "...le contenu des sous-menu sélectionné, mais pas plus creux"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr "...le contenu des sous-menus et de leur descendance"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr "Vérification du menu résultant"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitypethedirectory.caption"
|
||
msgid "directory I will type"
|
||
msgstr "nom de dossier que je vais taper"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitypethedirectory2.caption"
|
||
msgid "Add directory I will type"
|
||
msgstr "Ajoute un dossier dont je vais entrer le nom"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory3.caption
|
||
msgid "Insert directory I will type"
|
||
msgstr "Insère le dossier dont je vais entrer le nom"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
||
msgid "Addition from main panel:"
|
||
msgstr "Ajout du panneau principal"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
||
msgid "From all the supported formats, ask which one to use every time"
|
||
msgstr "De tous les formats supportés, demander lequel utilisé à chaque fois"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
||
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
||
msgstr "Lorsqu'on sauvegarde du texte en Unicode, utiliser le format UTF8 (autrement, cela sera UTF16)"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
||
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
||
msgstr "Lorsqu'on dépose du texte, décider automatiquement du nom de fichier résultant (autrement, on le demande à l'usager a chaque fois)"
|
||
|
||
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
||
msgid "&Show confirmation dialog after drop"
|
||
msgstr "Affiche la fenêtre de confirmation après avoir déposé"
|
||
|
||
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
||
msgid "When drag && dropping text into panels:"
|
||
msgstr "Lorsqu'on fait un glisser et déposer de texte vers un panneau :"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
||
msgid "Place the most desired format on top of list (use dag && drop):"
|
||
msgstr "Placer le format le plus désirable en premier (utiliser le glisser et déposer)"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
||
msgid "(if the most desired is not present, we'll take second one and so on)"
|
||
msgstr "(si celui le plus désiré n'est pas présent, on prendra le second et ainsi de suite)"
|
||
|
||
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
||
msgid "(will not work with some source application, so try to uncheck if problem)"
|
||
msgstr "(ne fonctionnera pas avec certains applications, décoché si problème)"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
||
msgid "Show &file system"
|
||
msgstr "Montre les fichiers-systèmes"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
||
msgid "Show fr&ee space"
|
||
msgstr "Montre l'espace-libre"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
||
msgid "Show &label"
|
||
msgstr "Montre les étiquettes"
|
||
|
||
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
||
msgid "Drives list"
|
||
msgstr "Liste des lecteurs"
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.caption
|
||
msgid "Caret past end of line"
|
||
msgstr "Le curseur a passé la fin de la ligne"
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.caption
|
||
msgid "Show special characters"
|
||
msgstr "Affiche les caractères spéciaux"
|
||
|
||
#: tfrmoptionseditor.gbinternaleditor.caption
|
||
msgid "Internal editor options"
|
||
msgstr "Options de l'éditeur interne"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "Fond"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "Fond"
|
||
|
||
#: tfrmoptionseditorcolors.btnresetmask.hint
|
||
msgid "Reset"
|
||
msgstr "Réinitialiser"
|
||
|
||
#: tfrmoptionseditorcolors.btnsavemask.hint
|
||
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
|
||
msgid "Save"
|
||
msgstr "Enregister"
|
||
|
||
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
||
msgid "Element Attributes"
|
||
msgstr "Élements d'attributs :"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
||
msgid "Fo®round"
|
||
msgstr "En avant-plan"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
|
||
msgid "Fo®round"
|
||
msgstr "En avant-plan"
|
||
|
||
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
||
msgid "&Text-mark"
|
||
msgstr "Texte sélectionné"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
||
msgid "Use (and edit) &global scheme settings"
|
||
msgstr "Utiliser (et éditer) selon le schéma global des ajustements"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
||
msgid "Use &local scheme settings"
|
||
msgstr "Utiliser les paramètres locaux"
|
||
|
||
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
||
msgid "&Bold"
|
||
msgstr "Gras"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "Inverse"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "Non"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "Oui"
|
||
|
||
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
||
msgid "&Italic"
|
||
msgstr "Italique"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "Inverse"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "Non"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "Oui"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
||
msgid "&Strike Out"
|
||
msgstr "Barré"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "Inverse"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "Non"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "Oui"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
||
msgid "&Underline"
|
||
msgstr "Soulignement"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "Inverse"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "Non"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "Oui"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnadd.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
|
||
msgid "Add..."
|
||
msgstr "Ajouter..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btndelete.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
|
||
msgid "Delete..."
|
||
msgstr "Effacer..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
||
msgid "Import/Export"
|
||
msgstr "Importation/Exportation"
|
||
|
||
#: tfrmoptionsfavoritetabs.btninsert.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
|
||
msgid "Insert..."
|
||
msgstr "Insérer..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnrename.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnsort.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
|
||
msgid "Sort..."
|
||
msgstr "Trier..."
|
||
|
||
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "Aucun"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
|
||
msgid "Always expand tree"
|
||
msgstr "Toujours déployer tout l'arbre"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Non"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
||
msgid "Left"
|
||
msgstr "Gauche"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
||
msgid "Right"
|
||
msgstr "Droite"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
||
msgid "Favorite Tabs list (reorder by drag && drop)"
|
||
msgstr "Liste des groupses d'onglets favoris (on peut utiliser le glisser et déposer)"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Autre options"
|
||
|
||
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
||
msgid "What to restore where for the selected entry:"
|
||
msgstr "Quoi restituer où pour l'entrée choisie :"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
||
msgid "Existing tabs to keep:"
|
||
msgstr "Onglet à conserver :"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
||
msgid "Save dir history:"
|
||
msgstr "Sauvegarder l'historique des dossiers :"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
||
msgid "Tabs saved on left to be restored to:"
|
||
msgstr "Les onglets de gauche sauvés seront ramenés à :"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
||
msgid "Tabs saved on right to be restored to:"
|
||
msgstr "Les onglets de droite sauvés seront ramenés à :"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
|
||
msgid "a separator"
|
||
msgstr "un séparateur"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
||
msgid "Add separator"
|
||
msgstr "Ajoute un séparateur"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
|
||
msgid "sub-menu"
|
||
msgstr "sous-menu"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
|
||
msgid "Add sub-menu"
|
||
msgstr "Ajouter un sous-menu"
|
||
|
||
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Compacte le tout"
|
||
|
||
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr "...au niveau de l'élément sélectionné seulement"
|
||
|
||
#: tfrmoptionsfavoritetabs.micutselection.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
|
||
msgid "delete all!"
|
||
msgstr "efface tout!"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "sous-menu et tous ses éléments"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "juste le sous-menu mais en conservant ses éléments"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
|
||
msgid "selected item"
|
||
msgstr "élément sélectionné"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Efface l'élément sélectionné"
|
||
|
||
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
||
msgid "Export selection to legacy .tab file(s)"
|
||
msgstr "Exporter vers fichier .tab classique"
|
||
|
||
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
||
msgid "FavoriteTabsTestMenu"
|
||
msgstr "Menu de test des groupes d'onglets favoris"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
||
msgid "Import legacy .tab file(s) according to default setting"
|
||
msgstr "Importe les fichiers classique d'onglets selon les ajustements par défaut"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr "Importe les fichiers classique d'onglets à l'emplacement sélectionné"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr "Importe les fichiers classique d'onglets à l'emplacement sélectionné"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
||
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
||
msgstr "Importe les fichiers classique d'onglets dans un sous-menu à l'emplacement sélectionné "
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
||
msgid "Insert separator"
|
||
msgstr "Insérer un séparateur"
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
||
msgid "Insert sub-menu"
|
||
msgstr "Insérer un sous-menu"
|
||
|
||
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Déploie toutes les branches"
|
||
|
||
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: tfrmoptionsfavoritetabs.mirename.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
|
||
msgid "Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "...tout, de A à Z!"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr "...un seul groupe d'items seulement"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr "Tri un seul groupe d'items"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr "...le contenu des sous-menus sélectionnés, mais pas plus profond"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr "...le contenu des sous-menus et de leur descendance"
|
||
|
||
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr "Vérification du menu résultant"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
|
||
msgid "Add"
|
||
msgstr "Ajouter"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
|
||
msgid "&Add"
|
||
msgstr "&Ajouter"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
|
||
msgid "A&dd"
|
||
msgstr "Ajouter"
|
||
|
||
#: tfrmoptionsfileassoc.btncloneact.caption
|
||
msgid "Clone"
|
||
msgstr "Dupliquer"
|
||
|
||
#: tfrmoptionsfileassoc.btndownact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
|
||
msgid "&Down"
|
||
msgstr "En dessous"
|
||
|
||
#: tfrmoptionsfileassoc.btneditext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
|
||
msgid "Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
||
msgid "Insert"
|
||
msgstr "Insérer"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
|
||
msgid "Insert"
|
||
msgstr "Insérer"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
|
||
msgid "Remo&ve"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
|
||
msgid "Re&move"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionsfileassoc.btnremovetype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
|
||
msgid "&Remove"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionsfileassoc.btnrenametype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
||
msgid "R&ename"
|
||
msgstr "Renommer"
|
||
|
||
#: tfrmoptionsfileassoc.btnupact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
|
||
msgid "&Up"
|
||
msgstr "Au dessus"
|
||
|
||
#: tfrmoptionsfileassoc.destartpath.hint
|
||
msgid "Starting path of the command. Never quote this string."
|
||
msgstr "Chemin de démarrage de la commande. Ne metter jamais entre guillemets."
|
||
|
||
#: tfrmoptionsfileassoc.edbactionname.hint
|
||
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
||
msgstr "Nom de l'action. Ce ne sera jamais passé au système, c'est simplement un nom idenitifant l'action choisi par vous et pour vous."
|
||
|
||
#: tfrmoptionsfileassoc.edtparams.hint
|
||
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
|
||
msgstr "Paramètre à passe à la commande. Les noms longs de fichier doivent être entre guillemets."
|
||
|
||
#: tfrmoptionsfileassoc.fnecommand.hint
|
||
msgid "Command to execute. Long filename with space should be quoted."
|
||
msgstr "Command à exécuter. Les noms long doivent être entre guillemets."
|
||
|
||
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
||
msgid "Action description:"
|
||
msgstr "Description de l'action"
|
||
|
||
#: tfrmoptionsfileassoc.gbactions.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
||
msgid "Actions"
|
||
msgstr "Actions"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
|
||
msgid "Extensions"
|
||
msgstr "Extensions"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.hint
|
||
msgid "Can be sorted by drag & drop"
|
||
msgstr "Peut être réarranger par glisser et déposer"
|
||
|
||
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
||
msgid "File types"
|
||
msgstr "Types de fichiers"
|
||
|
||
#: tfrmoptionsfileassoc.gbicon.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
|
||
msgid "Icon"
|
||
msgstr "Icône"
|
||
|
||
#: tfrmoptionsfileassoc.lbactions.hint
|
||
msgid "Actions may be sorted by drag & drop"
|
||
msgstr "Les actions peuvent être glissées/déposées"
|
||
|
||
#: tfrmoptionsfileassoc.lbexts.hint
|
||
msgid "Extensions may be sorted by drag & drop"
|
||
msgstr "Les extensions peuvent être triées par glisser et déposer"
|
||
|
||
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
||
msgid "File types may be sorted by drag & drop"
|
||
msgstr "Les types de fichier peuvent être trier par glisser et déposer"
|
||
|
||
#: tfrmoptionsfileassoc.lblaction.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
|
||
msgid "Action name:"
|
||
msgstr "Action :"
|
||
|
||
#: tfrmoptionsfileassoc.lblcommand.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
|
||
msgid "&Command:"
|
||
msgstr "&Commande :"
|
||
|
||
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Paramètres :"
|
||
|
||
#: tfrmoptionsfileassoc.lblstartpath.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "&Chemin de démarrage :"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem1.caption
|
||
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem3.caption
|
||
msgid "Custom with..."
|
||
msgstr "Personalisé avec..."
|
||
|
||
#: tfrmoptionsfileassoc.micustom.caption
|
||
msgid "Custom"
|
||
msgstr "Personalisé"
|
||
|
||
#: tfrmoptionsfileassoc.miedit.caption
|
||
msgctxt "tfrmoptionsfileassoc.miedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: tfrmoptionsfileassoc.mieditor.caption
|
||
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
|
||
msgid "Open in Editor"
|
||
msgstr "Ouvrir dans l'éditeur"
|
||
|
||
#: tfrmoptionsfileassoc.mieditwith.caption
|
||
msgid "Edit with..."
|
||
msgstr "Éditer avec..."
|
||
|
||
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
||
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
|
||
msgid "Get output from command"
|
||
msgstr "Récupérer la sortie de la commande"
|
||
|
||
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
||
msgid "Open in Internal Editor"
|
||
msgstr "Ouvrir dans l'éditeur interne"
|
||
|
||
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
||
msgid "Open in Internal Viewer"
|
||
msgstr "Ouvrir avec la visionneuse interne"
|
||
|
||
#: tfrmoptionsfileassoc.miopen.caption
|
||
msgctxt "tfrmoptionsfileassoc.miopen.caption"
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: tfrmoptionsfileassoc.miopenwith.caption
|
||
msgid "Open with..."
|
||
msgstr "Ouvir avec..."
|
||
|
||
#: tfrmoptionsfileassoc.miseparator.caption
|
||
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.mishell.caption
|
||
msgctxt "tfrmoptionsfileassoc.mishell.caption"
|
||
msgid "Run in terminal"
|
||
msgstr "Exécuter dans un terminal"
|
||
|
||
#: tfrmoptionsfileassoc.miview.caption
|
||
msgctxt "tfrmoptionsfileassoc.miview.caption"
|
||
msgid "View"
|
||
msgstr "Voir"
|
||
|
||
#: tfrmoptionsfileassoc.miviewer.caption
|
||
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
|
||
msgid "Open in Viewer"
|
||
msgstr "Ouvrir dans la visionneuse"
|
||
|
||
#: tfrmoptionsfileassoc.miviewwith.caption
|
||
msgid "View with..."
|
||
msgstr "Voir avec..."
|
||
|
||
#: tfrmoptionsfileassoc.sbtnicon.hint
|
||
msgid "Click me to change icon!"
|
||
msgstr "Cliquez-moi pour changer l'icône!"
|
||
|
||
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
||
msgid "Execute via shell"
|
||
msgstr "Exécuter via l'invite de commande"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
||
msgid "Extended context menu"
|
||
msgstr "Menu contextuel étendu"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr "Lorsqu'on accès au menu d'association, offrir d'ajouter l'extension du fichier sélectionné courant aux configuration d'extension si elle ne correspond pas déjà un groupe existant"
|
||
|
||
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
||
msgid "File association configuration"
|
||
msgstr "Configuration des associations d'extensions"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
||
msgid "Offer to add selection to file association when not included already"
|
||
msgstr "Offrir d'ajouter à la configuration d'association d'extension la sélection lorsqu'elle n'y est pas déjà"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr "Lorsqu'on accède les associations d'extensions, offrir d'ajouter celle du fichier sélectionné si elle n'est pas déjà configurée"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Exécuter via le terminal puis fermer"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Exécuter via le terminal et demeurer actif"
|
||
|
||
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
||
msgid "Extended options items:"
|
||
msgstr "Options étendues :"
|
||
|
||
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
||
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
|
||
msgid "Show confirmation window for:"
|
||
msgstr "Afficher la fenêtre de confirmation pour :"
|
||
|
||
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
||
msgid "Cop&y operation"
|
||
msgstr "Opération de copie"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
||
msgid "&Delete operation"
|
||
msgstr "Opération d'effacement"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDELETETOTRASH.CAPTION"
|
||
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
||
msgstr "Utiliser la corbeille lors des suppressions. (L'utilisation des touches Maj+Del permet la suppression sans passer par la corbeille.)"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
||
msgid "D&elete to trash operation"
|
||
msgstr "Opération d'effacement vers la corbeille"
|
||
|
||
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "D&rop readonly flag"
|
||
msgstr "Ne pas tenir compte du marqueur \"lecture seule\""
|
||
|
||
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
||
msgid "&Move operation"
|
||
msgstr "Opération de déplacement"
|
||
|
||
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBPROCESSCOMMENTS.CAPTION"
|
||
msgid "&Process comments with files/folders"
|
||
msgstr "Traiter les commentaires avec les fichiers/dossiers"
|
||
|
||
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBRENAMESELONLYNAME.CAPTION"
|
||
msgid "Select &file name without extension when renaming"
|
||
msgstr "Séletionner uniquement le nom du fichier lors d'un renommage (pas l'extension)"
|
||
|
||
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSHOWCOPYTABSELECTPANEL.CAPTION"
|
||
msgid "Sho&w tab select panel in copy/move dialog"
|
||
msgstr "Afficher l'onglet sélectionné dans la boite de dialogue des copies/déplacement"
|
||
|
||
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSKIPFILEOPERROR.CAPTION"
|
||
msgid "S&kip file operations errors and write them to log window"
|
||
msgstr "Continuer en cas d'erreurs lors des opérations et les afficher dans la fenêtre du journal"
|
||
|
||
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
||
msgid "Executing operations"
|
||
msgstr "Exécution des opérations"
|
||
|
||
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
||
msgid "User interface"
|
||
msgstr "Interface usager"
|
||
|
||
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
||
msgid "&Buffer size for file operations (in KB):"
|
||
msgstr "Taille du tampon pour les opérations sur les fichiers (en KB) :"
|
||
|
||
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
||
msgid "Buffer size for &hash calculation (in KB):"
|
||
msgstr "Taille du tampon pour le calcul de signature (en KB) :"
|
||
|
||
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
||
msgid "Show operations progress &initially in"
|
||
msgstr "Montre la progression des opérations dans"
|
||
|
||
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
||
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
|
||
msgid "Duplicated name auto-rename style:"
|
||
msgstr "Méthode de renommage automatique des fichiers à dupliquer :"
|
||
|
||
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
||
msgid "&Number of wipe passes:"
|
||
msgstr "Nombre de cycles de pulvérisation :"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
||
msgid "Reset to DC default"
|
||
msgstr "Réinitialiser aux options par défaut DC"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Autoriser la superposition des couleurs"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEFRAMECURSOR.CAPTION"
|
||
msgid "Use &Frame Cursor"
|
||
msgstr "Utiliser un cadre seul pour le curseur"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
||
msgid "Use &Gradient Indicator"
|
||
msgstr "Utiliser l'indicateur en gradient"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Sel Color"
|
||
msgstr "Utilisez la couleur de sélection inactive"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "U&se Inverted Selection"
|
||
msgstr "Utiliser la sélection inverse"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Bordure du curseur"
|
||
|
||
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
|
||
msgid "Drive Free Space Indicator"
|
||
msgstr "Indicateur d'espace-disque libre"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
||
msgid "Bac&kground:"
|
||
msgstr "Fond :"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
|
||
msgid "Backg&round 2:"
|
||
msgstr "Arrière-plan 2 :"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
|
||
msgid "C&ursor Color:"
|
||
msgstr "Couleur du curseur :"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
|
||
msgid "Cursor Te&xt:"
|
||
msgstr "Caractère du curseur :"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Couleur du curseur inactif"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Couleur de sélection inactive"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEPANELBRIGHTNESS.CAPTION"
|
||
msgid "&Brightness level of inactive panel"
|
||
msgstr "Niveau de luminosité du panneau inactif"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
||
msgid "In&dicator Back Color:"
|
||
msgstr "Couleur arrière de l'indicateur"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
||
msgid "&Indicator Fore Color:"
|
||
msgstr "Couleur avant de l'indicateur"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
|
||
msgid "&Mark Color:"
|
||
msgstr "Couleur de marque :"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
||
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
||
msgstr "Un aperçu apparaît ci-dessous. Vous pouvez vous déplacer, sélectionner un fichier et voir l'effet immédiatement des différentes options."
|
||
|
||
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
|
||
msgid "T&ext Color:"
|
||
msgstr "Couleur du texte :"
|
||
|
||
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
||
msgid "When launching file search, clear file mask filter"
|
||
msgstr "Lorsqu'on lanche une recherche de fichier, réinitialser les filtres"
|
||
|
||
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
||
msgid "&Search for part of file name"
|
||
msgstr "Recherche pour les parties de noms"
|
||
|
||
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
||
msgid "Show menu bar in \"Find files\""
|
||
msgstr "Affiche la barre de menu dans la recherche de fichiers"
|
||
|
||
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
||
msgid "Text search in files"
|
||
msgstr "Recherche de texte dans les fichiers"
|
||
|
||
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
||
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
|
||
msgid "File search"
|
||
msgstr "Recherche de fichiers"
|
||
|
||
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
||
msgid "Current filters with \"New search\" button:"
|
||
msgstr "Action sur les filtres lorsqu'on appuis le bouton \"Nouvelle recherche\":"
|
||
|
||
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
||
msgid "Default search template:"
|
||
msgstr "Modèle de recherche par défaut :"
|
||
|
||
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
||
msgid "Use memory mapping for search te&xt in files"
|
||
msgstr "Utiliser la mémoire pour les recherches dans les fichiers texte"
|
||
|
||
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
||
msgid "&Use stream for search text in files"
|
||
msgstr "Utiliser un flux pour les recherches dans les fichiers texte"
|
||
|
||
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
||
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Ajouter"
|
||
|
||
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
||
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Ai&de"
|
||
|
||
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
||
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
||
msgstr "Activation du changement vers le répertoire-parent lorsqu'on double-clic dans un espace vide d'un panneau"
|
||
|
||
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
||
msgid "Do&n't load file list until a tab is activated"
|
||
msgstr "Ne pas charger la liste des fichiers juqu'au moment où l'onglet est activé"
|
||
|
||
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBDIRBRACKETS.CAPTION"
|
||
msgid "S&how square brackets around directories"
|
||
msgstr "Mettre les noms des dossiers entre crochets"
|
||
|
||
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
||
msgid "Hi&ghlight new and updated files"
|
||
msgstr "Colore les nouveaux fichiers et ceux actualisés"
|
||
|
||
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
||
msgid "Enable inplace &renaming when clicking twice on a name"
|
||
msgstr "Active le renommage du fichier en double-cliquant sur son nom"
|
||
|
||
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
|
||
msgid "Load &file list in separate thread"
|
||
msgstr "Charger la liste des fichiers dans un \"tread\" séparé"
|
||
|
||
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
|
||
msgid "Load icons af&ter file list"
|
||
msgstr "Charger les icônes après la liste des fichiers"
|
||
|
||
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
|
||
msgid "Show s&ystem and hidden files"
|
||
msgstr "Afficher les fichiers cachés et système"
|
||
|
||
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBSPACEMOVESDOWN.CAPTION"
|
||
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
||
msgstr "Lors de la sélections des fichiers avec la barre d'espace, se déplacer sur le fichier suivant vers le bas (comme avec <Insér.>)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
|
||
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
||
msgstr "Interpréter le masque de filtre comme Windows (\"*.*\" sélectionne vraiment tout, même fichiers sans extension, etc.)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
|
||
msgid "Use an independant attribute filter in mask input dialog each time"
|
||
msgstr "Utiliser un filtre d'attribut indépendant à chaque entrée de masque de sélection"
|
||
|
||
#: tfrmoptionsfilesviews.gbformatting.caption
|
||
msgid "Formatting"
|
||
msgstr "Formatage"
|
||
|
||
#: tfrmoptionsfilesviews.gbmarking.caption
|
||
msgid "Marking/Unmarking entries"
|
||
msgstr "Sélection/désélection de fichiers"
|
||
|
||
#: tfrmoptionsfilesviews.gbsorting.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.GBSORTING.CAPTION"
|
||
msgid "Sorting"
|
||
msgstr "Tri"
|
||
|
||
#: tfrmoptionsfilesviews.lbattributemask.caption
|
||
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
|
||
msgid "Default attribute mask value to use:"
|
||
msgstr "Masque d'attribut à utiliser pa défaut:"
|
||
|
||
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
||
msgid "Case s&ensitivity:"
|
||
msgstr "Sensible à la casse :"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
||
msgid "Incorrect format"
|
||
msgstr "Format incorrect"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.LBLDATETIMEFORMAT.CAPTION"
|
||
msgid "&Date and time format:"
|
||
msgstr "Format des dates et heures :"
|
||
|
||
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
||
msgid "File si&ze format:"
|
||
msgstr "Format de taille de fichier :"
|
||
|
||
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
||
msgid "&Insert new files:"
|
||
msgstr "Insérer les nouveaux fichiers :"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
||
msgid "So&rting directories:"
|
||
msgstr "Triage des dossiers :"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.LBLSORTMETHOD.CAPTION"
|
||
msgid "&Sort method:"
|
||
msgstr "Méthode de tri :"
|
||
|
||
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
||
msgid "&Move updated files:"
|
||
msgstr "Déplace les fichiers mise à jour :"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Ajouter"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Appliquer"
|
||
|
||
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Modèle..."
|
||
|
||
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
||
msgid "File types colors (sort by drag&&drop)"
|
||
msgstr "Couleurs de type de fichiers (se trie par glisser et déposer)"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYATTR.CAPTION"
|
||
msgid "Category a&ttributes:"
|
||
msgstr "Attributs de catégorie :"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYCOLOR.CAPTION"
|
||
msgid "Category co&lor:"
|
||
msgstr "Couleur de catégorie :"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "Masque de catégorie :"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "Nom de catégorie :"
|
||
|
||
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnseleditfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsellogfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselmainfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.lblconsolefont.caption
|
||
msgid "&Console font"
|
||
msgstr "Police de la console"
|
||
|
||
#: tfrmoptionsfonts.lbleditorfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
|
||
msgid "&Editor font"
|
||
msgstr "Police de l'éditeur"
|
||
|
||
#: tfrmoptionsfonts.lbllogfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
|
||
msgid "&Log font"
|
||
msgstr "Police du journal"
|
||
|
||
#: tfrmoptionsfonts.lblmainfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
|
||
msgid "Main &font"
|
||
msgstr "Police principale"
|
||
|
||
#: tfrmoptionsfonts.lblpatheditfont.caption
|
||
msgid "Path font"
|
||
msgstr "Police du chemin"
|
||
|
||
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
||
msgid "Search results font"
|
||
msgstr "Police du résultat de recherche"
|
||
|
||
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
|
||
msgid "Viewer&Book Font"
|
||
msgstr "Police pour la visionneuse en mode \"Book\""
|
||
|
||
#: tfrmoptionsfonts.lblviewerfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
|
||
msgid "&Viewer font"
|
||
msgstr "Police du lecteur de fichiers"
|
||
|
||
#: tfrmoptionshotkeys.actaddhotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
|
||
msgid "Add &hotkey"
|
||
msgstr "Ajoute un raccourci-clavier"
|
||
|
||
#: tfrmoptionshotkeys.actcopy.caption
|
||
msgctxt "tfrmoptionshotkeys.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmoptionshotkeys.actdelete.caption
|
||
msgctxt "tfrmoptionshotkeys.actdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
|
||
msgid "&Delete hotkey"
|
||
msgstr "Efface le raccourci-clavier"
|
||
|
||
#: tfrmoptionshotkeys.actedithotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
|
||
msgid "&Edit hotkey"
|
||
msgstr ""
|
||
"Éditer raccourci-\n"
|
||
"clavier\n"
|
||
|
||
#: tfrmoptionshotkeys.actnextcategory.caption
|
||
msgid "Next category"
|
||
msgstr "Catégorie suivante"
|
||
|
||
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
||
msgid "Make popup the file related menu"
|
||
msgstr "Faire apparaitre le menu relié au fichier"
|
||
|
||
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
||
msgid "Previous category"
|
||
msgstr "Catégorie précédente"
|
||
|
||
#: tfrmoptionshotkeys.actrename.caption
|
||
msgctxt "tfrmoptionshotkeys.actrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: tfrmoptionshotkeys.actrestoredefault.caption
|
||
msgid "Restore DC default"
|
||
msgstr "Ramener valeur par défaut de DC"
|
||
|
||
#: tfrmoptionshotkeys.actsavenow.caption
|
||
msgid "Save now"
|
||
msgstr "Sauvegarde maintenant"
|
||
|
||
#: tfrmoptionshotkeys.actsortbycommand.caption
|
||
msgid "Sort by command name"
|
||
msgstr "Tri par commande"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
||
msgid "Sort by hotkeys (grouped)"
|
||
msgstr "Tri par raccourcis (groupé)"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
||
msgid "Sort by hotkeys (one per row)"
|
||
msgstr "Tri par raccourcis (une par ligne)"
|
||
|
||
#: tfrmoptionshotkeys.lbfilter.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
|
||
msgid "&Filter"
|
||
msgstr "Filtres"
|
||
|
||
#: tfrmoptionshotkeys.lblcategories.caption
|
||
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
|
||
msgid "C&ategories:"
|
||
msgstr "Catégories :"
|
||
|
||
#: tfrmoptionshotkeys.lblcommands.caption
|
||
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
|
||
msgid "Co&mmands:"
|
||
msgstr "Commandes :"
|
||
|
||
#: tfrmoptionshotkeys.lblscfiles.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
|
||
msgid "&Shortcut files:"
|
||
msgstr "Fichiers des raccourcis clavier :"
|
||
|
||
#: tfrmoptionshotkeys.lblsortorder.caption
|
||
msgid "So&rt order:"
|
||
msgstr "Ordre de tri:"
|
||
|
||
#: tfrmoptionshotkeys.micategories.caption
|
||
msgid "Categories"
|
||
msgstr "Catégories"
|
||
|
||
#: tfrmoptionshotkeys.micommands.caption
|
||
msgctxt "tfrmoptionshotkeys.micommands.caption"
|
||
msgid "Command"
|
||
msgstr "Commande"
|
||
|
||
#: tfrmoptionshotkeys.miseparator1.caption
|
||
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionshotkeys.misortorder.caption
|
||
msgid "Sort order"
|
||
msgstr "Orde de tri"
|
||
|
||
#: tfrmoptionsicons.cbiconsexclude.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Pour les chemins suivants et leurs sous-dossiers :"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenus.caption
|
||
msgid "Show icons for actions in &menus"
|
||
msgstr "Montre les icônes pour les actions dans les menus"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenussize.text
|
||
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
||
msgid "Show icons on buttons"
|
||
msgstr "Affiches les icônes sur les boutons"
|
||
|
||
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
|
||
msgid "Show o&verlay icons, e.g. for links"
|
||
msgstr "Afficher les icônes \"overlay\", par exemple pour les liens"
|
||
|
||
#: tfrmoptionsicons.cbiconssize.text
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSSIZE.TEXT"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
||
msgid "Disable special icons"
|
||
msgstr "Désactiver les icônes spéciales"
|
||
|
||
#: tfrmoptionsicons.gbiconsinmenus.caption
|
||
msgid "Icons in menus"
|
||
msgstr "Icône dans les menus"
|
||
|
||
#: tfrmoptionsicons.gbiconsonbuttons.caption
|
||
msgid "Icons on buttons"
|
||
msgstr "Les icônes sur les boutons"
|
||
|
||
#: tfrmoptionsicons.gbiconssize.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
|
||
msgid " Icon size "
|
||
msgstr " &Taille des icônes "
|
||
|
||
#: tfrmoptionsicons.gbshowiconsmode.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
|
||
msgid " Show icons to the left of the filename "
|
||
msgstr "Montrer les icônes à gauche des noms de fichier"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowall.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
||
msgid "A&ll"
|
||
msgstr "&Toutes"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
|
||
msgid "All associated + &EXE/LNK (slow)"
|
||
msgstr "Toutes les associations existantes + &EXE/LNK (lent)"
|
||
|
||
#: tfrmoptionsicons.rbiconsshownone.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
|
||
msgid "&No icons"
|
||
msgstr "&Pas d'icônes"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
|
||
msgid "Only &standard icons"
|
||
msgstr "&Seulement les icônes standard"
|
||
|
||
#: tfrmoptionsignorelist.btnaddsel.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
|
||
msgid "A&dd selected names"
|
||
msgstr "&Ajouter les noms sélectionnés"
|
||
|
||
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
|
||
msgid "Add selected names with &full path"
|
||
msgstr "Ajouter les noms sélectionnés avec le chemin &complet"
|
||
|
||
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
||
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmoptionsignorelist.chkignoreenable.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
|
||
msgid "&Ignore (don't show) the following files and folders:"
|
||
msgstr "&Ignorer (ne pas montrer) les fichiers et dossiers suivant :"
|
||
|
||
#: tfrmoptionsignorelist.lblsavein.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
|
||
msgid "&Save in:"
|
||
msgstr "&Enregistrer dans :"
|
||
|
||
#: tfrmoptionskeyboard.cblynxlike.caption
|
||
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
||
msgstr "Les flèches gauche et droite changent de dossier (déplacement comme Lynx)"
|
||
|
||
#: tfrmoptionskeyboard.gbtyping.caption
|
||
msgid "Typing"
|
||
msgstr "Frappe"
|
||
|
||
#: tfrmoptionskeyboard.lblalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
|
||
msgid "Alt+L&etters:"
|
||
msgstr "Alt+Lettres :"
|
||
|
||
#: tfrmoptionskeyboard.lblctrlalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
|
||
msgid "Ctrl+Alt+Le&tters:"
|
||
msgstr "Ctrl+Alt+Lettres :"
|
||
|
||
#: tfrmoptionskeyboard.lblnomodifier.caption
|
||
msgid "&Letters:"
|
||
msgstr "Lettres :"
|
||
|
||
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
|
||
msgid "&Flat buttons"
|
||
msgstr "Boutons plats"
|
||
|
||
#: tfrmoptionslayout.cbflatinterface.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
|
||
msgid "Flat i&nterface"
|
||
msgstr "Interface simple"
|
||
|
||
#: tfrmoptionslayout.cbflattoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
|
||
msgid "Flat b&uttons"
|
||
msgstr "Boutons plats"
|
||
|
||
#: tfrmoptionslayout.cbfreespaceind.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
|
||
msgid "Show fr&ee space indicator on drive label"
|
||
msgstr "Afficher l'espace disponible sur l'étiquette des volumes/disques"
|
||
|
||
#: tfrmoptionslayout.cblogwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
|
||
msgid "Show lo&g window"
|
||
msgstr "Afficher la fenêtre du journal"
|
||
|
||
#: tfrmoptionslayout.cbpanelofoperations.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
|
||
msgid "Show panel of operation in background"
|
||
msgstr "Afficher les opérations dans les panneaux en arrière-plan"
|
||
|
||
#: tfrmoptionslayout.cbproginmenubar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
|
||
msgid "Show common progress in menu bar"
|
||
msgstr "Afficher la barre de progression dans le menu"
|
||
|
||
#: tfrmoptionslayout.cbshowcmdline.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
|
||
msgid "Show command l&ine"
|
||
msgstr "Afficher la ligne de commande"
|
||
|
||
#: tfrmoptionslayout.cbshowcurdir.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
|
||
msgid "Show current director&y"
|
||
msgstr "Afficher le dossier courant"
|
||
|
||
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
|
||
msgid "Show &drive buttons"
|
||
msgstr "Afficher les boutons des volumes/disques"
|
||
|
||
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
|
||
msgid "Show free s&pace label"
|
||
msgstr "Afficher l'étiquette avec l'espace libre"
|
||
|
||
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
||
msgid "Show drives list bu&tton"
|
||
msgstr "Afficher les boutons de lecteur"
|
||
|
||
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
|
||
msgid "Show function &key buttons"
|
||
msgstr "Afficher les boutons des touches de &fonction (F3 à F10)"
|
||
|
||
#: tfrmoptionslayout.cbshowmainmenu.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
|
||
msgid "Show &main menu"
|
||
msgstr "Afficher le menu principal"
|
||
|
||
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
|
||
msgid "Show tool&bar"
|
||
msgstr "Afficher la barre d'outils"
|
||
|
||
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
||
msgid "Show short free space &label"
|
||
msgstr "Afficher l'étiquette d'espace libre restant"
|
||
|
||
#: tfrmoptionslayout.cbshowstatusbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
|
||
msgid "Show &status bar"
|
||
msgstr "Afficher la barre de statut"
|
||
|
||
#: tfrmoptionslayout.cbshowtabheader.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
|
||
msgid "S&how tabstop header"
|
||
msgstr "Afficher la ligne de titre dans les onglets"
|
||
|
||
#: tfrmoptionslayout.cbshowtabs.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
|
||
msgid "Sho&w folder tabs"
|
||
msgstr "Afficher les &onglets de dossiers"
|
||
|
||
#: tfrmoptionslayout.cbtermwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
|
||
msgid "Show te&rminal window"
|
||
msgstr "Afficher la fenêtre de terminal"
|
||
|
||
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
|
||
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
||
msgstr "Afficher deux barres de boutons avec les volumes/disques (largeur fixe, au dessus de la fenêtre des fichiers)"
|
||
|
||
#: tfrmoptionslayout.gbscreenlayout.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
|
||
msgid " Screen layout "
|
||
msgstr "Apparence de l'écran"
|
||
|
||
#: tfrmoptionslog.btnrelativelogfile.hint
|
||
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmoptionslog.btnviewlogfile.hint
|
||
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Voir le contenu du fichier-journal"
|
||
|
||
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
||
msgid "Include date in log filename"
|
||
msgstr "Inclure la date dans le nom du fichier-journal"
|
||
|
||
#: tfrmoptionslog.cblogarcop.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
|
||
msgid "&Pack/Unpack"
|
||
msgstr "Archivage/extraction des données des archives compressées"
|
||
|
||
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
||
msgid "External command line execution"
|
||
msgstr "Ligne de commande d'exécution externe"
|
||
|
||
#: tfrmoptionslog.cblogcpmvln.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
|
||
msgid "Cop&y/Move/Create link/symlink"
|
||
msgstr "Copie/Déplacement de fichier - Création de liens durs/symboliques"
|
||
|
||
#: tfrmoptionslog.cblogdelete.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionslog.cblogdirop.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
|
||
msgid "Crea&te/Delete directories"
|
||
msgstr "Créations/Suppressions des dossiers"
|
||
|
||
#: tfrmoptionslog.cblogerrors.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
|
||
msgid "Log &errors"
|
||
msgstr "Journaliser les erreurs"
|
||
|
||
#: tfrmoptionslog.cblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
|
||
msgid "C&reate a log file:"
|
||
msgstr "&Créer un fichier journal :"
|
||
|
||
#: tfrmoptionslog.cbloginfo.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
|
||
msgid "Log &information messages"
|
||
msgstr "Journaliser les messages d'information"
|
||
|
||
#: tfrmoptionslog.cblogstartshutdown.caption
|
||
msgid "Start/shutdown"
|
||
msgstr "Démarrage/Fermeture"
|
||
|
||
#: tfrmoptionslog.cblogsuccess.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
|
||
msgid "Log &successful operations"
|
||
msgstr "Journaliser les opérations &réussies"
|
||
|
||
#: tfrmoptionslog.cblogvfs.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
|
||
msgid "&File system plugins"
|
||
msgstr "\"Plugin\" de système de fichier"
|
||
|
||
#: tfrmoptionslog.gblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
|
||
msgid "File operation log file"
|
||
msgstr "Emplacement du fichier journal"
|
||
|
||
#: tfrmoptionslog.gblogfileop.caption
|
||
msgid "Log operations"
|
||
msgstr "Journalisation des opérations"
|
||
|
||
#: tfrmoptionslog.gblogfilestatus.caption
|
||
msgid "Operation status"
|
||
msgstr "Statut de l'opération"
|
||
|
||
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
||
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
||
msgid "&Remove thumbnails for no longer existing files"
|
||
msgstr "Efface les vignettes pour les fichiers qui n'existent plus"
|
||
|
||
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Voir le contenu du fichier-journal"
|
||
|
||
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
||
msgid "Create new with the encoding:"
|
||
msgstr "Créer de nouveaux avec le codage :"
|
||
|
||
#: tfrmoptionsmisc.chkgotoroot.caption
|
||
msgid "Always &go to the root of a drive when changing drives"
|
||
msgstr "Toujours aller à la racine du lecteur lorsqu'on change de lecteur"
|
||
|
||
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
||
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
|
||
msgid "Show &warning messages (\"OK\" button only)"
|
||
msgstr "Montrer les messages d'avertissement (seulement le bouton \"OK\")"
|
||
|
||
#: tfrmoptionsmisc.chkthumbsave.caption
|
||
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
|
||
msgid "&Save thumbnails in cache"
|
||
msgstr "Sauverager les vignettes en cache"
|
||
|
||
#: tfrmoptionsmisc.dblthumbnails.caption
|
||
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Vignettes"
|
||
|
||
#: tfrmoptionsmisc.gbfilecomments.caption
|
||
msgid "File comments (descript.ion)"
|
||
msgstr "Commentaire de fichier (descript.ion)"
|
||
|
||
#: tfrmoptionsmisc.gbtcexportimport.caption
|
||
msgid "Regarding TC export/import:"
|
||
msgstr "Concernant les importation/exportation avec TC :"
|
||
|
||
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
||
msgid "Default encoding:"
|
||
msgstr "Encodage par défaut :"
|
||
|
||
#: tfrmoptionsmisc.lbltcconfig.caption
|
||
msgid "Configuration file:"
|
||
msgstr "Fichier de configuration :"
|
||
|
||
#: tfrmoptionsmisc.lbltcexecutable.caption
|
||
msgid "TC executable:"
|
||
msgstr "Exécutable de TC:"
|
||
|
||
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
||
msgid "Toolbar output path:"
|
||
msgstr "Chemin de sortie de la barre d'outils :"
|
||
|
||
#: tfrmoptionsmisc.lblthumbpixels.caption
|
||
msgid "pixels"
|
||
msgstr "pixels"
|
||
|
||
#: tfrmoptionsmisc.lblthumbseparator.caption
|
||
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmoptionsmisc.lblthumbsize.caption
|
||
msgid "&Thumbnail size:"
|
||
msgstr "Taille de vignette :"
|
||
|
||
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
||
msgctxt "TFRMOPTIONSMOUSE.CBSELECTIONBYMOUSE.CAPTION"
|
||
msgid "&Selection by mouse"
|
||
msgstr "Sélection à la souris"
|
||
|
||
#: tfrmoptionsmouse.gbscrolling.caption
|
||
msgctxt "TFRMOPTIONSMOUSE.GBSCROLLING.CAPTION"
|
||
msgid "Scrolling"
|
||
msgstr "Défilement"
|
||
|
||
#: tfrmoptionsmouse.gbselection.caption
|
||
msgid "Selection"
|
||
msgstr "Sélection"
|
||
|
||
#: tfrmoptionsmouse.lblmousemode.caption
|
||
msgctxt "TFRMOPTIONSMOUSE.LBLMOUSEMODE.CAPTION"
|
||
msgid "&Mode:"
|
||
msgstr "Mode :"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
||
msgctxt "TFRMOPTIONSMOUSE.RBSCROLLLINEBYLINE.CAPTION"
|
||
msgid "&Line by line"
|
||
msgstr "Ligne par ligne"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
||
msgctxt "TFRMOPTIONSMOUSE.RBSCROLLLINEBYLINECURSOR.CAPTION"
|
||
msgid "Line by line &with cursor movement"
|
||
msgstr "Ligne par ligne avec les mouvements du curseur"
|
||
|
||
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
||
msgctxt "TFRMOPTIONSMOUSE.RBSCROLLPAGEBYPAGE.CAPTION"
|
||
msgid "&Page by page"
|
||
msgstr "Page par page"
|
||
|
||
#: tfrmoptionsplugins.btnaddplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Ajouter"
|
||
|
||
#: tfrmoptionsplugins.btnconfigplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "Configurer"
|
||
|
||
#: tfrmoptionsplugins.btnenableplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
|
||
msgid "E&nable"
|
||
msgstr "Activer"
|
||
|
||
#: tfrmoptionsplugins.btnremoveplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionsplugins.btntweakplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
|
||
msgid "&Tweak"
|
||
msgstr "Raffiner"
|
||
|
||
#: tfrmoptionsplugins.lbldsxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
|
||
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
||
msgstr "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
||
|
||
#: tfrmoptionsplugins.lblwcxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
|
||
msgid "Pack&er plugins are used to work with archives"
|
||
msgstr "Les \"plugins\" de compresseur sont utilisés pour travailler avec les archives compressées."
|
||
|
||
#: tfrmoptionsplugins.lblwdxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
|
||
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
||
msgstr "Les \"plugins\" de contenu permettent d'afficher la liste des métadonnées des fichiers comme les tags mp3 ou les attributs des images. Ils permettent aussi d'utiliser ces métadonnées dans les recherches ou l'outil de renommage en lots."
|
||
|
||
#: tfrmoptionsplugins.lblwfxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
|
||
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
||
msgstr "Les \"plugins\" de dystème de fichier permettent d'accéder à des systèmes de fichiers qui ne sont pas pris en charge par le système d'exploitation ou sur des périphériques externes comme les Palm et PocketPC."
|
||
|
||
#: tfrmoptionsplugins.lblwlxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
|
||
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
||
msgstr "Les \"plugins\" de visualisation permettent d'afficher différents formats de fichiers comme les images, les tableurs, les bases de données, etc, dans une visionneuse intégrée. (F3, Ctrl+Q)"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
|
||
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
|
||
msgid "Active"
|
||
msgstr "Actif"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
|
||
msgctxt "tfrmoptionsplugins.stgplugins.columns[1].title.caption"
|
||
msgid "Plugin"
|
||
msgstr "\"Plugin\""
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
|
||
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
|
||
msgid "Registered for"
|
||
msgstr "Enregistré pour"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
|
||
msgctxt "tfrmoptionsplugins.stgplugins.columns[3].title.caption"
|
||
msgid "File name"
|
||
msgstr "Nom de fichier"
|
||
|
||
#: tfrmoptionsplugins.tsdsx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
|
||
msgid "&Search plugins (.DSX)"
|
||
msgstr "\"Plugins\" de recherche (.DSX)"
|
||
|
||
#: tfrmoptionsplugins.tswcx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
|
||
msgid "Pac&ker plugins (.WCX)"
|
||
msgstr "\"Plugins\" de compresseur (.WCX)"
|
||
|
||
#: tfrmoptionsplugins.tswdx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
|
||
msgid "Content pl&ugins (.WDX)"
|
||
msgstr "\"Plugins\" de contenu (.WDX)"
|
||
|
||
#: tfrmoptionsplugins.tswfx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
|
||
msgid "F&ile system plugins (.WFX)"
|
||
msgstr "\"Plugins\" de système de fichiers (.WFX)"
|
||
|
||
#: tfrmoptionsplugins.tswlx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
|
||
msgid "&Viewer plugins (.WLX)"
|
||
msgstr "\"Plugins\" de visualisation (.WLX)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
|
||
msgid "&Beginning (name must start with first typed character)"
|
||
msgstr "&Commence par (le nom doit commencer par les caractères tapés)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
|
||
msgid "En&ding (last character before a typed dot . must match)"
|
||
msgstr "Se &termine par (les derniers caractères avant le . de l'extension doivent correspondre)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Options"
|
||
|
||
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
||
msgid "Exact name match"
|
||
msgstr "Correspondance exacte de nom"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
||
msgid "Search case"
|
||
msgstr "Sensible à la casse"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
||
msgid "Search for these items"
|
||
msgstr "Rechercher tous ces éléments"
|
||
|
||
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
||
msgid "Keep renamed name when unlocking a tab"
|
||
msgstr "Conserver le nom donner à l'onglet lorsqu'on le déverouille"
|
||
|
||
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
|
||
msgid "Activate target &panel when clicking on one of its Tabs"
|
||
msgstr "Activer le panneau cible lors d'un clic sur un de ses onglets"
|
||
|
||
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
|
||
msgid "&Show tab header also when there is only one tab"
|
||
msgstr "Montrer les entêtes des onglets même s'il n'y a qu'un &seul onglet"
|
||
|
||
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
||
msgid "Close duplicate tabs when closing application"
|
||
msgstr "Fermer les onglets doublons lorsqu'on quitte l'application"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
|
||
msgid "Con&firm close all tabs"
|
||
msgstr "&Confirmation pour la fermeture de tous les onglets"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
||
msgid "Confirm close locked tabs"
|
||
msgstr "Confirmer la fermeture des onglets verrouillés"
|
||
|
||
#: tfrmoptionstabs.cbtabslimitoption.caption
|
||
msgid "&Limit tab title length to"
|
||
msgstr "Limiter la légende de l'onglet à"
|
||
|
||
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
|
||
msgid "Show locked tabs &with an asterisk *"
|
||
msgstr "Afficher les onglets verrouillés avec un astérisque *"
|
||
|
||
#: tfrmoptionstabs.cbtabsmultilines.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
|
||
msgid "&Tabs on multiple lines"
|
||
msgstr "Disposer les &onglets sur plusieurs lignes"
|
||
|
||
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
|
||
msgid "Ctrl+&Up opens new tab in foreground"
|
||
msgstr "Ctrl+&FlècheHaut ouvre un nouvel onglet à l'arrière-plan"
|
||
|
||
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
|
||
msgid "Open &new tabs near current tab"
|
||
msgstr "Ouvrir les nouveaux onglets à côté de l'onglet courant"
|
||
|
||
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
||
msgid "Reuse existing tab when possible"
|
||
msgstr "Réutiliser les onglets existants quand c'est possible"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
|
||
msgid "Show ta&b close button"
|
||
msgstr "Afficher le bouton de fermeture des onglets"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
||
msgid "Always show drive letter in tab title"
|
||
msgstr "Toujours afficher la lettre du lecteur dans l'onglet"
|
||
|
||
#: tfrmoptionstabs.gbtabs.caption
|
||
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
|
||
msgid "Folder tabs headers"
|
||
msgstr "Titre des onglets de dossiers"
|
||
|
||
#: tfrmoptionstabs.lblchar.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
|
||
msgid "characters"
|
||
msgstr "caractères"
|
||
|
||
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
||
msgid "Action to do when double click on a tab:"
|
||
msgstr "Action à faire si on double clique sur un onglet :"
|
||
|
||
#: tfrmoptionstabs.lbltabsposition.caption
|
||
msgid "Ta&bs position"
|
||
msgstr "Position des onglets"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "Aucun"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Non"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
||
msgid "Left"
|
||
msgstr "Gauche"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
||
msgid "Right"
|
||
msgstr "Droite"
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after resaving"
|
||
msgstr "Aller à la configuration des groupes d'onglets favoris après l'avoir re-sauvegarder"
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
||
msgstr "Aller à la configuration des groupes d'onglets favoris après en avoir sauvegarder un nouveau"
|
||
|
||
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
||
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
||
msgstr "Active les options extra des groupes d'onglets favoris (choix du panneau-cible lorsqu'on rappel, etc.)"
|
||
|
||
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
||
msgid "Default extra settings when saving new Favorite Tabs:"
|
||
msgstr "Valeurs des options extra des groupes d'onglets favoris lorsqu'on en ajoute un nouveau"
|
||
|
||
#: tfrmoptionstabsextra.gbtabs.caption
|
||
msgid "Folder tabs headers extra"
|
||
msgstr "Options \"extra\" des onglets de dossiers"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
||
msgid "When restoring tab, existing tabs to keep:"
|
||
msgstr "Lorsqu'on restitue un onglet, conserver les onglets existants :"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
||
msgid "Tabs saved on left will be restored to:"
|
||
msgstr "Les onglets de gauche sauvegardé seront rechargés :"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
||
msgid "Tabs saved on right will be restored to:"
|
||
msgstr "Les onglets de droite sauvegardé seront rechargés :"
|
||
|
||
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
||
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "Conservation de l'historique des dossis avec ce groupe d'onglets favoris :"
|
||
|
||
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
||
msgid "Default position in menu when saving a new Favorite Tabs:"
|
||
msgstr "Position par défault du nouveau groupe d'onglets favori lorsqu'on l'ajoute :"
|
||
|
||
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "L'expression {command} devrait normalement être présente ici quelque part pour refléter l'emplacement où doit être la commande à exécuter en mode terminal"
|
||
|
||
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "L'expression {command} devrait normalement être présente ici quelque part pour refléter l'emplacement où doit être la commande à exécuter en mode terminal"
|
||
|
||
#: tfrmoptionsterminal.edruntermparams.hint
|
||
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "L'expression {command} devrait normalement être présente ici quelque part pour refléter l'emplacement où doit être la commande à exécuter en mode terminal"
|
||
|
||
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
||
msgid "Command for just running terminal:"
|
||
msgstr "Commande pour simplement exécuter le terminal :"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
||
msgid "Command for running a command in terminal and close after:"
|
||
msgstr "Commande pour exécuter une commande en mode terminal et qui sera fermé ensuite :"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
||
msgid "Command for running a command in terminal and stay open:"
|
||
msgstr "Commande pour exécuter une commande en mode terminal et qui demeurera ouvert :"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Commande :"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Paramètres :"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Commande :"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Paramètres :"
|
||
|
||
#: tfrmoptionsterminal.lbruntermcmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Commande :"
|
||
|
||
#: tfrmoptionsterminal.lbruntermparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Paramètres :"
|
||
|
||
#: tfrmoptionstoolbar.btnclonebutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btnclonebutton.caption"
|
||
msgid "C&lone button"
|
||
msgstr "&Dupliquer le bouton"
|
||
|
||
#: tfrmoptionstoolbar.btndeletebutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
|
||
msgid "&Delete"
|
||
msgstr "&Supprimer"
|
||
|
||
#: tfrmoptionstoolbar.btnedithotkey.caption
|
||
msgctxt "tfrmoptionstoolbar.btnedithotkey.caption"
|
||
msgid "Edit hot&key"
|
||
msgstr "Éditer raccourci clavier"
|
||
|
||
#: tfrmoptionstoolbar.btninsertbutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btninsertbutton.caption"
|
||
msgid "&Insert new button"
|
||
msgstr "&Insérer un nouveau bouton"
|
||
|
||
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
||
msgid "Select"
|
||
msgstr "Choisissez"
|
||
|
||
#: tfrmoptionstoolbar.btnopenfile.caption
|
||
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnother.caption
|
||
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
||
msgid "Other..."
|
||
msgstr "Autre..."
|
||
|
||
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
||
msgctxt "tfrmoptionstoolbar.btnremovehotkey.caption"
|
||
msgid "Remove hotke&y"
|
||
msgstr "Retire raccourci clavier"
|
||
|
||
#: tfrmoptionstoolbar.btnstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
||
msgid "Suggest"
|
||
msgstr "Suggestion"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
||
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
||
msgstr "Suggère un tooltip basé sur le type de bouton, sa commande et paramètres"
|
||
|
||
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
||
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
||
msgid "&Flat buttons"
|
||
msgstr "Bo&utons simples"
|
||
|
||
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
||
msgid "Report errors with commands"
|
||
msgstr "Rapporter les erreurs avec les commandes"
|
||
|
||
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
||
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
||
msgstr "Entrez les paramètres, un sur chaque ligne. Appuyez F1 pour obtenir de l'aide sur les paramètres."
|
||
|
||
#: tfrmoptionstoolbar.gbgroupbox.caption
|
||
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
|
||
msgid "Appearance"
|
||
msgstr "Apparence"
|
||
|
||
#: tfrmoptionstoolbar.lblbarsize.caption
|
||
msgctxt "tfrmoptionstoolbar.lblbarsize.caption"
|
||
msgid "&Bar size:"
|
||
msgstr "&Taille de la barre"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblexternalcommand.caption"
|
||
msgid "Comman&d:"
|
||
msgstr "Commande :"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Paramètres :"
|
||
|
||
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
|
||
msgid "Help"
|
||
msgstr "Aide"
|
||
|
||
#: tfrmoptionstoolbar.lblhotkey.caption
|
||
msgid "Hot key:"
|
||
msgstr "Raccourci clavier"
|
||
|
||
#: tfrmoptionstoolbar.lbliconfile.caption
|
||
msgctxt "tfrmoptionstoolbar.lbliconfile.caption"
|
||
msgid "Ico&n:"
|
||
msgstr "Icône :"
|
||
|
||
#: tfrmoptionstoolbar.lbliconsize.caption
|
||
msgctxt "tfrmoptionstoolbar.lbliconsize.caption"
|
||
msgid "Icon si&ze:"
|
||
msgstr "T&aille de l'icône :"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
|
||
msgid "Co&mmand:"
|
||
msgstr "Commande :"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
|
||
msgid "&Parameters:"
|
||
msgstr "Paramètres :"
|
||
|
||
#: tfrmoptionstoolbar.lblstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "&Chemin de démarrage :"
|
||
|
||
#: tfrmoptionstoolbar.lbltooltip.caption
|
||
msgctxt "tfrmoptionstoolbar.lbltooltip.caption"
|
||
msgid "&Tooltip:"
|
||
msgstr "&Infobulle :"
|
||
|
||
#: tfrmoptionstoolbar.miaddallcmds.caption
|
||
msgid "Add toolbar with ALL DC commands"
|
||
msgstr "Ajoute une barre d'outil avec TOUTES les commandes internes"
|
||
|
||
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
||
msgid "for an external command"
|
||
msgstr "pour une commande externe"
|
||
|
||
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
||
msgid "for an internal command"
|
||
msgstr "pour une commande interne"
|
||
|
||
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
||
msgid "for a separator"
|
||
msgstr "pour un séparateur"
|
||
|
||
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
||
msgid "for a sub-tool bar"
|
||
msgstr "pour un sous-menu"
|
||
|
||
#: tfrmoptionstoolbar.mibackup.caption
|
||
msgctxt "tfrmoptionstoolbar.mibackup.caption"
|
||
msgid "Backup..."
|
||
msgstr "Archivage..."
|
||
|
||
#: tfrmoptionstoolbar.miexport.caption
|
||
msgctxt "tfrmoptionstoolbar.miexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Exporter..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrent.caption
|
||
msgid "Current toolbar..."
|
||
msgstr "Barre courante..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "vers un fichier de barre d'outil (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "vers un fichier de barre d'outil TC en conservant les existants (.BAR)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "vers un fichier de barre d'outil TC en remplaçant les existants (.BAR)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "vers \"wincmd.ini\" de TC (conservant les existants)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "vers \"wincmd.ini\" de TC (remplaçant les existants)"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator3.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator4.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexporttop.caption
|
||
msgid "Top toolbar..."
|
||
msgstr "Barre d'outil principale..."
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
||
msgid "Save a backup of Toolbar"
|
||
msgstr "Savegarde une archive de la barre d'outil"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "vers un fichier de barre d'outils (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "vers un fichier .BAR de TC (remplace les existants)."
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "vers un fichier de barre d'outil TC en remplaçant les existants (.BAR)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "vers \"wincmd.ini\" de TC (conservant les existants)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "vers \"wincmd.ini\" de TC (remplaçant les existants)"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "immédiatement après la séelection courante"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "comme premier élément"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "comme dernier élément"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "immédiatement avant la sélection courante"
|
||
|
||
#: tfrmoptionstoolbar.miimport.caption
|
||
msgctxt "tfrmoptionstoolbar.miimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Importer..."
|
||
|
||
#: tfrmoptionstoolbar.miimportbackup.caption
|
||
msgid "Restore a backup of Toolbar"
|
||
msgstr "Ramène un backup de barre d'outils"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "pour ajouter à la barre d'outils courante"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "pour ajouter une nouvelle barre d'outils à la barre d'outil courante"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "pour ajouter une nouvelle barre d'outils à la barre d'outil principale"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "pour ajouter à la barre d'outils principale"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "pour remplace la barre d'outil pricipale"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbar.caption
|
||
msgid "from a Toolbar File (.toolbar)"
|
||
msgstr "d'un fichier de barre (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "pour ajouter à la barre d'outils courante"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "pour ajouter une nouvelle barre d'outils à la barre d'outil courante"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "pour ajouter une nouvelle barre d'outils à la barre d'outils principale"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "pour ajouter à la barre d'outils principale"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "pour remplace la barre d'outil pricipale"
|
||
|
||
#: tfrmoptionstoolbar.miimportseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbar.caption
|
||
msgid "from a single TC .BAR file"
|
||
msgstr "d'un fichier de barre de TC (.BAR)"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "pour ajouter à la barre d'outils courante"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "pour ajouter une nouvelle barre d'outils à la barre d'outil courante"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "pour ajouter une nouvelle barre d'outils à la barre d'outils principale"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "pour ajouter à la barre d'outils principale"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "pour remplace la barre d'outil pricipale"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcini.caption
|
||
msgid "from \"wincmd.ini\" of TC..."
|
||
msgstr "de \"wincmd.ini\" de TC"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "pour ajouter à la barre d'outils courante"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "pour ajouter une nouvelle barre d'outils à la barre d'outil courante"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "pour ajouter une nouvelle barre d'outils à la barre d'outils principale"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "pour ajouter à la barre d'outils principale"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "pour remplace la barre d'outil pricipale"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "immédiatement après la sélection courante"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "comme premier élément"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "comme dernier élément"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "immédiatement avant la sélection courante"
|
||
|
||
#: tfrmoptionstoolbar.misearchandreplace.caption
|
||
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
|
||
msgid "Search and replace..."
|
||
msgstr "Recherche et remplace..."
|
||
|
||
#: tfrmoptionstoolbar.miseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator10.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator11.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator13.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator14.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator6.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator7.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator8.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator9.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "immédiatement après la sélection courante"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
||
msgid "as first element"
|
||
msgstr "comme premier élément"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "comme dernier élément"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "immédiatement avant la sélection courante"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
||
msgid "in all of all the above..."
|
||
msgstr "dans tout ce qu'il y a plus haut..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
||
msgid "in all commands..."
|
||
msgstr "dans toutes les commandes"
|
||
|
||
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
||
msgid "in all icon names..."
|
||
msgstr "dans toutes les icônes"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
||
msgid "in all parameters..."
|
||
msgstr "dans tous les paramètres"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
||
msgid "in all start path..."
|
||
msgstr "dans tous les chemins de démarrage"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "immédiatement après la sélection courante"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "comme premier élément"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "comme dernier élément"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "immédiatement avant la sélection courante"
|
||
|
||
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
||
msgid "Button type"
|
||
msgstr "Type de bouton"
|
||
|
||
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
||
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSKEEPTERMINALOPEN.CAPTION"
|
||
msgid "&Keep terminal window open after executing program"
|
||
msgstr "Garder la fenêtre de terminal ouverte après avoir exécuté un programme"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSRUNINTERMINAL.CAPTION"
|
||
msgid "&Execute in terminal"
|
||
msgstr "Exécuter dans un terminal"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSUSEEXTERNALPROGRAM.CAPTION"
|
||
msgid "&Use external program"
|
||
msgstr "Utiliser un programme externe"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPARAMETERS.CAPTION"
|
||
msgid "A&dditional parameters"
|
||
msgstr "Paramètres supplémentaires"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolspath.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPATH.CAPTION"
|
||
msgid "&Path to program to execute"
|
||
msgstr "Chemin du programme à exécuter"
|
||
|
||
#: tfrmoptionstooltips.btnaddfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Ajouter"
|
||
|
||
#: tfrmoptionstooltips.btnapplyfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Appliquer"
|
||
|
||
#: tfrmoptionstooltips.btndeletefields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmoptionstooltips.btnfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Modèle..."
|
||
|
||
#: tfrmoptionstooltips.chkshowtooltip.caption
|
||
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
|
||
msgid "&Show tooltip for files in the file panel"
|
||
msgstr "Afficher les info-bulles dans les panneaux de fichiers"
|
||
|
||
#: tfrmoptionstooltips.gbcustomfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
|
||
msgid "Custom fields by file type"
|
||
msgstr "Champs personnalisés par type de fichier"
|
||
|
||
#: tfrmoptionstooltips.lblfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
|
||
msgid "Category &hint:"
|
||
msgstr "Indice de catégorie :"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsmask.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "Masque de catégorie :"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsname.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "Nom de catégorie :"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
||
msgid "With double-click on the bar on top of a file panel"
|
||
msgstr "Lors d'un double-clic sur la barre au-dessus du panneau de fichiers"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr "Via le menu et la commande interne"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
||
msgid "Double click in tree select and exit"
|
||
msgstr "Un double-clic sélectionne et quitte"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr "Via le menu et la commande interne"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
||
msgid "With double-click on a tab (if configured for it)"
|
||
msgstr "Lors d'un double-clic sur un onglet (si configuré pour cela)"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
||
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
||
msgstr "Lorsqu'on utilise un raccourcis-clavier, cela va quitter directement en retournant notre choix"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
||
msgid "Single mouse click in tree select and exit"
|
||
msgstr "Un clic-gauche sélectionne et quitte"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
||
msgid "Use it for Command Line History"
|
||
msgstr "Utilise pour l'historique de la ligne de commande"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
||
msgid "Use it for the Dir History"
|
||
msgstr "Utilise pour l'historique des dossiers"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
||
msgid "Use it for the View History (Visited paths for active view)"
|
||
msgstr "Utilise pour l'historique des chemins parcourus"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
||
msgid "Behavior regarding selection:"
|
||
msgstr "Comportement concernant la sélection :"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
||
msgid "Tree View Menus related options:"
|
||
msgstr "Options reliées au menu en arbre :"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
||
msgid "Where to use Tree View Menus:"
|
||
msgstr "Où utiliser les menu en arbre :"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblnote.caption
|
||
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
||
msgstr "*NOTE : Concernant les options comme la sensiblité à la casse, d'ignorer les accents ou non, ces options seront sauvegardées et ramenées pour chaque contexte d'un usage et d'une session à l'autre."
|
||
|
||
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
||
msgid "With Directory Hotlist:"
|
||
msgstr "Avec les dossiers favoris :"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
||
msgid "With Favorite Tabs:"
|
||
msgstr "Avec les onglets favoris :"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
||
msgid "With History:"
|
||
msgstr "Avec l'historique :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
||
msgid "Use and display keyboard shortcut for choosing items"
|
||
msgstr "Afficher et utiliser les raccourcis"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
||
msgid "Layout and colors options:"
|
||
msgstr "Options de disposition et de couleur :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
||
msgid "Background color:"
|
||
msgstr "Couleur de fond :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
||
msgid "Cursor color:"
|
||
msgstr "Couleur du curseur :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
||
msgid "Found text color:"
|
||
msgstr "Texte trouvé :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
||
msgid "Found text under cursor:"
|
||
msgstr "Texte trouvé sous le curseur :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
||
msgid "Normal text color:"
|
||
msgstr "Texte normal :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
||
msgid "Normal text under cursor:"
|
||
msgstr "Texte normal sous le curseur :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
||
msgid "Tree View Menu Preview:"
|
||
msgstr "Avant-goût du menu en arbre :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
||
msgid "Secondary text color:"
|
||
msgstr "Texte secondaire :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
||
msgid "Secondary text under cursor:"
|
||
msgstr "Texte secondaire sous le curseur :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
||
msgid "Shortcut color:"
|
||
msgstr "Raccourci :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
||
msgid "Shortcut under cursor:"
|
||
msgstr "Raccourci sous le curseur :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
||
msgid "Unselectable text color:"
|
||
msgstr "Texte non sélectionnable :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
||
msgid "Unselectable under cursor:"
|
||
msgstr "Texte non sélectionnable sous le curseur :"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
||
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
||
msgstr "Changer la couleur à gauche et vous observer un avant-goût du résultat à droite."
|
||
|
||
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWERBOOKMODE.CAPTION"
|
||
msgid "Viewer Book Mode"
|
||
msgstr "Vue en mode \"Book\" (book viewer)"
|
||
|
||
#: tfrmoptionsviewer.gbviewerexample.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
|
||
msgid "Example"
|
||
msgstr "Exemple"
|
||
|
||
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLBACKGROUNDCOLORVIEWERBOOK.CAPTION"
|
||
msgid "&Background color in book viewer"
|
||
msgstr "Arrière-plan dans la vue en mode \"Book\""
|
||
|
||
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLFONTCOLORVIEWERBOOK.CAPTION"
|
||
msgid "&Font color in book viewer"
|
||
msgstr "Couleur de la police en mode \"Book\""
|
||
|
||
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLNUMBERCOLUMNSVIEWER.CAPTION"
|
||
msgid "&Number of columns in book viewer"
|
||
msgstr "Nombre de colonne en mode \"Book\""
|
||
|
||
#: tfrmpackdlg.btnconfig.caption
|
||
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "&Configurer"
|
||
|
||
#: tfrmpackdlg.caption
|
||
msgctxt "TFRMPACKDLG.CAPTION"
|
||
msgid "Pack files"
|
||
msgstr "Compresser les fichiers"
|
||
|
||
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
||
msgid "C&reate separate archives, one per selected file/dir"
|
||
msgstr "Créer des archives séparées, &une par fichier/dossier"
|
||
|
||
#: tfrmpackdlg.cbcreatesfx.caption
|
||
msgid "Create self e&xtracting archive"
|
||
msgstr "Créer une archive auto-e&xtractible"
|
||
|
||
#: tfrmpackdlg.cbencrypt.caption
|
||
msgid "Encr&ypt"
|
||
msgstr "Cr&ypter"
|
||
|
||
#: tfrmpackdlg.cbmovetoarchive.caption
|
||
msgid "Mo&ve to archive"
|
||
msgstr "Déplacer les fichiers dans l'archive"
|
||
|
||
#: tfrmpackdlg.cbmultivolume.caption
|
||
msgid "&Multiple disk archive"
|
||
msgstr "Archive en plusieurs &volumes"
|
||
|
||
#: tfrmpackdlg.cbotherplugins.caption
|
||
msgid "=>"
|
||
msgstr "=>"
|
||
|
||
#: tfrmpackdlg.cbputintarfirst.caption
|
||
msgid "P&ut in the TAR archive first"
|
||
msgstr "Placer les fichiers dans une archive TAR avant de compresser"
|
||
|
||
#: tfrmpackdlg.cbstoredir.caption
|
||
msgid "Also &pack path names (only recursed)"
|
||
msgstr "Ajouter les noms de chemins dans l'archive (seulement si récursif)"
|
||
|
||
#: tfrmpackdlg.lblprompt.caption
|
||
msgid "Pack file(s) to the file:"
|
||
msgstr "Nom et emplacement du fichier archive :"
|
||
|
||
#: tfrmpackdlg.rgpacker.caption
|
||
msgid "Packer"
|
||
msgstr "Compression"
|
||
|
||
#: tfrmpackinfodlg.btnclose.caption
|
||
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Fermer"
|
||
|
||
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
||
msgid "Unpack &all and execute"
|
||
msgstr "&Tout extraire et exécuter"
|
||
|
||
#: tfrmpackinfodlg.btnunpackandexec.caption
|
||
msgid "&Unpack and execute"
|
||
msgstr "&Extraire et exécuter"
|
||
|
||
#: tfrmpackinfodlg.caption
|
||
msgctxt "TFRMPACKINFODLG.CAPTION"
|
||
msgid "Properties of packed file"
|
||
msgstr "Propriété de l'archive"
|
||
|
||
#: tfrmpackinfodlg.lblattributes.caption
|
||
msgid "Attributes:"
|
||
msgstr "Attributs :"
|
||
|
||
#: tfrmpackinfodlg.lblcompressionratio.caption
|
||
msgid "Compression ratio:"
|
||
msgstr "Taux de compression :"
|
||
|
||
#: tfrmpackinfodlg.lbldate.caption
|
||
msgid "Date:"
|
||
msgstr "Date :"
|
||
|
||
#: tfrmpackinfodlg.lblmethod.caption
|
||
msgid "Method:"
|
||
msgstr "Methode :"
|
||
|
||
#: tfrmpackinfodlg.lbloriginalsize.caption
|
||
msgid "Original size:"
|
||
msgstr "Taille originale :"
|
||
|
||
#: tfrmpackinfodlg.lblpackedfile.caption
|
||
msgid "File:"
|
||
msgstr "Fichier :"
|
||
|
||
#: tfrmpackinfodlg.lblpackedsize.caption
|
||
msgid "Packed size:"
|
||
msgstr "Taille de l'archive :"
|
||
|
||
#: tfrmpackinfodlg.lblpacker.caption
|
||
msgid "Packer:"
|
||
msgstr "Programme d'archivage :"
|
||
|
||
#: tfrmpackinfodlg.lbltime.caption
|
||
msgid "Time:"
|
||
msgstr "Date/heure :"
|
||
|
||
#: tfrmquicksearch.btncancel.caption
|
||
msgctxt "tfrmquicksearch.btncancel.caption"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmquicksearch.btncancel.hint
|
||
msgid "Close filter panel"
|
||
msgstr "Ferme le panneau de filtre"
|
||
|
||
#: tfrmquicksearch.edtsearch.hint
|
||
msgid "Enter text to search for or filter by"
|
||
msgstr "Entrez le texte à rechercher ou pour filtrer"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.caption
|
||
msgid "Aa"
|
||
msgstr "Aa"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.hint
|
||
msgid "Case Sensitive"
|
||
msgstr "Sensible à la casse"
|
||
|
||
#: tfrmquicksearch.sbdirectories.caption
|
||
msgid "D"
|
||
msgstr "D"
|
||
|
||
#: tfrmquicksearch.sbdirectories.hint
|
||
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
||
msgid "Directories"
|
||
msgstr "Dossiers"
|
||
|
||
#: tfrmquicksearch.sbfiles.caption
|
||
msgid "F"
|
||
msgstr "F"
|
||
|
||
#: tfrmquicksearch.sbfiles.hint
|
||
msgctxt "tfrmquicksearch.sbfiles.hint"
|
||
msgid "Files"
|
||
msgstr "Fichiers"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.caption
|
||
msgid "{"
|
||
msgstr "{"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.hint
|
||
msgid "Match Beginning"
|
||
msgstr "Que le début corresponde"
|
||
|
||
#: tfrmquicksearch.sbmatchending.caption
|
||
msgid "}"
|
||
msgstr "}"
|
||
|
||
#: tfrmquicksearch.sbmatchending.hint
|
||
msgid "Match Ending"
|
||
msgstr "Que la fin corresponde"
|
||
|
||
#: tfrmquicksearch.tglfilter.caption
|
||
msgctxt "tfrmquicksearch.tglfilter.caption"
|
||
msgid "Filter"
|
||
msgstr "Filtres"
|
||
|
||
#: tfrmquicksearch.tglfilter.hint
|
||
msgid "Toggle between search or filter"
|
||
msgstr "Alterner entre la recherche et le filtre"
|
||
|
||
#: tfrmsearchplugin.btnadd.caption
|
||
msgid "&More rules"
|
||
msgstr "D'avantage de règles"
|
||
|
||
#: tfrmsearchplugin.btndelete.caption
|
||
msgid "L&ess rules"
|
||
msgstr "Moins de règles"
|
||
|
||
#: tfrmsearchplugin.chkuseplugins.caption
|
||
msgid "Use &content plugins, combine with:"
|
||
msgstr "Utiliser les \"plugins\" de contenu, combiner avec :"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[0].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
|
||
msgid "Plugin"
|
||
msgstr "\"Plugin\""
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[1].text
|
||
msgid "Field"
|
||
msgstr "Champ"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[2].text
|
||
msgid "Operator"
|
||
msgstr "Opérateur"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[3].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: tfrmsearchplugin.rband.caption
|
||
msgid "&AND (all match)"
|
||
msgstr "ET (tout correspond)"
|
||
|
||
#: tfrmsearchplugin.rbor.caption
|
||
msgid "&OR (any match)"
|
||
msgstr "OU (n'importe quel concordance)"
|
||
|
||
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmselecttextrange.btppanel.closebutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Fermer"
|
||
|
||
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Ai&de"
|
||
|
||
#: tfrmselecttextrange.btppanel.okbutton.caption
|
||
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmselecttextrange.lblselecttext.caption
|
||
msgid "&Select the characters to insert:"
|
||
msgstr "Choisissez les caractères à insérer :"
|
||
|
||
#: tfrmsetfileproperties.btncancel.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmsetfileproperties.btnok.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmsetfileproperties.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change attributes"
|
||
msgstr "Changer les attributs"
|
||
|
||
#: tfrmsetfileproperties.cbsgid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmsetfileproperties.cbsticky.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Collant"
|
||
|
||
#: tfrmsetfileproperties.cbsuid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmsetfileproperties.chkarchive.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
|
||
msgid "Archive"
|
||
msgstr "Archive"
|
||
|
||
#: tfrmsetfileproperties.chkcreationtime.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
|
||
msgid "Created:"
|
||
msgstr "Créé :"
|
||
|
||
#: tfrmsetfileproperties.chkhidden.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
|
||
msgid "Hidden"
|
||
msgstr "Caché"
|
||
|
||
#: tfrmsetfileproperties.chklastaccesstime.caption
|
||
msgid "Accessed:"
|
||
msgstr "Accédé :"
|
||
|
||
#: tfrmsetfileproperties.chklastwritetime.caption
|
||
msgid "Modified:"
|
||
msgstr "Modifié :"
|
||
|
||
#: tfrmsetfileproperties.chkreadonly.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
|
||
msgid "Read only"
|
||
msgstr "Lecture seule"
|
||
|
||
#: tfrmsetfileproperties.chkrecursive.caption
|
||
msgid "Including subfolders"
|
||
msgstr "Récursif"
|
||
|
||
#: tfrmsetfileproperties.chksystem.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
|
||
msgid "System"
|
||
msgstr "Système"
|
||
|
||
#: tfrmsetfileproperties.gbtimesamp.caption
|
||
msgid "Timestamp properties"
|
||
msgstr "Propriétés de l'horodatage"
|
||
|
||
#: tfrmsetfileproperties.gbunixattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Attributs"
|
||
|
||
#: tfrmsetfileproperties.gbwinattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Attributs"
|
||
|
||
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Bits :"
|
||
|
||
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Groupe"
|
||
|
||
#: tfrmsetfileproperties.lblattrinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(les champs grisés signifient des valeurs inchangées)"
|
||
|
||
#: tfrmsetfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Autres"
|
||
|
||
#: tfrmsetfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Prorpiétaire"
|
||
|
||
#: tfrmsetfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmsetfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Texte :"
|
||
|
||
#: tfrmsetfileproperties.lblexec.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Exécuter"
|
||
|
||
#: tfrmsetfileproperties.lblmodeinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(les champs grisés signifient des valeurs inchangées)"
|
||
|
||
#: tfrmsetfileproperties.lbloctal.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Octal :"
|
||
|
||
#: tfrmsetfileproperties.lblread.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Lire"
|
||
|
||
#: tfrmsetfileproperties.lblwrite.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Écrire"
|
||
|
||
#: tfrmsplitter.btncancel.caption
|
||
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmsplitter.btnftchoice.caption
|
||
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmsplitter.btnok.caption
|
||
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmsplitter.btnrelativeftchoice.hint
|
||
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Fonctions pour choisir le chemin approprié"
|
||
|
||
#: tfrmsplitter.caption
|
||
msgctxt "TFRMSPLITTER.CAPTION"
|
||
msgid "Splitter"
|
||
msgstr "Découper le fichier"
|
||
|
||
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
||
msgid "Require a CRC32 verification file"
|
||
msgstr "Demander un fichier de vérification de signature CRC21"
|
||
|
||
#: tfrmsplitter.cmbxsize.text
|
||
msgid "1457664B - 3.5\""
|
||
msgstr "1457664B - 3.5\""
|
||
|
||
#: tfrmsplitter.grbxfile.caption
|
||
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Nom du fichier"
|
||
|
||
#: tfrmsplitter.grbxsize.caption
|
||
msgid "Size and number of parts"
|
||
msgstr "Taille et nombre de parts"
|
||
|
||
#: tfrmsplitter.lbdirtarget.caption
|
||
msgid "Directory &target"
|
||
msgstr "Dossier-cible"
|
||
|
||
#: tfrmsplitter.lbfilesource.caption
|
||
msgid "File &source"
|
||
msgstr "Fichier source"
|
||
|
||
#: tfrmsplitter.lblnumberparts.caption
|
||
msgid "&Number of parts"
|
||
msgstr "Nombre de blocs"
|
||
|
||
#: tfrmsplitter.rbtnbyte.caption
|
||
msgid "&Bytes"
|
||
msgstr "Octets"
|
||
|
||
#: tfrmsplitter.rbtngigab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
|
||
msgid "&Gigabytes"
|
||
msgstr "Gigaoctets"
|
||
|
||
#: tfrmsplitter.rbtnkilob.caption
|
||
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
|
||
msgid "&Kilobytes"
|
||
msgstr "Kilooctets"
|
||
|
||
#: tfrmsplitter.rbtnmegab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
|
||
msgid "&Megabytes"
|
||
msgstr "Mégaoctets"
|
||
|
||
#: tfrmstartingsplash.caption
|
||
msgctxt "tfrmstartingsplash.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblbuild.caption
|
||
msgctxt "tfrmstartingsplash.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Date révision"
|
||
|
||
#: tfrmstartingsplash.lblfreepascalver.caption
|
||
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmstartingsplash.lbllazarusver.caption
|
||
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmstartingsplash.lbloperatingsystem.caption
|
||
msgid "Operating System"
|
||
msgstr "Système d'explotation"
|
||
|
||
#: tfrmstartingsplash.lblplatform.caption
|
||
msgid "Platform"
|
||
msgstr "Plateforme"
|
||
|
||
#: tfrmstartingsplash.lblrevision.caption
|
||
msgctxt "tfrmstartingsplash.lblrevision.caption"
|
||
msgid "Revision"
|
||
msgstr "Révision"
|
||
|
||
#: tfrmstartingsplash.lbltitle.caption
|
||
msgctxt "tfrmstartingsplash.lbltitle.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblversion.caption
|
||
msgctxt "tfrmstartingsplash.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Version"
|
||
|
||
#: tfrmstartingsplash.lblwidgetsetver.caption
|
||
msgid "WidgetsetVer"
|
||
msgstr "Version de Widget"
|
||
|
||
#: tfrmsymlink.btncancel.caption
|
||
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmsymlink.btnok.caption
|
||
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmsymlink.caption
|
||
msgid "Create symbolic link"
|
||
msgstr "Créer un lien symbolique"
|
||
|
||
#: tfrmsymlink.lblexistingfile.caption
|
||
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "Destination vers laquelle le lien va pointer"
|
||
|
||
#: tfrmsymlink.lbllinktocreate.caption
|
||
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "Nom du lien"
|
||
|
||
#: tfrmsyncdirsdlg.btnclose.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
|
||
msgid "Close"
|
||
msgstr "Fermer"
|
||
|
||
#: tfrmsyncdirsdlg.btncompare.caption
|
||
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Comparer"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir1.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir2.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Appairer"
|
||
|
||
#: tfrmsyncdirsdlg.caption
|
||
msgid "Synchronize directories"
|
||
msgstr "Appairer les dossiers"
|
||
|
||
#: tfrmsyncdirsdlg.cbextfilter.text
|
||
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
||
msgid "asymmetric"
|
||
msgstr "asymétrique"
|
||
|
||
#: tfrmsyncdirsdlg.chkbycontent.caption
|
||
msgid "by content"
|
||
msgstr "par contenu"
|
||
|
||
#: tfrmsyncdirsdlg.chkignoredate.caption
|
||
msgid "ignore date"
|
||
msgstr "ignorer la date"
|
||
|
||
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
||
msgid "only selected"
|
||
msgstr "seulement les sélections"
|
||
|
||
#: tfrmsyncdirsdlg.chksubdirs.caption
|
||
msgid "Subdirs"
|
||
msgstr "Sous-dossiers"
|
||
|
||
#: tfrmsyncdirsdlg.groupbox1.caption
|
||
msgid "Show:"
|
||
msgstr "Montre :"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
|
||
msgid "Size"
|
||
msgstr "Taille"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
|
||
msgid "Date"
|
||
msgstr "Date"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
||
msgid "<=>"
|
||
msgstr "<=>"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
|
||
msgid "Date"
|
||
msgstr "Date"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
|
||
msgid "Size"
|
||
msgstr "Taille"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: tfrmsyncdirsdlg.label1.caption
|
||
msgid "(in main window)"
|
||
msgstr "(dans la fenêtre principale)"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
||
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Comparer"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
||
msgid "View left"
|
||
msgstr "Vue de gauche"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
||
msgid "View right"
|
||
msgstr "Vue de droite"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyright.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmsyncdirsdlg.sbduplicates.caption
|
||
msgid "duplicates"
|
||
msgstr "dupliqué"
|
||
|
||
#: tfrmsyncdirsdlg.sbequal.caption
|
||
msgid "="
|
||
msgstr "="
|
||
|
||
#: tfrmsyncdirsdlg.sbnotequal.caption
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: tfrmsyncdirsdlg.sbsingles.caption
|
||
msgid "singles"
|
||
msgstr "uniques"
|
||
|
||
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
||
msgid "Please press \"Compare\" to start"
|
||
msgstr "Appuyez \\Comparer\" pour lancer"
|
||
|
||
#: tfrmsyncdirsperformdlg.caption
|
||
msgctxt "tfrmsyncdirsperformdlg.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Synchronise"
|
||
|
||
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
||
msgid "Confirm overwrites"
|
||
msgstr "Confirmer l'écrasement"
|
||
|
||
#: tfrmtreeviewmenu.caption
|
||
msgctxt "tfrmtreeviewmenu.caption"
|
||
msgid "Tree View Menu"
|
||
msgstr "Menu en arbre"
|
||
|
||
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
||
msgid "Select your hot directory:"
|
||
msgstr "Choisissez votre dossier favori :"
|
||
|
||
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
||
msgid "Search is case sensitive"
|
||
msgstr "Recherche stricte respectant majuscules/minuscules"
|
||
|
||
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
||
msgid "Full collapse"
|
||
msgstr "Replier toutes les branches"
|
||
|
||
#: tfrmtreeviewmenu.pmifullexpand.caption
|
||
msgid "Full expand"
|
||
msgstr "Déployer les branchess"
|
||
|
||
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
||
msgid "Search ignore accents and ligatures"
|
||
msgstr "Ignorer les accents et ligatures durant la recherche"
|
||
|
||
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
||
msgid "Search is not case sensitive"
|
||
msgstr "Recherche en ignorant majuscules/minuscules"
|
||
|
||
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
||
msgid "Search is strict regarding accents and ligatures"
|
||
msgstr "Recherche stricte respectant les accents et ligatures"
|
||
|
||
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
||
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
||
msgstr "Ne pas montrer la branche si la chaîne recherchée ne se trouve que dans le nom de cette branche"
|
||
|
||
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
||
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
||
msgstr "Si la chaîne recherché se trouve dans le nom de la branche, afficher cette branche même si rien à l'intérieur de correspond"
|
||
|
||
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
||
msgid "Close Tree View Menu"
|
||
msgstr "Fermer le menu en arbre"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Configuration du menu en arbre"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Configuration des couleurs du menu en arbre"
|
||
|
||
#: tfrmtweakplugin.btnadd.caption
|
||
msgid "A&dd new"
|
||
msgstr "Ajouter un nouveau"
|
||
|
||
#: tfrmtweakplugin.btncancel.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmtweakplugin.btnchange.caption
|
||
msgid "C&hange"
|
||
msgstr "Changer"
|
||
|
||
#: tfrmtweakplugin.btndefault.caption
|
||
msgid "De&fault"
|
||
msgstr "Défaut"
|
||
|
||
#: tfrmtweakplugin.btnok.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmtweakplugin.btnremove.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmtweakplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
|
||
msgid "Tweak plugin"
|
||
msgstr "Raffiner le \"plugin\""
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
||
msgid "De&tect archive type by content"
|
||
msgstr "Détecter le type des archives par le contenu"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
||
msgid "Can de&lete files"
|
||
msgstr "Peut supprimer des fichiers"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
||
msgid "Supports e&ncryption"
|
||
msgstr "Supporte le cryptage"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
||
msgid "Sho&w as normal files (hide packer icon)"
|
||
msgstr "Afficher comme des fichiers normaux (cacher l'icône d'archive)"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
||
msgid "Supports pac&king in memory"
|
||
msgstr "Supporte les opérations d'archivage en mémoire"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
||
msgid "Can &modify existing archives"
|
||
msgstr "Peut modifier une archive existante"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
||
msgid "&Archive can contain multiple files"
|
||
msgstr "L'archive peut contenir plusieurs fichiers"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_new.caption
|
||
msgid "Can create new archi&ves"
|
||
msgstr "Peut créer de nouvelles archives"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_options.caption
|
||
msgid "S&upports the options dialogbox"
|
||
msgstr "Supporte les boites de dialogue avec les options"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
||
msgid "Allow searchin&g for text in archives"
|
||
msgstr "Autoriser la recherche de texte dans les archives"
|
||
|
||
#: tfrmtweakplugin.lbldescription.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
|
||
msgid "&Description:"
|
||
msgstr "Description :"
|
||
|
||
#: tfrmtweakplugin.lbldetectstr.caption
|
||
msgid "D&etect string:"
|
||
msgstr "Chaine à détecter :"
|
||
|
||
#: tfrmtweakplugin.lblextension.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
|
||
msgid "&Extension:"
|
||
msgstr "Extension :"
|
||
|
||
#: tfrmtweakplugin.lblflags.caption
|
||
msgid "Flags:"
|
||
msgstr "Marqueurs :"
|
||
|
||
#: tfrmtweakplugin.lblname.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
|
||
msgid "&Name:"
|
||
msgstr "Nom :"
|
||
|
||
#: tfrmtweakplugin.lblplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "\"Plugin\" :"
|
||
|
||
#: tfrmtweakplugin.lblplugin1.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "\"Plugin\" :"
|
||
|
||
#: tfrmviewer.actabout.caption
|
||
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
|
||
msgid "About Viewer..."
|
||
msgstr "A propos de la visionneuse"
|
||
|
||
#: tfrmviewer.actabout.hint
|
||
msgid "Displays the About message"
|
||
msgstr "Affiche le message d'À propos"
|
||
|
||
#: tfrmviewer.actcopyfile.caption
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
||
msgid "Copy File"
|
||
msgstr "Copie fichier"
|
||
|
||
#: tfrmviewer.actcopyfile.hint
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
||
msgid "Copy File"
|
||
msgstr "Copie fichier"
|
||
|
||
#: tfrmviewer.actcopytoclipboard.caption
|
||
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
||
msgid "Copy To Clipboard"
|
||
msgstr "Copier vers le presse-papier"
|
||
|
||
#: tfrmviewer.actcopytoclipboardformatted.caption
|
||
msgid "Copy To Clipboard Formatted"
|
||
msgstr "Coper vers le presse-papier"
|
||
|
||
#: tfrmviewer.actdeletefile.caption
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
||
msgid "Delete File"
|
||
msgstr "Efface le fichier"
|
||
|
||
#: tfrmviewer.actdeletefile.hint
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
||
msgid "Delete File"
|
||
msgstr "Efface le fichier"
|
||
|
||
#: tfrmviewer.actexitviewer.caption
|
||
msgctxt "tfrmviewer.actexitviewer.caption"
|
||
msgid "E&xit"
|
||
msgstr "&Quitter"
|
||
|
||
#: tfrmviewer.actfind.caption
|
||
msgctxt "tfrmviewer.actfind.caption"
|
||
msgid "Find"
|
||
msgstr "Rechercher"
|
||
|
||
#: tfrmviewer.actfindnext.caption
|
||
msgctxt "tfrmviewer.actfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Rechercher le suivant"
|
||
|
||
#: tfrmviewer.actfindprev.caption
|
||
msgctxt "tfrmviewer.actfindprev.caption"
|
||
msgid "Find previous"
|
||
msgstr "Recherche précédent"
|
||
|
||
#: tfrmviewer.actfullscreen.caption
|
||
msgctxt "tfrmviewer.actfullscreen.caption"
|
||
msgid "Full Screen"
|
||
msgstr "Plein écran"
|
||
|
||
#: tfrmviewer.actimagecenter.caption
|
||
msgctxt "tfrmviewer.actimagecenter.caption"
|
||
msgid "Center"
|
||
msgstr "Centrer"
|
||
|
||
#: tfrmviewer.actloadnextfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
|
||
msgid "&Next"
|
||
msgstr "Sui&vant"
|
||
|
||
#: tfrmviewer.actloadnextfile.hint
|
||
msgid "Load Next File"
|
||
msgstr "Charger le fichier suivant"
|
||
|
||
#: tfrmviewer.actloadprevfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
|
||
msgid "&Previous"
|
||
msgstr "&Précédent"
|
||
|
||
#: tfrmviewer.actloadprevfile.hint
|
||
msgid "Load Previous File"
|
||
msgstr "Charger le fichier précédent"
|
||
|
||
#: tfrmviewer.actmirrorhorz.caption
|
||
msgid "Mirror Horizontally"
|
||
msgstr "Miroir horizontal"
|
||
|
||
#: tfrmviewer.actmirrorhorz.hint
|
||
msgctxt "tfrmviewer.actmirrorhorz.hint"
|
||
msgid "Mirror"
|
||
msgstr "Miroir"
|
||
|
||
#: tfrmviewer.actmirrorvert.caption
|
||
msgid "Mirror Vertically"
|
||
msgstr "Miroir vertical"
|
||
|
||
#: tfrmviewer.actmovefile.caption
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
||
msgid "Move File"
|
||
msgstr "Déplace fichier"
|
||
|
||
#: tfrmviewer.actmovefile.hint
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
||
msgid "Move File"
|
||
msgstr "Déplace fichier"
|
||
|
||
#: tfrmviewer.actpreview.caption
|
||
msgctxt "tfrmviewer.actpreview.caption"
|
||
msgid "Preview"
|
||
msgstr "Prévisualisation"
|
||
|
||
#: tfrmviewer.actreload.caption
|
||
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
||
msgid "Reload"
|
||
msgstr "Recharger"
|
||
|
||
#: tfrmviewer.actreload.hint
|
||
msgid "Reload current file"
|
||
msgstr "Recharger le fichier courant"
|
||
|
||
#: tfrmviewer.actrotate180.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
|
||
msgid "+ 180"
|
||
msgstr "Tourner de 180 degrés"
|
||
|
||
#: tfrmviewer.actrotate180.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
|
||
msgid "Rotate 180 degrees"
|
||
msgstr "Tourner de 180 degrés"
|
||
|
||
#: tfrmviewer.actrotate270.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
|
||
msgid "- 90"
|
||
msgstr "Tourner de 270 degrés"
|
||
|
||
#: tfrmviewer.actrotate270.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
|
||
msgid "Rotate -90 degrees"
|
||
msgstr "Tourner de 270 degrés"
|
||
|
||
#: tfrmviewer.actrotate90.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
|
||
msgid "+ 90"
|
||
msgstr "Tourner de 90 degrés"
|
||
|
||
#: tfrmviewer.actrotate90.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
|
||
msgid "Rotate +90 degrees"
|
||
msgstr "Tourner de 90 degrés"
|
||
|
||
#: tfrmviewer.actsave.caption
|
||
msgctxt "tfrmviewer.actsave.caption"
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: tfrmviewer.actsaveas.caption
|
||
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
|
||
msgid "Save As..."
|
||
msgstr "Enregistrer sous..."
|
||
|
||
#: tfrmviewer.actsaveas.hint
|
||
msgid "Save File As..."
|
||
msgstr "Sauvegarder le fichier sous..."
|
||
|
||
#: tfrmviewer.actscreenshot.caption
|
||
msgctxt "tfrmviewer.actscreenshot.caption"
|
||
msgid "Screenshot"
|
||
msgstr "Capture d'écran"
|
||
|
||
#: tfrmviewer.actscreenshotdelay3sec.caption
|
||
msgid "Delay 3 sec"
|
||
msgstr "Délai de 3 secondes"
|
||
|
||
#: tfrmviewer.actscreenshotdelay5sec.caption
|
||
msgid "Delay 5 sec"
|
||
msgstr "Délain de 5 seconde"
|
||
|
||
#: tfrmviewer.actselectall.caption
|
||
msgctxt "tfrmviewer.actselectall.caption"
|
||
msgid "Select All"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: tfrmviewer.actshowasbin.caption
|
||
msgid "Show as &Bin"
|
||
msgstr "Vue en Binaire"
|
||
|
||
#: tfrmviewer.actshowasbook.caption
|
||
msgid "Show as B&ook"
|
||
msgstr "Vue en mode \"Book\""
|
||
|
||
#: tfrmviewer.actshowasdec.caption
|
||
msgid "Show as &Dec"
|
||
msgstr "Vue en Décimal"
|
||
|
||
#: tfrmviewer.actshowashex.caption
|
||
msgid "Show as &Hex"
|
||
msgstr "Vue en Hexadécimal"
|
||
|
||
#: tfrmviewer.actshowastext.caption
|
||
msgid "Show as &Text"
|
||
msgstr "Vue en mode Texte"
|
||
|
||
#: tfrmviewer.actshowaswraptext.caption
|
||
msgid "Show as &Wrap text"
|
||
msgstr "Vue en mode Texte avec retour à la ligne"
|
||
|
||
#: tfrmviewer.actshowgraphics.caption
|
||
msgctxt "tfrmviewer.actshowgraphics.caption"
|
||
msgid "Graphics"
|
||
msgstr "Graphiques"
|
||
|
||
#: tfrmviewer.actshowplugins.caption
|
||
msgctxt "tfrmviewer.actshowplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "\"Plugins\""
|
||
|
||
#: tfrmviewer.actstretchimage.caption
|
||
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
|
||
msgid "Stretch"
|
||
msgstr "Étirer"
|
||
|
||
#: tfrmviewer.actstretchimage.hint
|
||
msgid "Stretch Image"
|
||
msgstr "Étendre l'image"
|
||
|
||
#: tfrmviewer.actstretchonlylarge.caption
|
||
msgctxt "tfrmviewer.actstretchonlylarge.caption"
|
||
msgid "Stretch only large"
|
||
msgstr "Étendre seulement les grandes images"
|
||
|
||
#: tfrmviewer.actzoom.caption
|
||
msgid "Zoom"
|
||
msgstr "Zoom"
|
||
|
||
#: tfrmviewer.actzoomin.caption
|
||
msgctxt "tfrmviewer.actzoomin.caption"
|
||
msgid "Zoom In"
|
||
msgstr "Zoom +"
|
||
|
||
#: tfrmviewer.actzoomout.caption
|
||
msgctxt "tfrmviewer.actzoomout.caption"
|
||
msgid "Zoom Out"
|
||
msgstr "Zoom -"
|
||
|
||
#: tfrmviewer.btncopyfile.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmviewer.btncopyfile1.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: tfrmviewer.btncuttuimage.hint
|
||
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
|
||
msgid "Crop"
|
||
msgstr "Rogner"
|
||
|
||
#: tfrmviewer.btndeletefile.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmviewer.btndeletefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: tfrmviewer.btnfullscreen.hint
|
||
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
||
msgid "Full Screen"
|
||
msgstr "Plein écran"
|
||
|
||
#: tfrmviewer.btngifmove.caption
|
||
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmviewer.btngiftobmp.caption
|
||
msgid "S"
|
||
msgstr "S"
|
||
|
||
#: tfrmviewer.btnhightlight.hint
|
||
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
||
msgid "Highlight"
|
||
msgstr "Surbrillance"
|
||
|
||
#: tfrmviewer.btnmovefile.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
|
||
msgid "Move"
|
||
msgstr "Déplacer"
|
||
|
||
#: tfrmviewer.btnmovefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
|
||
msgid "Move"
|
||
msgstr "Déplacer"
|
||
|
||
#: tfrmviewer.btnnextgifframe.caption
|
||
msgid "||>"
|
||
msgstr "||>"
|
||
|
||
#: tfrmviewer.btnpaint.hint
|
||
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
||
msgid "Paint"
|
||
msgstr "Colorer"
|
||
|
||
#: tfrmviewer.btnprevgifframe.caption
|
||
msgid "<||"
|
||
msgstr "<||"
|
||
|
||
#: tfrmviewer.btnredeye.hint
|
||
msgid "Red Eyes"
|
||
msgstr "Yeux rouges"
|
||
|
||
#: tfrmviewer.btnresize.hint
|
||
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
|
||
msgid "Resize"
|
||
msgstr "Redimensionner"
|
||
|
||
#: tfrmviewer.btnundo.hint
|
||
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Annuler"
|
||
|
||
#: tfrmviewer.caption
|
||
msgctxt "tfrmviewer.caption"
|
||
msgid "Viewer"
|
||
msgstr "Visionneuse"
|
||
|
||
#: tfrmviewer.cbslideshow.caption
|
||
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Diaporama"
|
||
|
||
#: tfrmviewer.comboboxpaint.text
|
||
msgid "Pen"
|
||
msgstr "Crayon"
|
||
|
||
#: tfrmviewer.comboboxwidth.text
|
||
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmviewer.gboxhightlight.caption
|
||
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
||
msgid "Highlight"
|
||
msgstr "Surbrillance"
|
||
|
||
#: tfrmviewer.gboxpaint.caption
|
||
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
||
msgid "Paint"
|
||
msgstr "Colorer"
|
||
|
||
#: tfrmviewer.gboxslideshow.caption
|
||
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Diaporama"
|
||
|
||
#: tfrmviewer.gboxview.caption
|
||
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Vue"
|
||
|
||
#: tfrmviewer.lblhightlight.caption
|
||
msgid "0x0"
|
||
msgstr "0x0"
|
||
|
||
#: tfrmviewer.miabout.caption
|
||
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "A propos"
|
||
|
||
#: tfrmviewer.midiv1.caption
|
||
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv2.caption
|
||
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv3.caption
|
||
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv4.caption
|
||
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv5.caption
|
||
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miedit.caption
|
||
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Édit&er"
|
||
|
||
#: tfrmviewer.miencoding.caption
|
||
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "En&codage"
|
||
|
||
#: tfrmviewer.mifile.caption
|
||
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Fichier"
|
||
|
||
#: tfrmviewer.miimage.caption
|
||
msgid "&Image"
|
||
msgstr "&Image"
|
||
|
||
#: tfrmviewer.miprint.caption
|
||
msgid "Print..."
|
||
msgstr "Imprimer..."
|
||
|
||
#: tfrmviewer.mirotate.caption
|
||
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
|
||
msgid "Rotate"
|
||
msgstr "Pivoter"
|
||
|
||
#: tfrmviewer.miscreenshot.caption
|
||
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
||
msgid "Screenshot"
|
||
msgstr "Capture d'écran"
|
||
|
||
#: tfrmviewer.miseparator.caption
|
||
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miview.caption
|
||
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
||
msgid "&View"
|
||
msgstr "&Vue"
|
||
|
||
#: tfrmviewer.pmiselectall.caption
|
||
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Quand le fichier existe"
|
||
|
||
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Quand le fichier existe"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Copy d&ate/time"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
||
msgid "Work in background (separate connection)"
|
||
msgstr "Travailler en arrière-plan (connexion séparée)"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Quand le fichier existe"
|
||
|
||
#: uexifreader.rsdatetimeoriginal
|
||
msgid "Date taken"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsimageheight
|
||
#, fuzzy
|
||
msgctxt "uexifreader.rsimageheight"
|
||
msgid "Height"
|
||
msgstr "Hauteur"
|
||
|
||
#: uexifreader.rsimagewidth
|
||
#, fuzzy
|
||
msgctxt "uexifreader.rsimagewidth"
|
||
msgid "Width"
|
||
msgstr "Largeur"
|
||
|
||
#: uexifreader.rsmake
|
||
msgid "Manufacturer"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsmodel
|
||
msgid "Camera model"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsorientation
|
||
msgid "Orientation"
|
||
msgstr ""
|
||
|
||
#: ulng.msgtrytolocatecrcfile
|
||
msgid ""
|
||
"This file cannot be found and could help to validate final combination of files:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Could you make it available and press \"OK\" when ready,\n"
|
||
"or press \"CANCEL\" to continue without it?\n"
|
||
msgstr ""
|
||
"Ce fichier est introuvable et pourrait aider à valider la concaténation des fichiers à la finl:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Est-ce que vous pourriez le rendre disponible et appuyer \"OK\" quand vous êtes prêt,\n"
|
||
"ou \"ANNULER\" pour continuer tout de même sans ce fichier?\n"
|
||
|
||
#: ulng.rscancelfilter
|
||
msgid "Cancel Quick Filter"
|
||
msgstr "Annule le filtre rapide"
|
||
|
||
#: ulng.rscanceloperation
|
||
msgid "Cancel Current Operation"
|
||
msgstr "Annuler l'opération en cours"
|
||
|
||
#: ulng.rscaptionforaskingfilename
|
||
msgid "Enter filename, with extension, for dropped text"
|
||
msgstr "Entrez le nom, avec l'extension, pour le texte déposé"
|
||
|
||
#: ulng.rscaptionfortextformattoimport
|
||
msgid "Text format to import"
|
||
msgstr "Format du texteà importer"
|
||
|
||
#: ulng.rschecksumverifybroken
|
||
msgid "Broken:"
|
||
msgstr "Brisé :"
|
||
|
||
#: ulng.rschecksumverifygeneral
|
||
msgid "General:"
|
||
msgstr "Général :"
|
||
|
||
#: ulng.rschecksumverifymissing
|
||
msgid "Missing:"
|
||
msgstr "Manquant :"
|
||
|
||
#: ulng.rschecksumverifyreaderror
|
||
msgid "Read error:"
|
||
msgstr "Erreur de lecture :"
|
||
|
||
#: ulng.rschecksumverifysuccess
|
||
msgid "Success:"
|
||
msgstr "Succès :"
|
||
|
||
#: ulng.rschecksumverifytext
|
||
msgid "Enter checksum and select algorithm:"
|
||
msgstr "Entrer la signature et sélectionnez l'algorithme"
|
||
|
||
#: ulng.rschecksumverifytitle
|
||
msgid "Verify checksum"
|
||
msgstr "Vérifier la signature"
|
||
|
||
#: ulng.rschecksumverifytotal
|
||
msgid "Total:"
|
||
msgstr "Total :"
|
||
|
||
#: ulng.rsclearfiltersornot
|
||
msgid "Do you want to clear filters for this new search?"
|
||
msgstr "Voulez-vous réinitialiser les recherches pour cette nouvelle recherche?"
|
||
|
||
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
||
msgid "Clipboard doesn't contain any valid toolbar data."
|
||
msgstr "Le presse papier ne contient aucune information de barre d'outils"
|
||
|
||
#: ulng.rscmdcategorylistinorder
|
||
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
||
msgstr "Tous;Panneau actif;Panneau de gauche;Panneau de droite;Opérations sur fichier;Configuration;Réseau;Divers;Port parallèle;Impression;Sélection;Securité;Presse-papier;FTP;Navigation;Aide;Window;Ligne de commande;Outil;Affichage;Utilisateur;Onglet;Tri;Journal"
|
||
|
||
#: ulng.rscmdkindofsort
|
||
msgid "Legacy sorted;A-Z sorted"
|
||
msgstr "Ordonné de manière classique;Trié alphabétiquement"
|
||
|
||
#: ulng.rscolattr
|
||
msgid "Attr"
|
||
msgstr "Attr"
|
||
|
||
#: ulng.rscoldate
|
||
msgctxt "ulng.rscoldate"
|
||
msgid "Date"
|
||
msgstr "Date"
|
||
|
||
#: ulng.rscolext
|
||
msgid "Ext"
|
||
msgstr "Ext"
|
||
|
||
#: ulng.rscolname
|
||
msgctxt "ulng.rscolname"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: ulng.rscolsize
|
||
msgctxt "ulng.rscolsize"
|
||
msgid "Size"
|
||
msgstr "Taille"
|
||
|
||
#: ulng.rsconfcolalign
|
||
msgid "Align"
|
||
msgstr "Aligner"
|
||
|
||
#: ulng.rsconfcolcaption
|
||
msgid "Caption"
|
||
msgstr "Légende"
|
||
|
||
#: ulng.rsconfcoldelete
|
||
msgctxt "ulng.rsconfcoldelete"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: ulng.rsconfcolfieldcont
|
||
msgid "Field contents"
|
||
msgstr "Contenu du champ"
|
||
|
||
#: ulng.rsconfcolmove
|
||
msgctxt "ulng.rsconfcolmove"
|
||
msgid "Move"
|
||
msgstr "Déplacer"
|
||
|
||
#: ulng.rsconfcolwidth
|
||
msgctxt "ulng.rsconfcolwidth"
|
||
msgid "Width"
|
||
msgstr "Largeur"
|
||
|
||
#: ulng.rsconfcustheader
|
||
msgid "Customize column"
|
||
msgstr "Personnaliser la colonne"
|
||
|
||
#: ulng.rsconfigurationfileassociation
|
||
msgid "Configure file association"
|
||
msgstr "Configuration des associations d'extension"
|
||
|
||
#: ulng.rsconfirmexecution
|
||
msgid "Confirming command line and parameters"
|
||
msgstr "Confirmer la ligne de commande et les paramètres"
|
||
|
||
#: ulng.rscopynametemplate
|
||
msgid "Copy (%d) %s"
|
||
msgstr "Copie (%d) %s"
|
||
|
||
#: ulng.rsdefaultimporteddctoolbarhint
|
||
msgid "Imported DC toolbar"
|
||
msgstr "Barre d'outils DC importée"
|
||
|
||
#: ulng.rsdefaultimportedtctoolbarhint
|
||
msgid "Imported TC toolbar"
|
||
msgstr "Barre d'outils TC importée"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtext
|
||
msgid "_DroppedText"
|
||
msgstr "_TexteDéposé"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
||
msgid "_DroppedHTMLtext"
|
||
msgstr "_TexteHTMLDéposé"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
||
msgid "_DroppedRichtext"
|
||
msgstr "_TexteRichDéposé"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
||
msgid "_DroppedSimpleText"
|
||
msgstr "_TexteSimpleDéposé"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
||
msgid "_DroppedUnicodeUTF16text"
|
||
msgstr "_TexteUnicodeUTF16Déposé"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
||
msgid "_DroppedUnicodeUTF8text"
|
||
msgstr "_TexteUnicodeUTF8Déposé"
|
||
|
||
#: ulng.rsdiffadds
|
||
msgid " Adds: "
|
||
msgstr "Adjouté :"
|
||
|
||
#: ulng.rsdiffdeletes
|
||
msgid " Deletes: "
|
||
msgstr "Effacé :"
|
||
|
||
#: ulng.rsdifffilesidentical
|
||
msgid "The two files are identical!"
|
||
msgstr "Les deux fichiers sont identiques!"
|
||
|
||
#: ulng.rsdiffmatches
|
||
msgid " Matches: "
|
||
msgstr "Corresponde :"
|
||
|
||
#: ulng.rsdiffmodifies
|
||
msgid " Modifies: "
|
||
msgstr "Modifie :"
|
||
|
||
#: ulng.rsdlgbuttonabort
|
||
msgid "Ab&ort"
|
||
msgstr "Abandonner"
|
||
|
||
#: ulng.rsdlgbuttonall
|
||
msgctxt "ulng.rsdlgbuttonall"
|
||
msgid "A&ll"
|
||
msgstr "&Tous"
|
||
|
||
#: ulng.rsdlgbuttonappend
|
||
msgid "A&ppend"
|
||
msgstr "Ajo&uter"
|
||
|
||
#: ulng.rsdlgbuttonautorenamesource
|
||
msgid "A&uto-rename source files"
|
||
msgstr "Renomme automatiquement le fichier"
|
||
|
||
#: ulng.rsdlgbuttoncancel
|
||
msgctxt "ulng.rsdlgbuttoncancel"
|
||
msgid "&Cancel"
|
||
msgstr "&Annuler"
|
||
|
||
#: ulng.rsdlgbuttoncontinue
|
||
msgid "&Continue"
|
||
msgstr "Continuer"
|
||
|
||
#: ulng.rsdlgbuttoncopyinto
|
||
msgid "&Merge"
|
||
msgstr "Copier &dans"
|
||
|
||
#: ulng.rsdlgbuttoncopyintoall
|
||
msgid "Mer&ge All"
|
||
msgstr "Copie tout à l'intérieur"
|
||
|
||
#: ulng.rsdlgbuttonexitprogram
|
||
msgid "E&xit program"
|
||
msgstr "Sortie de l'application"
|
||
|
||
#: ulng.rsdlgbuttonignore
|
||
msgid "Ig&nore"
|
||
msgstr "Ig&nore"
|
||
|
||
#: ulng.rsdlgbuttonignoreall
|
||
msgid "I&gnore All"
|
||
msgstr "Ignorez tous"
|
||
|
||
#: ulng.rsdlgbuttonno
|
||
msgid "&No"
|
||
msgstr "&Non"
|
||
|
||
#: ulng.rsdlgbuttonnone
|
||
msgid "Non&e"
|
||
msgstr "Aucu&n"
|
||
|
||
#: ulng.rsdlgbuttonok
|
||
msgctxt "ulng.rsdlgbuttonok"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: ulng.rsdlgbuttonother
|
||
msgid "Ot&her"
|
||
msgstr "Autre"
|
||
|
||
#: ulng.rsdlgbuttonoverwrite
|
||
msgid "&Overwrite"
|
||
msgstr "Écraser"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteall
|
||
msgid "Overwrite &All"
|
||
msgstr "&Tout Écraser"
|
||
|
||
#: ulng.rsdlgbuttonoverwritelarger
|
||
msgid "Overwrite All &Larger"
|
||
msgstr "Écrasement de ceux plus grands"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteolder
|
||
msgid "Overwrite All Ol&der"
|
||
msgstr "Écrasement de ceux plus vieux"
|
||
|
||
#: ulng.rsdlgbuttonoverwritesmaller
|
||
msgid "Overwrite All S&maller"
|
||
msgstr "Écrasement des plus petits"
|
||
|
||
#: ulng.rsdlgbuttonrename
|
||
msgctxt "ulng.rsdlgbuttonrename"
|
||
msgid "R&ename"
|
||
msgstr "Renommer"
|
||
|
||
#: ulng.rsdlgbuttonresume
|
||
msgid "&Resume"
|
||
msgstr "Reprendre"
|
||
|
||
#: ulng.rsdlgbuttonretry
|
||
msgid "Re&try"
|
||
msgstr "Ré-&essayer"
|
||
|
||
#: ulng.rsdlgbuttonskip
|
||
msgid "&Skip"
|
||
msgstr "&Passer"
|
||
|
||
#: ulng.rsdlgbuttonskipall
|
||
msgid "S&kip All"
|
||
msgstr "Passer pour &tous"
|
||
|
||
#: ulng.rsdlgbuttonyes
|
||
msgid "&Yes"
|
||
msgstr "&Oui"
|
||
|
||
#: ulng.rsdlgcp
|
||
msgctxt "ulng.rsdlgcp"
|
||
msgid "Copy file(s)"
|
||
msgstr "Copie du(des) fichier(s)"
|
||
|
||
#: ulng.rsdlgmv
|
||
msgid "Move file(s)"
|
||
msgstr "Déplacement du(des) fichier(s)"
|
||
|
||
#: ulng.rsdlgoppause
|
||
msgctxt "ulng.rsdlgoppause"
|
||
msgid "Pau&se"
|
||
msgstr "Pause"
|
||
|
||
#: ulng.rsdlgopstart
|
||
msgctxt "ulng.rsdlgopstart"
|
||
msgid "&Start"
|
||
msgstr "Démarrer"
|
||
|
||
#: ulng.rsdlgqueue
|
||
msgctxt "ulng.rsdlgqueue"
|
||
msgid "Queue"
|
||
msgstr "File d'attente"
|
||
|
||
#: ulng.rsdlgspeed
|
||
msgid "Speed %s/s"
|
||
msgstr "Vitesse %s/s"
|
||
|
||
#: ulng.rsdlgspeedtime
|
||
msgid "Speed %s/s, time remaining %s"
|
||
msgstr "Vitesse %s/s, temps restant estimé %s"
|
||
|
||
#: ulng.rsdraganddroptextformat
|
||
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
||
msgstr "Format Rich Text;Format HTML;Format Unicode;Format texte simple"
|
||
|
||
#: ulng.rsdrivenolabel
|
||
msgid "<no label>"
|
||
msgstr "<sans étiquette>"
|
||
|
||
#: ulng.rsdrivenomedia
|
||
msgid "<no media>"
|
||
msgstr "<sans média>"
|
||
|
||
#: ulng.rseditabouttext
|
||
msgid "Internal Editor of Double Commander."
|
||
msgstr "Éditeur interne de Double Commander."
|
||
|
||
#: ulng.rseditgotolinequery
|
||
msgid "Goto line:"
|
||
msgstr "Aller à la ligne :"
|
||
|
||
#: ulng.rseditgotolinetitle
|
||
msgctxt "ulng.rseditgotolinetitle"
|
||
msgid "Goto Line"
|
||
msgstr "Aller à la ligne"
|
||
|
||
#: ulng.rseditnewfile
|
||
msgid "new.txt"
|
||
msgstr "new.txt"
|
||
|
||
#: ulng.rseditnewfilename
|
||
msgid "Filename:"
|
||
msgstr "Nom de fichier :"
|
||
|
||
#: ulng.rseditnewopen
|
||
msgid "Open file"
|
||
msgstr "Ouvrir le fichier"
|
||
|
||
#: ulng.rseditsearchback
|
||
msgid "&Backward"
|
||
msgstr "&Retour en arrière"
|
||
|
||
#: ulng.rseditsearchcaption
|
||
msgctxt "ulng.rseditsearchcaption"
|
||
msgid "Search"
|
||
msgstr "Rechercher"
|
||
|
||
#: ulng.rseditsearchfrw
|
||
msgid "&Forward"
|
||
msgstr "&Aller en avant"
|
||
|
||
#: ulng.rseditsearchreplace
|
||
msgctxt "ulng.rseditsearchreplace"
|
||
msgid "Replace"
|
||
msgstr "Remplacer"
|
||
|
||
#: ulng.rseditwithexternaleditor
|
||
msgid "with external editor"
|
||
msgstr "avec un éditeur externe"
|
||
|
||
#: ulng.rseditwithinternaleditor
|
||
msgid "with internal editor"
|
||
msgstr "avec éditeur interne"
|
||
|
||
#: ulng.rsexecuteviashell
|
||
msgctxt "ulng.rsexecuteviashell"
|
||
msgid "Execute via shell"
|
||
msgstr "Exécuter via l'invite de commande"
|
||
|
||
#: ulng.rsexecuteviaterminalclose
|
||
msgctxt "ulng.rsexecuteviaterminalclose"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Exécuter via le terminal puis fermer"
|
||
|
||
#: ulng.rsexecuteviaterminalstayopen
|
||
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Exécuter via le terminal et demeurer actif"
|
||
|
||
#: ulng.rsfavtabspanelsideselection
|
||
msgid "Left;Right;Active;Inactive;Both;None"
|
||
msgstr "Gauche;Droite;Actif;Inactif;Les deux;Aucun"
|
||
|
||
#: ulng.rsfavtabssavedirhistory
|
||
msgid "No;Yes"
|
||
msgstr "Non;Oui"
|
||
|
||
#: ulng.rsfilenameexportedtcbarprefix
|
||
msgid "Exported_from_DC"
|
||
msgstr "Exporté_de_DC"
|
||
|
||
#: ulng.rsfileopdirectoryexistsoptions
|
||
msgid "Ask;Merge;Skip"
|
||
msgstr "Demande;Copie à l'intérieur;Saute"
|
||
|
||
#: ulng.rsfileopfileexistsoptions
|
||
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
||
msgstr "Demande;Ré-écris;Ré-écris plus vieux;Saute"
|
||
|
||
#: ulng.rsfileopsetpropertyerroroptions
|
||
msgctxt "ulng.rsfileopsetpropertyerroroptions"
|
||
msgid "Ask;Don't set anymore;Ignore errors"
|
||
msgstr "Demande;N'ajuste plus désormais;Ignore les erreurs"
|
||
|
||
#: ulng.rsfilterstatus
|
||
msgid "FILTER"
|
||
msgstr "FILTRE"
|
||
|
||
#: ulng.rsfinddefinetemplate
|
||
msgid "Define template"
|
||
msgstr "Définir un modèle"
|
||
|
||
#: ulng.rsfinddepth
|
||
msgid "%s level(s)"
|
||
msgstr "%s niveaux"
|
||
|
||
#: ulng.rsfinddepthall
|
||
msgid "all (unlimited depth)"
|
||
msgstr "tout (profondeur illimitée)"
|
||
|
||
#: ulng.rsfinddepthcurdir
|
||
msgid "current dir only"
|
||
msgstr "seulement le dossier courant"
|
||
|
||
#: ulng.rsfinddirnoex
|
||
msgid "Directory %s does not exist!"
|
||
msgstr "Le dossier %s n'existe pas !"
|
||
|
||
#: ulng.rsfindfound
|
||
msgctxt "ulng.rsfindfound"
|
||
msgid "Found: %d"
|
||
msgstr "Trouvé : %d"
|
||
|
||
#: ulng.rsfindsavetemplatecaption
|
||
msgid "Save search template"
|
||
msgstr "Sauvegarder le modèle de la recherche"
|
||
|
||
#: ulng.rsfindsavetemplatetitle
|
||
msgid "Template name:"
|
||
msgstr "Nom du modèle :"
|
||
|
||
#: ulng.rsfindscanned
|
||
msgctxt "ulng.rsfindscanned"
|
||
msgid "Scanned: %d"
|
||
msgstr "Analyse effectuée : %d"
|
||
|
||
#: ulng.rsfindscanning
|
||
msgid "Scanning"
|
||
msgstr "Analyse"
|
||
|
||
#: ulng.rsfindsearchfiles
|
||
msgctxt "ulng.rsfindsearchfiles"
|
||
msgid "Find files"
|
||
msgstr "Rechercher les fichiers"
|
||
|
||
#: ulng.rsfindtimeofscan
|
||
msgid "Time of scan: "
|
||
msgstr "Durée du balayage :"
|
||
|
||
#: ulng.rsfindwherebeg
|
||
msgid "Begin at"
|
||
msgstr "Commencer à"
|
||
|
||
#: ulng.rsfreemsg
|
||
msgid "Free %s from %s bytes"
|
||
msgstr "%s libre sur %s octets"
|
||
|
||
#: ulng.rsfreemsgshort
|
||
msgid "%s bytes free"
|
||
msgstr "%s octets libres"
|
||
|
||
#: ulng.rsfuncatime
|
||
msgid "Access date/time"
|
||
msgstr "Date/heure d'accès"
|
||
|
||
#: ulng.rsfuncattr
|
||
msgctxt "ulng.rsfuncattr"
|
||
msgid "Attributes"
|
||
msgstr "Attributs"
|
||
|
||
#: ulng.rsfunccomment
|
||
msgid "Comment"
|
||
msgstr "Commentaire"
|
||
|
||
#: ulng.rsfunccompressedsize
|
||
msgid "Compressed size"
|
||
msgstr "Taille compressé"
|
||
|
||
#: ulng.rsfuncctime
|
||
msgid "Creation date/time"
|
||
msgstr "Date/heure de création"
|
||
|
||
#: ulng.rsfuncext
|
||
msgid "Extension"
|
||
msgstr "Extension"
|
||
|
||
#: ulng.rsfuncgroup
|
||
msgctxt "ulng.rsfuncgroup"
|
||
msgid "Group"
|
||
msgstr "Groupe"
|
||
|
||
#: ulng.rsfunchtime
|
||
msgid "Change date/time"
|
||
msgstr "Changer date/heure"
|
||
|
||
#: ulng.rsfunclinkto
|
||
msgid "Link to"
|
||
msgstr "Lier à"
|
||
|
||
#: ulng.rsfuncmtime
|
||
msgid "Modification date/time"
|
||
msgstr "Date/heure de modification"
|
||
|
||
#: ulng.rsfuncname
|
||
msgctxt "ulng.rsfuncname"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: ulng.rsfuncnamenoext
|
||
msgid "Name without extension"
|
||
msgstr "Nom sans l'extension"
|
||
|
||
#: ulng.rsfuncowner
|
||
msgctxt "ulng.rsfuncowner"
|
||
msgid "Owner"
|
||
msgstr "Propriétaire"
|
||
|
||
#: ulng.rsfuncpath
|
||
msgctxt "ulng.rsfuncpath"
|
||
msgid "Path"
|
||
msgstr "Chemin"
|
||
|
||
#: ulng.rsfuncsize
|
||
msgctxt "ulng.rsfuncsize"
|
||
msgid "Size"
|
||
msgstr "Taille"
|
||
|
||
#: ulng.rsfunctype
|
||
msgid "Type"
|
||
msgstr "Type"
|
||
|
||
#: ulng.rsharderrcreate
|
||
msgid "Error creating hardlink."
|
||
msgstr "Erreur lors de la création du lien dur (hardlink)."
|
||
|
||
#: ulng.rshotdirforcesortingorderchoices
|
||
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
||
msgstr "aucun;Nom, a-z;Nom, z-a;Ext, a-z;Ext, z-a;Taille 9-0;Taille 0-9;Date 9-0;Date 0-9"
|
||
|
||
#: ulng.rshotdirwarningabortrestorebackup
|
||
msgid ""
|
||
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
||
"\n"
|
||
"Are you sure you want to proceed?\n"
|
||
msgstr ""
|
||
"Avertissement! Lorsqu'on ramène liste de dossiers favoris, cela va effacer celle existant pour la replacer par celle importée.\n"
|
||
"\n"
|
||
"Êtes-vous sûr de vouloir continuer?\n"
|
||
|
||
#: ulng.rshotkeycategorycopymovedialog
|
||
msgid "Copy/Move Dialog"
|
||
msgstr "Fenêtre de copie/déplacement"
|
||
|
||
#: ulng.rshotkeycategorydiffer
|
||
msgctxt "ulng.rshotkeycategorydiffer"
|
||
msgid "Differ"
|
||
msgstr "Différences"
|
||
|
||
#: ulng.rshotkeycategoryeditcommentdialog
|
||
msgid "Edit Comment Dialog"
|
||
msgstr "Fenêtre d'édition du commentaire"
|
||
|
||
#: ulng.rshotkeycategoryeditor
|
||
msgctxt "ulng.rshotkeycategoryeditor"
|
||
msgid "Editor"
|
||
msgstr "Éditeur"
|
||
|
||
#: ulng.rshotkeycategoryfindfiles
|
||
msgctxt "ulng.rshotkeycategoryfindfiles"
|
||
msgid "Find files"
|
||
msgstr "Rechercher les fichiers"
|
||
|
||
#: ulng.rshotkeycategorymain
|
||
msgid "Main"
|
||
msgstr "Principal"
|
||
|
||
#: ulng.rshotkeycategoryviewer
|
||
msgctxt "ulng.rshotkeycategoryviewer"
|
||
msgid "Viewer"
|
||
msgstr "Visionneuse"
|
||
|
||
#: ulng.rshotkeyfilealreadyexists
|
||
msgid ""
|
||
"A setup with that name already exists.\n"
|
||
"Do you want to overwrite it?\n"
|
||
msgstr ""
|
||
"Une configuration avec ce nom existe déjà.\n"
|
||
"Est-ce que tu veux l'écraser?\n"
|
||
|
||
#: ulng.rshotkeyfileconfirmdefault
|
||
msgid "Are you sure you want to restore default?"
|
||
msgstr "Êtes-vous sûr de vouloir ramener les valeur initiales?"
|
||
|
||
#: ulng.rshotkeyfileconfirmerasure
|
||
msgid "Are you sure you want to erase setup \"%s\"?"
|
||
msgstr "Êtes-vous sûr de vouloir effacer la configuration \"%s\"?"
|
||
|
||
#: ulng.rshotkeyfilecopyof
|
||
msgid "Copy of %s"
|
||
msgstr "Copie de %s"
|
||
|
||
#: ulng.rshotkeyfileinputnewname
|
||
msgid "Input your new name"
|
||
msgstr "Entrez votre nouveau nom"
|
||
|
||
#: ulng.rshotkeyfilemustkeepone
|
||
msgid "You must keep at least one shortcut file."
|
||
msgstr "Vous devez conserver au moins un fichier de raccourcis."
|
||
|
||
#: ulng.rshotkeyfilenewname
|
||
msgid "New name"
|
||
msgstr "Nouveau nom"
|
||
|
||
#: ulng.rshotkeyfilesavemodified
|
||
msgid ""
|
||
"\"%s\" setup has been modified.\n"
|
||
"Do you want to save it now?\n"
|
||
msgstr ""
|
||
"Le fichier de configuration \"%\" a été modifié.\n"
|
||
"Voulez-vous le sauvegarder maintenant?\n"
|
||
|
||
#: ulng.rshotkeynoscenter
|
||
msgid "No shortcut with \"ENTER\""
|
||
msgstr "Aucun raccourcis avec la touche \"Entrée\""
|
||
|
||
#: ulng.rshotkeysortorder
|
||
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
||
msgstr "Par nom de commande;Par raccourcis-clavier (groupé);Par raccourcis-clavier (un par ligne)"
|
||
|
||
#: ulng.rsimporttoolbarproblem
|
||
msgid "Cannot find reference to default bar file"
|
||
msgstr "On ne troube pas de rérérence à la barre par défaut"
|
||
|
||
#: ulng.rslistoffindfileswindows
|
||
msgid "List of \"Find files\" windows"
|
||
msgstr "Liste des fenêtres de recherche de fichiers"
|
||
|
||
#: ulng.rsmarkminus
|
||
msgid "Unselect mask"
|
||
msgstr "Désélectionner le masque"
|
||
|
||
#: ulng.rsmarkplus
|
||
msgid "Select mask"
|
||
msgstr "Choisissez le masque"
|
||
|
||
#: ulng.rsmaskinput
|
||
msgid "Input mask:"
|
||
msgstr "Masque de saisie :"
|
||
|
||
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
||
msgid "A columns view with that name already exists."
|
||
msgstr "Une configuration de colonne avec ce nom existe déjà"
|
||
|
||
#: ulng.rsmenuconfigurecolumnssavetochange
|
||
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
||
msgstr "Pour éditer une autre vue \"colonne\", vous devez SAUVEGARDER, COPIER ou EFFACER celle qui vous éditez présentement"
|
||
|
||
#: ulng.rsmenuconfigurecustomcolumns
|
||
msgid "Configure custom columns"
|
||
msgstr "Configurer les colonnes personnalisées"
|
||
|
||
#: ulng.rsmenuconfigureentercustomcolumnname
|
||
msgid "Enter new custom columns name"
|
||
msgstr "Entrez un nom pour la nouvelle colonne personnalisée"
|
||
|
||
#: ulng.rsmnuactions
|
||
msgctxt "ulng.rsmnuactions"
|
||
msgid "Actions"
|
||
msgstr "Actions"
|
||
|
||
#: ulng.rsmnucopynetnamestoclip
|
||
msgid "Copy names with UNC path"
|
||
msgstr "Copie les noms avec chemin UNC"
|
||
|
||
#: ulng.rsmnudisconnectnetworkdrive
|
||
msgid "Disconnect Network Drive..."
|
||
msgstr "Déconnecté les lecteurs-réseaux"
|
||
|
||
#: ulng.rsmnuedit
|
||
msgctxt "ulng.rsmnuedit"
|
||
msgid "Edit"
|
||
msgstr "Éditer"
|
||
|
||
#: ulng.rsmnueject
|
||
msgid "Eject"
|
||
msgstr "Éjecter"
|
||
|
||
#: ulng.rsmnuextracthere
|
||
msgid "Extract here..."
|
||
msgstr "Extraire ici..."
|
||
|
||
#: ulng.rsmnumapnetworkdrive
|
||
msgid "Map Network Drive..."
|
||
msgstr "Connecter un lecteur réseau..."
|
||
|
||
#: ulng.rsmnumount
|
||
msgid "Mount"
|
||
msgstr "Monter"
|
||
|
||
#: ulng.rsmnunew
|
||
msgctxt "ulng.rsmnunew"
|
||
msgid "New"
|
||
msgstr "Nouveau"
|
||
|
||
#: ulng.rsmnunomedia
|
||
msgid "No media available"
|
||
msgstr "Média indisponible"
|
||
|
||
#: ulng.rsmnuopen
|
||
msgctxt "ulng.rsmnuopen"
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: ulng.rsmnuopenwith
|
||
msgid "Open with"
|
||
msgstr "Ouvrir avec"
|
||
|
||
#: ulng.rsmnuopenwithother
|
||
msgctxt "ulng.rsmnuopenwithother"
|
||
msgid "Other..."
|
||
msgstr "Autre..."
|
||
|
||
#: ulng.rsmnupackhere
|
||
msgid "Pack here..."
|
||
msgstr "Compresse ici..."
|
||
|
||
#: ulng.rsmnusortby
|
||
msgid "Sort by"
|
||
msgstr "Trier par"
|
||
|
||
#: ulng.rsmnuumount
|
||
msgid "Unmount"
|
||
msgstr "Démonter"
|
||
|
||
#: ulng.rsmnuview
|
||
msgctxt "ulng.rsmnuview"
|
||
msgid "View"
|
||
msgstr "Voir"
|
||
|
||
#: ulng.rsmsgaccount
|
||
msgid "Account:"
|
||
msgstr "Compte :"
|
||
|
||
#: ulng.rsmsgarchivercustomparams
|
||
msgid "Additional parameters for archiver command-line:"
|
||
msgstr "Paramètres additionnels pour la ligne de commande du programme d'archivage :"
|
||
|
||
#: ulng.rsmsgaskquoteornot
|
||
msgid "Do you want to enclose between quotes?"
|
||
msgstr "Voulez-vous mettre en guillemets"
|
||
|
||
#: ulng.rsmsgbadcrc32
|
||
msgid ""
|
||
"Bad CRC32 for resulting file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Do you want to keep the resulting corrupted file anyway?\n"
|
||
msgstr ""
|
||
"Mauvais CRC32 pour le fichier résultant:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Voulez-vous conserver le fichier résultant même s'il est corrompu?\n"
|
||
|
||
#: ulng.rsmsgcannotcopymoveitself
|
||
msgid "You can not copy/move a file \"%s\" to itself!"
|
||
msgstr "Vous ne pouvez pas copier/déplacer le fichier \"%s\" sur lui-même !"
|
||
|
||
#: ulng.rsmsgcannotdeletedirectory
|
||
msgid "Cannot delete directory %s"
|
||
msgstr "On ne peut pas effacer le dossier %s"
|
||
|
||
#: ulng.rsmsgcannotoverwritedirectory
|
||
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
||
msgstr "On ne peut pas écraser le répertoire \"%s\" avec de quoi qui n'est pas un répertoire \"%s\""
|
||
|
||
#: ulng.rsmsgchdirfailed
|
||
msgid "ChDir to [%s] failed!"
|
||
msgstr "Le changement de dossier vers [%s] a échoué !"
|
||
|
||
#: ulng.rsmsgcloseallinactivetabs
|
||
msgid "Remove all inactive tabs?"
|
||
msgstr "Fermer tous les onglets inactifs?"
|
||
|
||
#: ulng.rsmsgcloselockedtab
|
||
msgid "This tab (%s) is locked! Close anyway?"
|
||
msgstr "Cet onglet (%s) est verrouillé! Forcer sa fermeture tout de même?"
|
||
|
||
#: ulng.rsmsgconfirmquit
|
||
msgid "Are you sure you want to quit?"
|
||
msgstr "Êtes-vous certain de vouloir quitter ?"
|
||
|
||
#: ulng.rsmsgcopybackward
|
||
msgid "The file %s has changed. Do you want to copy it backward?"
|
||
msgstr "Le fichier %s a changé. Voulez-vous tout de même l'écraser avec ce contenu?"
|
||
|
||
#: ulng.rsmsgcouldnotcopybackward
|
||
msgid "Could not copy backward - do you want to keep the changed file?"
|
||
msgstr "On ne peut pas copier en retour - voulez-vous conserver le fichier qui a changé?"
|
||
|
||
#: ulng.rsmsgcpfldr
|
||
msgid "Copy %d selected files/directories?"
|
||
msgstr "Copier les %d fichiers/dossiers sélectionnés ?"
|
||
|
||
#: ulng.rsmsgcpsel
|
||
msgid "Copy selected \"%s\"?"
|
||
msgstr "Copier la sélection \"%s\" ?"
|
||
|
||
#: ulng.rsmsgcreateanewfiletype
|
||
msgid "< Create a new file type \"%s files\" >"
|
||
msgstr "< Créer un nouveau type de fichier \"%s\" >"
|
||
|
||
#: ulng.rsmsgdctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a DC Toolbar file"
|
||
msgstr "Entrez l'emplacement et le nom de fichier pour la barre d'outil DC à sauvegarder"
|
||
|
||
#: ulng.rsmsgdefaultcustomactionname
|
||
msgid "Custom action"
|
||
msgstr "Action personalisée"
|
||
|
||
#: ulng.rsmsgdeletepartiallycopied
|
||
msgid "Delete the partially copied file ?"
|
||
msgstr "Effacer le fichier copié partiellement?"
|
||
|
||
#: ulng.rsmsgdelfldr
|
||
msgid "Delete %d selected files/directories?"
|
||
msgstr "Supprimer les %d fichiers/dossiers sélectionnés ?"
|
||
|
||
#: ulng.rsmsgdelfldrt
|
||
msgid "Delete %d selected files/directories into trash can?"
|
||
msgstr "Déplacer les %d fichiers/dossiers sélectionnés dans la corbeille ?"
|
||
|
||
#: ulng.rsmsgdelsel
|
||
msgid "Delete selected \"%s\"?"
|
||
msgstr "Supprimer la sélection \"%s\" ?"
|
||
|
||
#: ulng.rsmsgdelselt
|
||
msgid "Delete selected \"%s\" into trash can?"
|
||
msgstr "Déplacer le fichier/dossier \"%s\" sélectionné dans la corbeille ?"
|
||
|
||
#: ulng.rsmsgdeltotrashforce
|
||
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
||
msgstr "Impossible de mettre \"%s\" à la corbeille ! Le supprimer définitivement ?"
|
||
|
||
#: ulng.rsmsgdisknotavail
|
||
msgid "Disk is not available"
|
||
msgstr "Le volume/disque n'est pas accessible"
|
||
|
||
#: ulng.rsmsgentercustomaction
|
||
msgid "Enter custom action name:"
|
||
msgstr "Enter le nom de l'action personalisée"
|
||
|
||
#: ulng.rsmsgenterfileext
|
||
msgid "Enter file extension:"
|
||
msgstr "Donnez l'extension de fichier :"
|
||
|
||
#: ulng.rsmsgentername
|
||
msgid "Enter name:"
|
||
msgstr "Donnez le nom :"
|
||
|
||
#: ulng.rsmsgenternewfiletypename
|
||
msgid "Enter name of new file type to create for extension \"%s\""
|
||
msgstr "Entrez un nom pour le nouveau type de fichier à créer avec l'extension \"%s\""
|
||
|
||
#: ulng.rsmsgerrbadarchive
|
||
msgid "CRC error in archive data"
|
||
msgstr "Erreur CRC (contrôle de redondance cyclique) dans l'archive"
|
||
|
||
#: ulng.rsmsgerrbaddata
|
||
msgid "Data is bad"
|
||
msgstr "Les données sont erronées"
|
||
|
||
#: ulng.rsmsgerrcannotconnect
|
||
msgid "Can not connect to server: \"%s\""
|
||
msgstr "Impossible de se connecter au serveur : \"%s\""
|
||
|
||
#: ulng.rsmsgerrcannotcopyfile
|
||
msgid "Cannot copy file %s to %s"
|
||
msgstr "Impossible de copier le fichier %s vers %s"
|
||
|
||
#: ulng.rsmsgerrcreatefiledirectoryexists
|
||
msgid "There already exists a directory named \"%s\"."
|
||
msgstr "Il existe déjà un dossier nommé \"%s\"."
|
||
|
||
#: ulng.rsmsgerrdatenotsupported
|
||
msgid "Date %s is not supported"
|
||
msgstr "La date %s n'est pas supportée"
|
||
|
||
#: ulng.rsmsgerrdirexists
|
||
msgid "Directory %s exists!"
|
||
msgstr "Le dossier %s existe déjà !"
|
||
|
||
#: ulng.rsmsgerreaborted
|
||
msgid "Function aborted by user"
|
||
msgstr "Fonction interrompue par l'utilisateur"
|
||
|
||
#: ulng.rsmsgerreclose
|
||
msgid "Error closing file"
|
||
msgstr "Erreur à la fermeture du fichier"
|
||
|
||
#: ulng.rsmsgerrecreate
|
||
msgid "Cannot create file"
|
||
msgstr "Impossible de créer le fichier"
|
||
|
||
#: ulng.rsmsgerrendarchive
|
||
msgid "No more files in archive"
|
||
msgstr "Plus de fichier dans l'archive"
|
||
|
||
#: ulng.rsmsgerreopen
|
||
msgid "Cannot open existing file"
|
||
msgstr "Impossible d'ouvrir le fichier existant"
|
||
|
||
#: ulng.rsmsgerreread
|
||
msgid "Error reading from file"
|
||
msgstr "Erreur de lecture du fichier"
|
||
|
||
#: ulng.rsmsgerrewrite
|
||
msgid "Error writing to file"
|
||
msgstr "Erreur lors de l'écriture dans le fichier"
|
||
|
||
#: ulng.rsmsgerrforcedir
|
||
msgid "Can not create directory %s!"
|
||
msgstr "Impossible de créer le dossier %s !"
|
||
|
||
#: ulng.rsmsgerrinvalidlink
|
||
msgid "Invalid link"
|
||
msgstr "Lien non valide"
|
||
|
||
#: ulng.rsmsgerrnofiles
|
||
msgid "No files found"
|
||
msgstr "Pas de fichier trouvé"
|
||
|
||
#: ulng.rsmsgerrnomemory
|
||
msgid "Not enough memory"
|
||
msgstr "La mémoire est insuffisante"
|
||
|
||
#: ulng.rsmsgerrnotsupported
|
||
msgid "Function not supported!"
|
||
msgstr "Fonction non supportée !"
|
||
|
||
#: ulng.rsmsgerrorincontextmenucommand
|
||
msgid "Error in context menu command"
|
||
msgstr "Erreur dans la commande du menu contextuel"
|
||
|
||
#: ulng.rsmsgerrorloadingconfiguration
|
||
msgid "Error when loading configuration"
|
||
msgstr "Erreur de chargement de la configuration"
|
||
|
||
#: ulng.rsmsgerrregexpsyntax
|
||
msgid "Syntax error in regular expression!"
|
||
msgstr "Erreur de syntaxe dans l'expression régulière !"
|
||
|
||
#: ulng.rsmsgerrrename
|
||
msgid "Cannot rename file %s to %s"
|
||
msgstr "Impossible de renommer le fichier %s en %s"
|
||
|
||
#: ulng.rsmsgerrsaveassociation
|
||
msgid "Can not save association!"
|
||
msgstr "On ne peut sauver l'association!"
|
||
|
||
#: ulng.rsmsgerrsavefile
|
||
msgid "Cannot save file"
|
||
msgstr "Impossible de sauvegarder le fichier"
|
||
|
||
#: ulng.rsmsgerrsetattribute
|
||
msgid "Can not set attributes for \"%s\""
|
||
msgstr "Impossible de définir les attributs pour \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetdatetime
|
||
msgid "Can not set date/time for \"%s\""
|
||
msgstr "Impossible de définir la date/heure pour \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetownership
|
||
msgid "Can not set owner/group for \"%s\""
|
||
msgstr "On ne peut pas ajuster le propiétaire/groupe pour \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetpermissions
|
||
msgid "Can not set permissions for \"%s\""
|
||
msgstr "On ne peut ajuster les permissions pour \"%s\""
|
||
|
||
#: ulng.rsmsgerrsmallbuf
|
||
msgid "Buffer too small"
|
||
msgstr "Le cache (mémoire tampon) est trop petit"
|
||
|
||
#: ulng.rsmsgerrtoomanyfiles
|
||
msgid "Too many files to pack"
|
||
msgstr "Il y a trop de fichier à archiver"
|
||
|
||
#: ulng.rsmsgerrunknownformat
|
||
msgid "Archive format unknown"
|
||
msgstr "Format d'archive inconnu"
|
||
|
||
#: ulng.rsmsgfavoritetabsdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
||
msgstr "Êtes-vous sûr que vous vous détruire toutes les entrées de vos onglets-favoris? (On ne pourra pas défaire cette action!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsdraghereentry
|
||
msgid "Drag here other entries"
|
||
msgstr "Déplacer ici les autres entrées"
|
||
|
||
#: ulng.rsmsgfavoritetabsentername
|
||
msgid "Enter a name this Favorite Tabs entry"
|
||
msgstr "Entrer un nom pour ce groupes d'onglets favoris"
|
||
|
||
#: ulng.rsmsgfavoritetabsenternametitle
|
||
msgid "Saving a new Favorite Tabs entry"
|
||
msgstr "Savegarde vers une nouvelle entrée de groupe d'onglets favoris"
|
||
|
||
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
||
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
||
msgstr "Nombre de groupes d'onglets exportés avec succès : %d sur %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsextramode
|
||
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
||
msgstr "Ajustement pour sauvegarde de l'historique des dossiers par défaut pour un nouveau groupe d'onglets favoris"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
||
msgid "Number of file(s) imported successfully: %d on %d"
|
||
msgstr "Nombre de fichiers importés avec succès : %d sur %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
||
msgid "Legacy tabs imported"
|
||
msgstr "Les .tab favoris ont été importés"
|
||
|
||
#: ulng.rsmsgfavoritetabsimporttitle
|
||
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
||
msgstr "Choisissez le(s) fichier(s) .tab à importer (on peut en importer plus d'un à la fois!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
||
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
||
msgstr "Les dernières modifications des onglets favoris n'ont pas été sauvegardées. Est-ce que vous voulez les sauvegarder avant de continuer?"
|
||
|
||
#: ulng.rsmsgfavoritetabssimplemode
|
||
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "Conservation de l'historique des dossis avec ce groupe d'onglets favoris :"
|
||
|
||
#: ulng.rsmsgfavoritetabssubmenuname
|
||
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Nom du sous-menu"
|
||
|
||
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
||
msgid "This will load the Favorite Tabs: \"%s\""
|
||
msgstr "Cela va restituer le groupe d'onglets favoris sauvegardé sous le nom \"%s\""
|
||
|
||
#: ulng.rsmsgfavortietabssaveoverexisting
|
||
msgid "Save current tabs over existing Favorite Tabs entry"
|
||
msgstr "Sauvegarder les onglets courants sur un groupe d'onglets favoris existant"
|
||
|
||
#: ulng.rsmsgfilechangedsave
|
||
msgid "File %s changed, save?"
|
||
msgstr "Le fichier %s a été modifié, le sauvegarder ?"
|
||
|
||
#: ulng.rsmsgfileexistsfileinfo
|
||
msgid "%s bytes, %s"
|
||
msgstr "%s octets, %s"
|
||
|
||
#: ulng.rsmsgfileexistsoverwrite
|
||
msgid "Overwrite:"
|
||
msgstr "Écraser :"
|
||
|
||
#: ulng.rsmsgfileexistsrwrt
|
||
msgid "File %s exists, overwrite?"
|
||
msgstr "Le fichier %s existe déjà, l'écraser ?"
|
||
|
||
#: ulng.rsmsgfileexistswithfile
|
||
msgid "With file:"
|
||
msgstr "Avec fichier :"
|
||
|
||
#: ulng.rsmsgfilenotfound
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Ce fichier est introuvable : %s"
|
||
|
||
#: ulng.rsmsgfileoperationsactive
|
||
msgid "File operations active"
|
||
msgstr "Opérations sur les fichiers en cours"
|
||
|
||
#: ulng.rsmsgfileoperationsactivelong
|
||
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
||
msgstr "Certaines opérations sur les fichiers ne sont pas encore terminées. Fermer Double Commander peut entraîner la perte de données."
|
||
|
||
#: ulng.rsmsgfilepathovermaxpath
|
||
msgid ""
|
||
"The target name length (%d) is more than %d characters!\n"
|
||
"%s\n"
|
||
"Most programs will not be able to access a file/directory with such a long name!\n"
|
||
msgstr ""
|
||
"La longueur du nom de fichier-cible (%d) est plus grande que %d caractères!\n"
|
||
"%s\n"
|
||
"La plupart des applications ne seront pas capable d'accéder au dossier/fichier avec un nom long comme cela!\n"
|
||
|
||
#: ulng.rsmsgfilereadonly
|
||
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
||
msgstr "Le fichier %s est en lecture seule. Le supprimer quand même?"
|
||
|
||
#: ulng.rsmsgfilesizetoobig
|
||
msgid "The file size of \"%s\" is too big for destination file system!"
|
||
msgstr "La taille du fichier \"%s\" est supérieure à l'espace disponible sur le système de fichier de destination !"
|
||
|
||
#: ulng.rsmsgfolderexistsrwrt
|
||
msgid "Folder %s exists, merge?"
|
||
msgstr "Le dossier %s existe déjà, copier à l'intérieur'?"
|
||
|
||
#: ulng.rsmsgfollowsymlink
|
||
msgid "Follow symlink \"%s\"?"
|
||
msgstr "Suivre le lien symbolique \"%s\"?"
|
||
|
||
#: ulng.rsmsgfortextformattoimport
|
||
msgid "Select the text format to import"
|
||
msgstr "Sélectionnez le format du texte à importer"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectories
|
||
msgid "Add %d selected dirs"
|
||
msgstr "Ajoute les %d dossiers sélectionnés"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectory
|
||
msgid "Add selected dir: "
|
||
msgstr "Ajoute le dossier sélectionné: "
|
||
|
||
#: ulng.rsmsghotdiraddthisdirectory
|
||
msgid "Add current dir: "
|
||
msgstr "Ajoute le dossier courant : "
|
||
|
||
#: ulng.rsmsghotdircommandname
|
||
msgid "Do command"
|
||
msgstr "Commande"
|
||
|
||
#: ulng.rsmsghotdircommandsample
|
||
msgid "cm_somthing"
|
||
msgstr "cm_something"
|
||
|
||
#: ulng.rsmsghotdirconfighotlist
|
||
msgctxt "ulng.rsmsghotdirconfighotlist"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Configuration des dossiers favoris"
|
||
|
||
#: ulng.rsmsghotdirdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
||
msgstr "Êtes-vous sûr de retirer toutes les entrées de votre liste de dossiers favoris? (Il n'y a pas de \"undo\" à cette action!)"
|
||
|
||
#: ulng.rsmsghotdirdemocommand
|
||
msgid "This will execute the following command:"
|
||
msgstr "Cela exécutera la commande suivante :"
|
||
|
||
#: ulng.rsmsghotdirdemoname
|
||
msgid "This is hot dir named "
|
||
msgstr "Ceci est le dossier favori appelé "
|
||
|
||
#: ulng.rsmsghotdirdemopath
|
||
msgid "This will change active frame to the following path:"
|
||
msgstr "Cela changerait le chemin du panneau actif pour le suivant :"
|
||
|
||
#: ulng.rsmsghotdirdemotarget
|
||
msgid "And inactive frame would change to the following path:"
|
||
msgstr "Et le panneau inactif changerait de chemin pour le suivant :"
|
||
|
||
#: ulng.rsmsghotdirerrorbackuping
|
||
msgid "Error backuping entries..."
|
||
msgstr "Erreur en archivant les entrées..."
|
||
|
||
#: ulng.rsmsghotdirerrorexporting
|
||
msgid "Error exporting entries..."
|
||
msgstr "Erreur d'exportation d'entrées"
|
||
|
||
#: ulng.rsmsghotdirexportall
|
||
msgid "Export all!"
|
||
msgstr "Exporter tous!"
|
||
|
||
#: ulng.rsmsghotdirexporthotlist
|
||
msgid "Export Directory Hotlist - Select the entries you want to export"
|
||
msgstr "Exporte la liste des dossiers favoris - Sélectionnez les entrées à exporter"
|
||
|
||
#: ulng.rsmsghotdirexportsel
|
||
msgid "Export selected"
|
||
msgstr "Exporte la sélection"
|
||
|
||
#: ulng.rsmsghotdirimportall
|
||
msgctxt "ulng.rsmsghotdirimportall"
|
||
msgid "Import all!"
|
||
msgstr "Importe tous!"
|
||
|
||
#: ulng.rsmsghotdirimporthotlist
|
||
msgid "Import Directory Hotlist - Select the entries you want to import"
|
||
msgstr "Importe liste des dossiers favoris - Sélectionnez les entrées à importer"
|
||
|
||
#: ulng.rsmsghotdirimportsel
|
||
msgctxt "ulng.rsmsghotdirimportsel"
|
||
msgid "Import selected"
|
||
msgstr "Importe la sélection"
|
||
|
||
#: ulng.rsmsghotdirjustpath
|
||
msgctxt "ulng.rsmsghotdirjustpath"
|
||
msgid "Path"
|
||
msgstr "Chemin"
|
||
|
||
#: ulng.rsmsghotdirlocatehotlistfile
|
||
msgid "Locate \".hotlist\" file to import"
|
||
msgstr "Pointez le fichier \".hotlist\" à importer"
|
||
|
||
#: ulng.rsmsghotdirname
|
||
msgid "Hotdir name"
|
||
msgstr "Nom du favori :"
|
||
|
||
#: ulng.rsmsghotdirnbnewentries
|
||
msgid "Number of new entries: %d"
|
||
msgstr "Nombre de nouvelles entrées : %d"
|
||
|
||
#: ulng.rsmsghotdirnothingtoexport
|
||
msgid "Nothing selected to export!"
|
||
msgstr "Rien à exporter"
|
||
|
||
#: ulng.rsmsghotdirpath
|
||
msgid "Hotdir path"
|
||
msgstr "Chemin du dossier"
|
||
|
||
#: ulng.rsmsghotdirreaddselecteddirectory
|
||
msgid "Re-Add selected dir: "
|
||
msgstr "Ajoute à nouveau le dossier sélectionné : "
|
||
|
||
#: ulng.rsmsghotdirreaddthisdirectory
|
||
msgid "Re-Add current dir: "
|
||
msgstr "Ajoute à nouveau le dossier courant : "
|
||
|
||
#: ulng.rsmsghotdirrestorewhat
|
||
msgid "Enter location and filename of Directory Hotlist to restore"
|
||
msgstr "Sélectionner le fichier de dossiers favoris"
|
||
|
||
#: ulng.rsmsghotdirsimplecommand
|
||
msgctxt "ulng.rsmsghotdirsimplecommand"
|
||
msgid "Command:"
|
||
msgstr "Commande"
|
||
|
||
#: ulng.rsmsghotdirsimpleendofmenu
|
||
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
||
msgid "(end of sub menu)"
|
||
msgstr "(fin de menu)"
|
||
|
||
#: ulng.rsmsghotdirsimplemenu
|
||
msgctxt "ulng.rsmsghotdirsimplemenu"
|
||
msgid "Menu name:"
|
||
msgstr "Sous-menu :"
|
||
|
||
#: ulng.rsmsghotdirsimplename
|
||
msgctxt "ulng.rsmsghotdirsimplename"
|
||
msgid "Name:"
|
||
msgstr "Nom :"
|
||
|
||
#: ulng.rsmsghotdirsimpleseparator
|
||
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
||
msgid "(separator)"
|
||
msgstr "(séparateur)"
|
||
|
||
#: ulng.rsmsghotdirsubmenuname
|
||
msgctxt "ulng.rsmsghotdirsubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Nom du sous-menu"
|
||
|
||
#: ulng.rsmsghotdirtarget
|
||
msgid "Hotdir target"
|
||
msgstr "Dossier-cible"
|
||
|
||
#: ulng.rsmsghotdirtiporderpath
|
||
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Détermine l''ordre de tri du panneau actif après avoir changé de dossier"
|
||
|
||
#: ulng.rsmsghotdirtipordertarget
|
||
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Détermine l''ordre de tri du panneau inactif après avoir changé de dossier"
|
||
|
||
#: ulng.rsmsghotdirtipspecialdirbut
|
||
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
||
msgstr "Quelques fonctions pour choisir le chemin parmis ceux relatif, absolu, selon les dossiers spéciaux de Windows, etc."
|
||
|
||
#: ulng.rsmsghotdirtotalbackuped
|
||
msgid ""
|
||
"Total entries saved: %d\n"
|
||
"\n"
|
||
"Backup filename: %s\n"
|
||
msgstr ""
|
||
"Entrées sauvegardées : %d\n"
|
||
"\n"
|
||
"Fichier de backup : %s\n"
|
||
|
||
#: ulng.rsmsghotdirtotalexported
|
||
msgid "Total entries exported: "
|
||
msgstr "Nombre d''entrées exportées : "
|
||
|
||
#: ulng.rsmsghotdirwhattodelete
|
||
msgid ""
|
||
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
||
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
||
msgstr ""
|
||
"Voulez-vous effacer tous les éléments du sous-menu [%s]?\n"
|
||
"Répondre NON va effacer seulment les délimiteurs de menu mais conservera tous les éléments à l'intérieur du menu\n"
|
||
|
||
#: ulng.rsmsghotdirwheretosave
|
||
msgid "Enter location and filename where to save a Directory Hotlist file"
|
||
msgstr "Sélectionnez où sauvegarder le fichier des dossiers favoris"
|
||
|
||
#: ulng.rsmsgincorrectfilelength
|
||
msgid "Incorrect resulting filelength for file : \"%s\""
|
||
msgstr "Longueur de fichier résultant incorrecte : \"%s\""
|
||
|
||
#: ulng.rsmsginsertnextdisk
|
||
msgid ""
|
||
"Please insert next disk or something similar.\n"
|
||
"\n"
|
||
"It is to allow writing this file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Number of bytes still to write: %d\n"
|
||
msgstr ""
|
||
"Insérez le prochain média de support.\n"
|
||
"\n"
|
||
"C'est pour écrire le fichier :\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Nombre d'octets restant à écrire : %d\n"
|
||
|
||
#: ulng.rsmsginvalidcommandline
|
||
msgid "Error in command line"
|
||
msgstr "Erreur dans la ligne de commande"
|
||
|
||
#: ulng.rsmsginvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Nom de fichier incorrect"
|
||
|
||
#: ulng.rsmsginvalidformatofconfigurationfile
|
||
msgid "Invalid format of configuration file"
|
||
msgstr "Format incorrect du fichier de configuration"
|
||
|
||
#: ulng.rsmsginvalidpath
|
||
msgid "Invalid path"
|
||
msgstr "Chemin invalide"
|
||
|
||
#: ulng.rsmsginvalidpathlong
|
||
msgid "Path %s contains forbidden characters."
|
||
msgstr "Le chemin \"%s\" contient de caractères interdits"
|
||
|
||
#: ulng.rsmsginvalidplugin
|
||
msgid "This is not a valid plugin!"
|
||
msgstr "Ce n'est pas un \"plugin\" valide!"
|
||
|
||
#: ulng.rsmsginvalidpluginarchitecture
|
||
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
||
msgstr "Ce \"plugin\" est fait pour Double Commander pour %s.%sIl ne peut pas fonctionner avec Double Commander pour %s!"
|
||
|
||
#: ulng.rsmsginvalidquoting
|
||
msgid "Invalid quoting"
|
||
msgstr "Mise entre guillemets invalide"
|
||
|
||
#: ulng.rsmsginvalidselection
|
||
msgid "Invalid selection."
|
||
msgstr "Sélection non permise"
|
||
|
||
#: ulng.rsmsgloadingfilelist
|
||
msgid "Loading file list..."
|
||
msgstr "Chargement de la liste des fichiers..."
|
||
|
||
#: ulng.rsmsglocatetcconfiguation
|
||
msgid "Locate TC configuration file (wincmd.ini)"
|
||
msgstr "Localisez le fichier de configuration de TC (wincmd.ini)"
|
||
|
||
#: ulng.rsmsglocatetcexecutable
|
||
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
||
msgstr "Localisez le fichier de l'exécutable (totalcmd.exe or totalcmd64.exe)"
|
||
|
||
#: ulng.rsmsglogcopy
|
||
msgid "Copy file %s"
|
||
msgstr "Copie du fichier %s"
|
||
|
||
#: ulng.rsmsglogdelete
|
||
msgid "Delete file %s"
|
||
msgstr "Suppression du fichier %s"
|
||
|
||
#: ulng.rsmsglogerror
|
||
msgid "Error: "
|
||
msgstr "Erreur :"
|
||
|
||
#: ulng.rsmsglogextcmdlaunch
|
||
msgid "Launch external"
|
||
msgstr "Lancement externe"
|
||
|
||
#: ulng.rsmsglogextcmdresult
|
||
msgid "Result external"
|
||
msgstr "Résultat externe"
|
||
|
||
#: ulng.rsmsglogextract
|
||
msgid "Extract file %s"
|
||
msgstr "Extraction du fichier %s"
|
||
|
||
#: ulng.rsmsgloginfo
|
||
msgid "Info: "
|
||
msgstr "Information :"
|
||
|
||
#: ulng.rsmsgloglink
|
||
msgid "Create link %s"
|
||
msgstr "Créer le lien %s"
|
||
|
||
#: ulng.rsmsglogmkdir
|
||
msgid "Create directory %s"
|
||
msgstr "Créer le dossier %s"
|
||
|
||
#: ulng.rsmsglogmove
|
||
msgid "Move file %s"
|
||
msgstr "Déplacer le fichier %s"
|
||
|
||
#: ulng.rsmsglogpack
|
||
msgid "Pack to file %s"
|
||
msgstr "Archiver dans le fichier %s"
|
||
|
||
#: ulng.rsmsglogrmdir
|
||
msgid "Remove directory %s"
|
||
msgstr "Supprimer le dossier %s"
|
||
|
||
#: ulng.rsmsglogsuccess
|
||
msgid "Done: "
|
||
msgstr "Effectué :"
|
||
|
||
#: ulng.rsmsglogsymlink
|
||
msgid "Create symlink %s"
|
||
msgstr "Créer le lien symbolique %s"
|
||
|
||
#: ulng.rsmsglogtest
|
||
msgid "Test file integrity %s"
|
||
msgstr "Test de l'intégrité du fichier %s"
|
||
|
||
#: ulng.rsmsglogwipe
|
||
msgid "Wipe file %s"
|
||
msgstr "Pulvérisez le fichier %s"
|
||
|
||
#: ulng.rsmsglogwipedir
|
||
msgid "Wipe directory %s"
|
||
msgstr "Pulvérisez le dossier %s"
|
||
|
||
#: ulng.rsmsgmasterpassword
|
||
msgid "Master Password"
|
||
msgstr "Mot de passe principal"
|
||
|
||
#: ulng.rsmsgmasterpasswordenter
|
||
msgid "Please enter the master password:"
|
||
msgstr "Introduisez le mot de passe principal :"
|
||
|
||
#: ulng.rsmsgnewfile
|
||
msgid "New file"
|
||
msgstr "Nouveau fichier"
|
||
|
||
#: ulng.rsmsgnextvolunpack
|
||
msgid "Next volume will be unpacked"
|
||
msgstr "Le volume suivant de l'archive va être extrait"
|
||
|
||
#: ulng.rsmsgnofiles
|
||
msgid "No files"
|
||
msgstr "Aucun fichier"
|
||
|
||
#: ulng.rsmsgnofilesselected
|
||
msgid "No files selected."
|
||
msgstr "Aucun fichier sélectionner."
|
||
|
||
#: ulng.rsmsgnofreespacecont
|
||
msgid "No enough free space on target drive, Continue?"
|
||
msgstr "Espace insuffisant sur le volume cible. Continuer ?"
|
||
|
||
#: ulng.rsmsgnofreespaceretry
|
||
msgid "No enough free space on target drive, Retry?"
|
||
msgstr "Espace insuffisant sur le volume cible. Réessayer ?"
|
||
|
||
#: ulng.rsmsgnotdelete
|
||
msgid "Can not delete file %s"
|
||
msgstr "Impossible de supprimer le fichier %s"
|
||
|
||
#: ulng.rsmsgnotimplemented
|
||
msgid "Not implemented."
|
||
msgstr "Pas encore implémenté."
|
||
|
||
#: ulng.rsmsgpanelpreview
|
||
msgctxt "ulng.rsmsgpanelpreview"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Ci-dessous est un aperçu. Vous pouvez voir immédiatement le résultat de vos ajustements de couleur et tester un peu."
|
||
|
||
#: ulng.rsmsgpassword
|
||
msgid "Password:"
|
||
msgstr "Mot de passe :"
|
||
|
||
#: ulng.rsmsgpassworddiff
|
||
msgid "Passwords are different!"
|
||
msgstr "Les mots de passe sont différent!"
|
||
|
||
#: ulng.rsmsgpasswordenter
|
||
msgid "Please enter the password:"
|
||
msgstr "Introduire le mot de passe :"
|
||
|
||
#: ulng.rsmsgpasswordfirewall
|
||
msgid "Password (Firewall):"
|
||
msgstr "Mot de passe (Firewall) :"
|
||
|
||
#: ulng.rsmsgpasswordverify
|
||
msgid "Please re-enter the password for verification:"
|
||
msgstr "S'il vous plait, ré-entrez le mot de passe pour vérification :"
|
||
|
||
#: ulng.rsmsgpopuphotdelete
|
||
msgid "&Delete %s"
|
||
msgstr "&Supprimer %s"
|
||
|
||
#: ulng.rsmsgpresetalreadyexists
|
||
msgid "Preset \"%s\" already exists. Overwrite?"
|
||
msgstr "Écraser la configuration existante ?"
|
||
|
||
#: ulng.rsmsgproblemexecutingcommand
|
||
msgid "Problem executing command (%s)"
|
||
msgstr "Problème d'exécution de la commande (%s)"
|
||
|
||
#: ulng.rsmsgpromptaskingfilename
|
||
msgid "Filename for dropped text:"
|
||
msgstr "Nom de fichier pour le texte déposé :"
|
||
|
||
#: ulng.rsmsgprovidethisfile
|
||
msgid "Please, make this file available. Retry?"
|
||
msgstr "S'il vous plait, rendez ce fichier disponible. Ré-essayer?"
|
||
|
||
#: ulng.rsmsgrenamefavtabs
|
||
msgid "Enter new friendly name for this Favorite Tabs"
|
||
msgstr "Entrez un nom pour ce groupe d'onglets favoris"
|
||
|
||
#: ulng.rsmsgrenamefavtabsmenu
|
||
msgid "Enter new name for this menu"
|
||
msgstr "Entrez un nom pour ce nouveau menu"
|
||
|
||
#: ulng.rsmsgrenfldr
|
||
msgid "Rename/move %d selected files/directories?"
|
||
msgstr "Renommer/Déplacer les %d fichiers/dossiers sélectionnés ?"
|
||
|
||
#: ulng.rsmsgrensel
|
||
msgid "Rename/move selected \"%s\"?"
|
||
msgstr "Renommer/Déplacer la sélection \"%s\" ?"
|
||
|
||
#: ulng.rsmsgrestartforapplychanges
|
||
msgid "Please, restart Double Commander in order to apply changes"
|
||
msgstr "Vous devez redémarrer Double Commander pour activer les changements."
|
||
|
||
#: ulng.rsmsgsekectfiletype
|
||
msgid "Select to which file type to add extension \"%s\""
|
||
msgstr "Choisissez le type de fichier auquel ajouté une extension \"%s\""
|
||
|
||
#: ulng.rsmsgselectedinfo
|
||
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
||
msgstr "Sélectionnés : %s de %s, fichiers : %d sur %d, dossiers : %d sur %d"
|
||
|
||
#: ulng.rsmsgselectexecutablefile
|
||
msgid "Select executable file for"
|
||
msgstr "Choisissez le fichier d'exécutable pour"
|
||
|
||
#: ulng.rsmsgselectonlychecksumfiles
|
||
msgid "Please select only checksum files!"
|
||
msgstr "S'il vous plait, choisissez uniquement un fichier contenant une (des) signature(s)!"
|
||
|
||
#: ulng.rsmsgsellocnextvol
|
||
msgid "Please select location of next volume"
|
||
msgstr "Merci de choisir l'emplacement du volume suivant"
|
||
|
||
#: ulng.rsmsgsetvolumelabel
|
||
msgid "Set volume label"
|
||
msgstr "Définir le nom du vomume"
|
||
|
||
#: ulng.rsmsgspecialdir
|
||
msgid "Special Dirs"
|
||
msgstr "Dossier spéciaux"
|
||
|
||
#: ulng.rsmsgspecialdiraddacti
|
||
msgid "Add path from active frame"
|
||
msgstr "Ajoute le dossier du panneau actif"
|
||
|
||
#: ulng.rsmsgspecialdiraddnonacti
|
||
msgid "Add path from inactive frame"
|
||
msgstr "Ajoute le dossier du panneau inactif"
|
||
|
||
#: ulng.rsmsgspecialdirbrowssel
|
||
msgid "Browse and use selected path"
|
||
msgstr "Parcourir et utiliser le dossier désigné"
|
||
|
||
#: ulng.rsmsgspecialdirenvvar
|
||
msgid "Use environment variable..."
|
||
msgstr "Utilise variable d'environnement"
|
||
|
||
#: ulng.rsmsgspecialdirgotodc
|
||
msgid "Go to Double Commander special path..."
|
||
msgstr "Aller configurer les chemin spéciaux de DC..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoenvvar
|
||
msgid "Go to environment variable..."
|
||
msgstr "Aller au variables d'environnement"
|
||
|
||
#: ulng.rsmsgspecialdirgotoother
|
||
msgid "Go to other Windows special folder..."
|
||
msgstr "Aller aux dossiers spéciaux de Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirgototc
|
||
msgid "Go to Windows special folder (TC)..."
|
||
msgstr "Aller aux dossiers spéciaux de Windows (TC)..."
|
||
|
||
#: ulng.rsmsgspecialdirmakereltohotdir
|
||
msgid "Make relative to hotdir path"
|
||
msgstr "Rend relatif selon le chemin du dossier favori"
|
||
|
||
#: ulng.rsmsgspecialdirmkabso
|
||
msgid "Make path absolute"
|
||
msgstr "Transforme le chemin en absolu"
|
||
|
||
#: ulng.rsmsgspecialdirmkdcrel
|
||
msgid "Make relative to Double Commander special path..."
|
||
msgstr "Transforme le chemin en relatif par rapport à un dossier spécial de DC..."
|
||
|
||
#: ulng.rsmsgspecialdirmkenvrel
|
||
msgid "Make relative to environment variable..."
|
||
msgstr "Transforme le chemin en relatif par rapport à une variable d'environnement"
|
||
|
||
#: ulng.rsmsgspecialdirmktctel
|
||
msgid "Make relative to Windows special folder (TC)..."
|
||
msgstr "Transforme le chemin en relatif par rapport à un dossier spécial de Windows (même que TC)..."
|
||
|
||
#: ulng.rsmsgspecialdirmkwnrel
|
||
msgid "Make relative to other Windows special folder..."
|
||
msgstr "Transforme le chemin en relatif par rapport à un autre dossier spécial de Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusedc
|
||
msgid "Use Double Commander special path..."
|
||
msgstr "Utilise un chemin spécial de Double Commander..."
|
||
|
||
#: ulng.rsmsgspecialdirusehotdir
|
||
msgid "Use hotdir path"
|
||
msgstr "Utilise le chemin du dossier favori"
|
||
|
||
#: ulng.rsmsgspecialdiruseother
|
||
msgid "Use other Windows special folder..."
|
||
msgstr "Choisir parmis d'autre dossiers spéciaux de Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusetc
|
||
msgid "Use Windows special folder (TC)..."
|
||
msgstr "Choisir parmis des dossiers spéciaux de Windows (TC)..."
|
||
|
||
#: ulng.rsmsgtabforopeninginnewtab
|
||
msgid "This tab (%s) is locked! Open directory in another tab?"
|
||
msgstr "Cet onglet (%s) est verrouillé! Voulez-vous ouvrir ce dossier dans un autre onglet?"
|
||
|
||
#: ulng.rsmsgtabrenamecaption
|
||
msgid "Rename tab"
|
||
msgstr "Renommer l'onglet"
|
||
|
||
#: ulng.rsmsgtabrenameprompt
|
||
msgid "New tab name:"
|
||
msgstr "Nom du nouvel onglet :"
|
||
|
||
#: ulng.rsmsgtargetdir
|
||
msgid "Target path:"
|
||
msgstr "Chemin du dossier cible :"
|
||
|
||
#: ulng.rsmsgtcconfignotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration file:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Erreur! On ne trouve pas le fichier de configuratio de TC:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcexecutablenotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration executable:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Erreur! On ne trouve pas le fichier de l'exécutable de TC :\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcisrunning
|
||
msgid ""
|
||
"Error! TC is still running but it should be closed for this operation.\n"
|
||
"Close it and press OK or press CANCEL to abort.\n"
|
||
msgstr ""
|
||
"Erreur! TC est toujours en cours d'exécution mais devrait être fermé pour compléter cette opération.\n"
|
||
"Fermez-le et appuyez OK ou ANNULER pour avorter.\n"
|
||
|
||
#: ulng.rsmsgtctoolbarnotfound
|
||
msgid ""
|
||
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Erreur! On ne trouve pas le dossier de sortie pour la barre d'outil TC désirée :\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a TC Toolbar file"
|
||
msgstr "Entrez l'emplacement et le nom de fichier pour la barre d'outil TC à sauvegarder"
|
||
|
||
#: ulng.rsmsgthisisnowinclipboard
|
||
msgid "\"%s\" is now in the clipboard"
|
||
msgstr "\"%\" est maintenant dans le presse-papier"
|
||
|
||
#: ulng.rsmsgtitleextnotinfiletype
|
||
msgid "Extension of selected file is not in any recognized file types"
|
||
msgstr "L'extension du fichier sélectionné n'est pas parmis celles reconnues"
|
||
|
||
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
||
msgid "Locate \".toolbar\" file to import"
|
||
msgstr "Sélectionnez le fichier \".toolbar\" à importer"
|
||
|
||
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
||
msgid "Locate \".BAR\" file to import"
|
||
msgstr "Sélectionnez le fichier \".BAR\" à importer"
|
||
|
||
#: ulng.rsmsgtoolbarrestorewhat
|
||
msgid "Enter location and filename of Toolbar to restore"
|
||
msgstr "Entrez l'emplacement et le nom de fichier pour la barre d'outil à ramener"
|
||
|
||
#: ulng.rsmsgtoolbarsaved
|
||
msgid ""
|
||
"Saved!\n"
|
||
"Toolbar filename: %s\n"
|
||
msgstr ""
|
||
"Sauvegardé!\n"
|
||
"Nom du fichier de barre d'outil : %s\n"
|
||
|
||
#: ulng.rsmsgtoomanyfilesselected
|
||
msgid "Too many files selected."
|
||
msgstr "Trop de fichier sélectionnés."
|
||
|
||
#: ulng.rsmsgundeterminednumberoffile
|
||
msgid "Undetermined"
|
||
msgstr "Indéterminé"
|
||
|
||
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
||
msgid "ERROR: Unexpected Tree View Menu usage!"
|
||
msgstr "ERREUR : Comportement inattendu dans le menu en arbre!"
|
||
|
||
#: ulng.rsmsgurl
|
||
msgid "URL:"
|
||
msgstr "URL :"
|
||
|
||
#: ulng.rsmsguserdidnotsetextension
|
||
msgid "<NO EXT>"
|
||
msgstr "<SANS EXT>"
|
||
|
||
#: ulng.rsmsguserdidnotsetname
|
||
msgid "<NO NAME>"
|
||
msgstr "<SANS NOM>"
|
||
|
||
#: ulng.rsmsgusername
|
||
msgid "User name:"
|
||
msgstr "Nom d'utilisateur :"
|
||
|
||
#: ulng.rsmsgusernamefirewall
|
||
msgid "User name (Firewall):"
|
||
msgstr "Nom d'utilisateur (Firewall) :"
|
||
|
||
#: ulng.rsmsgvolumelabel
|
||
msgid "Volume label:"
|
||
msgstr "Nom de volume :"
|
||
|
||
#: ulng.rsmsgvolumesizeenter
|
||
msgid "Please enter the volume size:"
|
||
msgstr "Entrez la taille du volume :"
|
||
|
||
#: ulng.rsmsgwipefldr
|
||
msgid "Wipe %d selected files/directories?"
|
||
msgstr "Lancer l'effacement sécurisé pour les %d fichiers/dossiers sélectionnés ?"
|
||
|
||
#: ulng.rsmsgwipesel
|
||
msgid "Wipe selected \"%s\"?"
|
||
msgstr "Lancer l'effacement sécurisé pour la sélection \"%s\" ?"
|
||
|
||
#: ulng.rsmsgwithactionwith
|
||
msgid "with"
|
||
msgstr "avec"
|
||
|
||
#: ulng.rsmulrenfilenamestylelist
|
||
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
||
msgstr "Pas de changement;MAJUSCULE;minuscule;Premier caractère majuscule;Premier Caractère De Chaque Mot Majuscule;"
|
||
|
||
#: ulng.rsmulrenwronglinesnumber
|
||
msgid "File contains wrong number of lines: %d, should be %d!"
|
||
msgstr "Le fichier contient le mauvais nombre de lignes: %d, mais devrait être %d!"
|
||
|
||
#: ulng.rsnewsearchclearfilteroptions
|
||
msgid "Keep;Clear;Prompt"
|
||
msgstr "Conserver;Réinitialiser;Demander"
|
||
|
||
#: ulng.rsnoequivalentinternalcommand
|
||
msgid "No internal equivalent command"
|
||
msgstr "Pas commande interne équivalente"
|
||
|
||
#: ulng.rsnofindfileswindowyet
|
||
msgid "Sorry, no \"Find files\" window yet..."
|
||
msgstr "Désolé, aucune fenêtre de recherche de fichiers..."
|
||
|
||
#: ulng.rsnootherfindfileswindowtoclose
|
||
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
||
msgstr "Désolé, il n'y a pas de fenêtre de recherche à fermer et oublier..."
|
||
|
||
#: ulng.rsoperaborted
|
||
msgid "Aborted"
|
||
msgstr "Annulé"
|
||
|
||
#: ulng.rsopercalculatingchecksum
|
||
msgid "Calculating checksum"
|
||
msgstr "Calcun de signature"
|
||
|
||
#: ulng.rsopercalculatingchecksumin
|
||
msgid "Calculating checksum in \"%s\""
|
||
msgstr "Calcul de signature en \"%s\""
|
||
|
||
#: ulng.rsopercalculatingchecksumof
|
||
msgid "Calculating checksum of \"%s\""
|
||
msgstr "Calcul de signature de \"%s\""
|
||
|
||
#: ulng.rsopercalculatingstatictics
|
||
msgctxt "ulng.rsopercalculatingstatictics"
|
||
msgid "Calculating"
|
||
msgstr "Calcul en cours..."
|
||
|
||
#: ulng.rsopercalculatingstatisticsin
|
||
msgid "Calculating \"%s\""
|
||
msgstr "Calcul \"%s\""
|
||
|
||
#: ulng.rsopercombining
|
||
msgid "Joining"
|
||
msgstr "Concaténage"
|
||
|
||
#: ulng.rsopercombiningfromto
|
||
msgid "Joining files in \"%s\" to \"%s\""
|
||
msgstr "Concaténer fichiers dans \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsopercopying
|
||
msgid "Copying"
|
||
msgstr "Copie"
|
||
|
||
#: ulng.rsopercopyingfromto
|
||
msgid "Copying from \"%s\" to \"%s\""
|
||
msgstr "Copie de \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsopercopyingsomethingto
|
||
msgid "Copying \"%s\" to \"%s\""
|
||
msgstr "Copie \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsopercreatingdirectory
|
||
msgid "Creating directory"
|
||
msgstr "Création d'un dossier"
|
||
|
||
#: ulng.rsopercreatingsomedirectory
|
||
msgid "Creating directory \"%s\""
|
||
msgstr "Création du dossier \"%s\""
|
||
|
||
#: ulng.rsoperdeleting
|
||
msgctxt "ulng.rsoperdeleting"
|
||
msgid "Deleting"
|
||
msgstr "Suppression"
|
||
|
||
#: ulng.rsoperdeletingin
|
||
msgid "Deleting in \"%s\""
|
||
msgstr "Effacement dans \"%s\""
|
||
|
||
#: ulng.rsoperdeletingsomething
|
||
msgid "Deleting \"%s\""
|
||
msgstr "Efface \"%s\""
|
||
|
||
#: ulng.rsoperexecuting
|
||
msgid "Executing"
|
||
msgstr "Exécution"
|
||
|
||
#: ulng.rsoperexecutingsomething
|
||
msgid "Executing \"%s\""
|
||
msgstr "Exécution de \"%s\""
|
||
|
||
#: ulng.rsoperextracting
|
||
msgid "Extracting"
|
||
msgstr "Décompression"
|
||
|
||
#: ulng.rsoperextractingfromto
|
||
msgid "Extracting from \"%s\" to \"%s\""
|
||
msgstr "Décompression de \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsoperfinished
|
||
msgid "Finished"
|
||
msgstr "Terminés"
|
||
|
||
#: ulng.rsoperlisting
|
||
msgid "Listing"
|
||
msgstr "Liste"
|
||
|
||
#: ulng.rsoperlistingin
|
||
msgid "Listing \"%s\""
|
||
msgstr "Liste \"%s\""
|
||
|
||
#: ulng.rsopermoving
|
||
msgid "Moving"
|
||
msgstr "Déplacement"
|
||
|
||
#: ulng.rsopermovingfromto
|
||
msgid "Moving from \"%s\" to \"%s\""
|
||
msgstr "Déplacement de \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsopermovingsomethingto
|
||
msgid "Moving \"%s\" to \"%s\""
|
||
msgstr "Déplacement de \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsopernotstarted
|
||
msgid "Not started"
|
||
msgstr "Pas encore démarrés"
|
||
|
||
#: ulng.rsoperpacking
|
||
msgid "Packing"
|
||
msgstr "Compression"
|
||
|
||
#: ulng.rsoperpackingfromto
|
||
msgid "Packing from \"%s\" to \"%s\""
|
||
msgstr "Compression de \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsoperpackingsomethingto
|
||
msgid "Packing \"%s\" to \"%s\""
|
||
msgstr "Compression de \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsoperpaused
|
||
msgid "Paused"
|
||
msgstr "En attente"
|
||
|
||
#: ulng.rsoperpausing
|
||
msgid "Pausing"
|
||
msgstr "Mettre en attente"
|
||
|
||
#: ulng.rsoperrunning
|
||
msgid "Running"
|
||
msgstr "En cours"
|
||
|
||
#: ulng.rsopersettingproperty
|
||
msgid "Setting property"
|
||
msgstr "Ajustement d'une propriété"
|
||
|
||
#: ulng.rsopersettingpropertyin
|
||
msgid "Setting property in \"%s\""
|
||
msgstr "Ajustement d'une propriété dans \"%s\""
|
||
|
||
#: ulng.rsopersettingpropertyof
|
||
msgid "Setting property of \"%s\""
|
||
msgstr "Ajustement d'une propriété de \"%s\""
|
||
|
||
#: ulng.rsopersplitting
|
||
msgid "Splitting"
|
||
msgstr "Fractionnement"
|
||
|
||
#: ulng.rsopersplittingfromto
|
||
msgid "Splitting \"%s\" to \"%s\""
|
||
msgstr "Fractionnement de \"%s\" vers \"%s\""
|
||
|
||
#: ulng.rsoperstarting
|
||
msgid "Starting"
|
||
msgstr "En cours de démarrage"
|
||
|
||
#: ulng.rsoperstopped
|
||
msgid "Stopped"
|
||
msgstr "Arrêté"
|
||
|
||
#: ulng.rsoperstopping
|
||
msgid "Stopping"
|
||
msgstr "En train d'arrêter"
|
||
|
||
#: ulng.rsopertesting
|
||
msgid "Testing"
|
||
msgstr "Test"
|
||
|
||
#: ulng.rsopertestingin
|
||
msgid "Testing in \"%s\""
|
||
msgstr "Test dans \"%s\""
|
||
|
||
#: ulng.rsopertestingsomething
|
||
msgid "Testing \"%s\""
|
||
msgstr "Test \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksum
|
||
msgid "Verifying checksum"
|
||
msgstr "Vérification de la signature"
|
||
|
||
#: ulng.rsoperverifyingchecksumin
|
||
msgid "Verifying checksum in \"%s\""
|
||
msgstr "Vérification de la signature dans \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksumof
|
||
msgid "Verifying checksum of \"%s\""
|
||
msgstr "Vérification de la signature de \"%s\""
|
||
|
||
#: ulng.rsoperwaitingforconnection
|
||
msgid "Waiting for access to file source"
|
||
msgstr "En attente de l'accès au fichier source..."
|
||
|
||
#: ulng.rsoperwaitingforfeedback
|
||
msgid "Waiting for user response"
|
||
msgstr "En attente de la réponse de l'utilisateur..."
|
||
|
||
#: ulng.rsoperwiping
|
||
msgid "Wiping"
|
||
msgstr "Pulvérisation"
|
||
|
||
#: ulng.rsoperwipingin
|
||
msgid "Wiping in \"%s\""
|
||
msgstr "Pulvérise dans \"%s\""
|
||
|
||
#: ulng.rsoperwipingsomething
|
||
msgid "Wiping \"%s\""
|
||
msgstr "Pulvérise \"%s\""
|
||
|
||
#: ulng.rsoperworking
|
||
msgid "Working"
|
||
msgstr "Dossier de travail"
|
||
|
||
#: ulng.rsoptaddfrommainpanel
|
||
msgid "Add at beginning;Add at the end;Smart add"
|
||
msgstr "Ajout au début;Ajout à la fin;Ajout astucieux"
|
||
|
||
#: ulng.rsoptarchivedelete
|
||
msgctxt "ulng.rsoptarchivedelete"
|
||
msgid "Delete:"
|
||
msgstr "Supprimer :"
|
||
|
||
#: ulng.rsoptarchiveextractwithoutpath
|
||
msgid "Extract without path:"
|
||
msgstr "Extraire sans les chemins des dossiers contenus dans l'archive :"
|
||
|
||
#: ulng.rsoptarchiveformmode
|
||
msgid "Format parsing mode:"
|
||
msgstr "Mode d'analyse de format :"
|
||
|
||
#: ulng.rsoptarchiveid
|
||
msgctxt "ulng.rsoptarchiveid"
|
||
msgid "ID:"
|
||
msgstr "ID :"
|
||
|
||
#: ulng.rsoptarchiveidpos
|
||
msgctxt "ulng.rsoptarchiveidpos"
|
||
msgid "ID Position:"
|
||
msgstr "Position de l'ID :"
|
||
|
||
#: ulng.rsoptarchiveidseekrange
|
||
msgctxt "ulng.rsoptarchiveidseekrange"
|
||
msgid "ID Seek Range:"
|
||
msgstr "Plage de recherche du ID :"
|
||
|
||
#: ulng.rsoptarchiveparam
|
||
msgid "Parameter"
|
||
msgstr "Paramètre"
|
||
|
||
#: ulng.rsoptarchivepasswordquery
|
||
msgid "Password query string:"
|
||
msgstr "Mot de passe :"
|
||
|
||
#: ulng.rsoptarchiveselfextract
|
||
msgctxt "ulng.rsoptarchiveselfextract"
|
||
msgid "Create self extracting archive:"
|
||
msgstr "Créer une archive auto-extractible :"
|
||
|
||
#: ulng.rsoptarchivetest
|
||
msgctxt "ulng.rsoptarchivetest"
|
||
msgid "Test:"
|
||
msgstr "Tester l'archive :"
|
||
|
||
#: ulng.rsoptarchivetypename
|
||
msgid "Archive type name:"
|
||
msgstr "Type d'archive :"
|
||
|
||
#: ulng.rsoptarchivevalue
|
||
msgctxt "ulng.rsoptarchivevalue"
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: ulng.rsoptassocpluginwith
|
||
msgid "Associate plugin \"%s\" with:"
|
||
msgstr "Associer le \"plugin\" %s avec :"
|
||
|
||
#: ulng.rsoptautosizecolumn
|
||
msgid "First;Last;"
|
||
msgstr "Premier;Dernier;"
|
||
|
||
#: ulng.rsoptconfigsortorder
|
||
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
||
msgstr "Ordre classique;Ordre alphabétique (mais \"Langue\" sera toujours premier)"
|
||
|
||
#: ulng.rsoptdifferframeposition
|
||
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
||
msgstr "Le panneau actif à gauche et l'inactif à droite (classique);Le panneau de gauche à gauche, celui de droite à droite"
|
||
|
||
#: ulng.rsoptdisable
|
||
msgid "Disable"
|
||
msgstr "Désactiver"
|
||
|
||
#: ulng.rsoptenable
|
||
msgctxt "ulng.rsoptenable"
|
||
msgid "Enable"
|
||
msgstr "Activer"
|
||
|
||
#: ulng.rsoptenterext
|
||
msgid "Enter extension"
|
||
msgstr "Entrer une extension"
|
||
|
||
#: ulng.rsoptfavoritetabswheretoaddinlist
|
||
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
||
msgstr "Ajoute au début;Ajoute à la fin;Ordre alphabétique"
|
||
|
||
#: ulng.rsoptfileoperationsprogresskind
|
||
msgid "separate window;minimized separate window;operations panel"
|
||
msgstr "fenêtre séparée;fenêtre séparée réduite;panneau d'opération"
|
||
|
||
#: ulng.rsoptfilesizeformat
|
||
msgid "float;B;K;M;G"
|
||
msgstr "dynamique;B;K;M;G"
|
||
|
||
#: ulng.rsopthotkeysadddeleteshortcutlong
|
||
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
||
msgstr "Le raccourci %s de la commande cm_Delete va être enregistré, donc it pourra être utilisé pour inverser cette option."
|
||
|
||
#: ulng.rsopthotkeysaddhotkey
|
||
msgid "Add hotkey for %s"
|
||
msgstr "Ajoute un raccourci clavier pour %s"
|
||
|
||
#: ulng.rsopthotkeysaddshortcutbutton
|
||
msgid "Add shortcut"
|
||
msgstr "Ajoute un raccourci"
|
||
|
||
#: ulng.rsopthotkeyscannotsetshortcut
|
||
msgid "Cannot set shortcut"
|
||
msgstr "On ne peut ajuster de raccourci"
|
||
|
||
#: ulng.rsopthotkeyschangeshortcut
|
||
msgid "Change shortcut"
|
||
msgstr "Changer le raccourci"
|
||
|
||
#: ulng.rsopthotkeyscommand
|
||
msgctxt "ulng.rsopthotkeyscommand"
|
||
msgid "Command"
|
||
msgstr "Commande"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
||
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
||
msgstr "Le raccourci %s de la commande cm_Delete a un paramètre qui peut passer outre cette option. Voulez-vous changer ce paramètre pour utiliser celui global?"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
||
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
||
msgstr "Le raccourci %s de la commande cm_Delete a besoin d'avoir un paramètre modifié pour correspondre au raccourci %s. Est-ce que vous voulez le changer?"
|
||
|
||
#: ulng.rsopthotkeysdescription
|
||
msgctxt "ulng.rsopthotkeysdescription"
|
||
msgid "Description"
|
||
msgstr "Description"
|
||
|
||
#: ulng.rsopthotkeysedithotkey
|
||
msgid "Edit hotkey for %s"
|
||
msgstr "Éditer raccourci clavier pour %s"
|
||
|
||
#: ulng.rsopthotkeysfixparameter
|
||
msgid "Fix parameter"
|
||
msgstr "Paramètre fixe"
|
||
|
||
#: ulng.rsopthotkeyshotkey
|
||
msgctxt "ulng.rsopthotkeyshotkey"
|
||
msgid "Hotkey"
|
||
msgstr "Raccourci clavier"
|
||
|
||
#: ulng.rsopthotkeyshotkeys
|
||
msgctxt "ulng.rsopthotkeyshotkeys"
|
||
msgid "Hotkeys"
|
||
msgstr "Raccourcis clavier"
|
||
|
||
#: ulng.rsopthotkeysnohotkey
|
||
msgid "<none>"
|
||
msgstr "<aucun>"
|
||
|
||
#: ulng.rsopthotkeysparameters
|
||
msgctxt "ulng.rsopthotkeysparameters"
|
||
msgid "Parameters"
|
||
msgstr "Paramètres"
|
||
|
||
#: ulng.rsopthotkeyssetdeleteshortcut
|
||
msgid "Set shortcut to delete file"
|
||
msgstr "Ajuster le raccourci pour effacer un fichier"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
||
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
||
msgstr "Pour que cette option fonctionne avec le raccouris %s, le raccourci %s doit être assigné à cm_Delete but imais il est déjà assigné à %s. Désirez-vous changer cela?"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
||
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
||
msgstr "Le raccourci %s de la commande cm_Delete est une séquence de raccouci pourlaquelle l'action inverse avec \"SHIFT\" ne peux pas être habitué. Cet ajustement peut donc ne pas fonctionner."
|
||
|
||
#: ulng.rsopthotkeysshortcutused
|
||
msgid "Shortcut in use"
|
||
msgstr "Raccourcis utilisé"
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext1
|
||
msgid "Shortcut %s is already used."
|
||
msgstr "Le raccourci %s est déjà utilisé."
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext2
|
||
msgid "Change it to %s?"
|
||
msgstr "Modifier en %s ?"
|
||
|
||
#: ulng.rsopthotkeysusedby
|
||
msgid "used for %s in %s"
|
||
msgstr "utilisé par %s dans %s"
|
||
|
||
#: ulng.rsopthotkeysusedwithdifferentparams
|
||
msgid "used for this command but with different parameters"
|
||
msgstr "utilisé pour cette commande mais avec des paramètres différents"
|
||
|
||
#: ulng.rsoptionseditorarchivers
|
||
msgctxt "ulng.rsoptionseditorarchivers"
|
||
msgid "Archivers"
|
||
msgstr "Gestions des archives"
|
||
|
||
#: ulng.rsoptionseditorautorefresh
|
||
msgctxt "ulng.rsoptionseditorautorefresh"
|
||
msgid "Auto refresh"
|
||
msgstr "Rafraichissement automatique"
|
||
|
||
#: ulng.rsoptionseditorbehavior
|
||
msgctxt "ulng.rsoptionseditorbehavior"
|
||
msgid "Behaviors"
|
||
msgstr "Comportements"
|
||
|
||
#: ulng.rsoptionseditorbriefview
|
||
msgctxt "ulng.rsoptionseditorbriefview"
|
||
msgid "Brief"
|
||
msgstr "Vue résumé"
|
||
|
||
#: ulng.rsoptionseditorcolors
|
||
msgctxt "ulng.rsoptionseditorcolors"
|
||
msgid "Colors"
|
||
msgstr "Couleurs"
|
||
|
||
#: ulng.rsoptionseditorcolumnsview
|
||
msgctxt "ulng.rsoptionseditorcolumnsview"
|
||
msgid "Columns"
|
||
msgstr "Colonnes"
|
||
|
||
#: ulng.rsoptionseditorconfiguration
|
||
msgctxt "ulng.rsoptionseditorconfiguration"
|
||
msgid "Configuration"
|
||
msgstr "Configuration"
|
||
|
||
#: ulng.rsoptionseditorcustomcolumns
|
||
msgid "Custom columns"
|
||
msgstr "Colonnes personalisées"
|
||
|
||
#: ulng.rsoptionseditordirectoryhotlist
|
||
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Dossiers favoris"
|
||
|
||
#: ulng.rsoptionseditordraganddrop
|
||
msgid "Drag & drop"
|
||
msgstr "Glisser et déposer"
|
||
|
||
#: ulng.rsoptionseditordriveslistbutton
|
||
msgid "Drives list button"
|
||
msgstr "Bouton de lecteurs"
|
||
|
||
#: ulng.rsoptionseditorfavoritetabs
|
||
msgid "Favorite Tabs"
|
||
msgstr "Onglets favoris"
|
||
|
||
#: ulng.rsoptionseditorfileassicextra
|
||
msgid "File associations extra"
|
||
msgstr "Extension \"extra\""
|
||
|
||
#: ulng.rsoptionseditorfileassoc
|
||
msgctxt "ulng.rsoptionseditorfileassoc"
|
||
msgid "File associations"
|
||
msgstr "Associations de fichiers"
|
||
|
||
#: ulng.rsoptionseditorfilenewfiletypes
|
||
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
||
msgid "New"
|
||
msgstr "Nouveau"
|
||
|
||
#: ulng.rsoptionseditorfileoperations
|
||
msgctxt "ulng.rsoptionseditorfileoperations"
|
||
msgid "File operations"
|
||
msgstr "Opérations sur fichiers"
|
||
|
||
#: ulng.rsoptionseditorfilepanels
|
||
msgctxt "ulng.rsoptionseditorfilepanels"
|
||
msgid "File panels"
|
||
msgstr "Panneaux des fichiers"
|
||
|
||
#: ulng.rsoptionseditorfilesearch
|
||
msgctxt "ulng.rsoptionseditorfilesearch"
|
||
msgid "File search"
|
||
msgstr "Recherche de fichiers"
|
||
|
||
#: ulng.rsoptionseditorfilesviews
|
||
msgid "Files views"
|
||
msgstr "Affichage des fichiers"
|
||
|
||
#: ulng.rsoptionseditorfiletypes
|
||
msgctxt "ulng.rsoptionseditorfiletypes"
|
||
msgid "File types"
|
||
msgstr "Types de fichiers"
|
||
|
||
#: ulng.rsoptionseditorfoldertabs
|
||
msgctxt "ulng.rsoptionseditorfoldertabs"
|
||
msgid "Folder tabs"
|
||
msgstr "Onglets"
|
||
|
||
#: ulng.rsoptionseditorfoldertabsextra
|
||
msgid "Folder tabs extra"
|
||
msgstr "Options extra"
|
||
|
||
#: ulng.rsoptionseditorfonts
|
||
msgctxt "ulng.rsoptionseditorfonts"
|
||
msgid "Fonts"
|
||
msgstr "Polices"
|
||
|
||
#: ulng.rsoptionseditorhighlighters
|
||
msgid "Highlighters"
|
||
msgstr "Surbrillance"
|
||
|
||
#: ulng.rsoptionseditorhotkeys
|
||
msgctxt "ulng.rsoptionseditorhotkeys"
|
||
msgid "Hot keys"
|
||
msgstr "Raccourcis clavier"
|
||
|
||
#: ulng.rsoptionseditoricons
|
||
msgctxt "ulng.rsoptionseditoricons"
|
||
msgid "Icons"
|
||
msgstr "Icônes"
|
||
|
||
#: ulng.rsoptionseditorignorelist
|
||
msgctxt "ulng.rsoptionseditorignorelist"
|
||
msgid "Ignore list"
|
||
msgstr "Fichiers/dossiers ignorés"
|
||
|
||
#: ulng.rsoptionseditorkeyboard
|
||
msgid "Keys"
|
||
msgstr "Clavier"
|
||
|
||
#: ulng.rsoptionseditorlanguage
|
||
msgctxt "ulng.rsoptionseditorlanguage"
|
||
msgid "Language"
|
||
msgstr "Langue"
|
||
|
||
#: ulng.rsoptionseditorlayout
|
||
msgctxt "ulng.rsoptionseditorlayout"
|
||
msgid "Layout"
|
||
msgstr "Disposition"
|
||
|
||
#: ulng.rsoptionseditorlog
|
||
msgctxt "ulng.rsoptionseditorlog"
|
||
msgid "Log"
|
||
msgstr "Journal"
|
||
|
||
#: ulng.rsoptionseditormiscellaneous
|
||
msgctxt "ulng.rsoptionseditormiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Divers"
|
||
|
||
#: ulng.rsoptionseditormouse
|
||
msgid "Mouse"
|
||
msgstr "Souris"
|
||
|
||
#: ulng.rsoptionseditoroptionschanged
|
||
msgid ""
|
||
"Options have changed in \"%s\"\n"
|
||
"\n"
|
||
"Do you want to save modifications?\n"
|
||
msgstr ""
|
||
"Les options ont changé pour \"%s\"\n"
|
||
"\n"
|
||
"Voulez-vous sauvegarder les modifications?\n"
|
||
|
||
#: ulng.rsoptionseditorplugins
|
||
msgctxt "ulng.rsoptionseditorplugins"
|
||
msgid "Plugins"
|
||
msgstr "Plugins"
|
||
|
||
#: ulng.rsoptionseditorquicksearch
|
||
msgctxt "ulng.rsoptionseditorquicksearch"
|
||
msgid "Quick search/filter"
|
||
msgstr "Filtres de recherche rapide"
|
||
|
||
#: ulng.rsoptionseditorterminal
|
||
msgctxt "ulng.rsoptionseditorterminal"
|
||
msgid "Terminal"
|
||
msgstr "Terminal"
|
||
|
||
#: ulng.rsoptionseditortoolbar
|
||
msgid "Toolbar"
|
||
msgstr "Barre d'outils"
|
||
|
||
#: ulng.rsoptionseditortools
|
||
msgctxt "ulng.rsoptionseditortools"
|
||
msgid "Tools"
|
||
msgstr "Outils"
|
||
|
||
#: ulng.rsoptionseditortooltips
|
||
msgctxt "ulng.rsoptionseditortooltips"
|
||
msgid "Tooltips"
|
||
msgstr "Infobulles"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenu
|
||
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
||
msgid "Tree View Menu"
|
||
msgstr "Menu en arbre"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenucolors
|
||
msgid "Tree View Menu Colors"
|
||
msgstr "Couleur menu arbre"
|
||
|
||
#: ulng.rsoptletters
|
||
msgid "None;Command Line;Quick Search;Quick Filter"
|
||
msgstr "Aucun;Ligne de commande;Recherche rapide;Filtre rapide"
|
||
|
||
#: ulng.rsoptmouseselectionbutton
|
||
msgid "Left button;Right button;"
|
||
msgstr "Bouton gauche; Bouton droit;"
|
||
|
||
#: ulng.rsoptnewfilesposition
|
||
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
||
msgstr "en premier de la liste de fichiers;après les dossiers (si les dossiers sont triés avant les fichiers);à la position selon le tri;à la fin de la liste de fichiers"
|
||
|
||
#: ulng.rsoptpluginalreadyassigned
|
||
msgid "Plugin %s is already assigned for the following extensions:"
|
||
msgstr "Le \"plugin\" %s est déjà enregistré pour les extensions suivantes :"
|
||
|
||
#: ulng.rsoptpluginsactive
|
||
msgctxt "ulng.rsoptpluginsactive"
|
||
msgid "Active"
|
||
msgstr "Actif"
|
||
|
||
#: ulng.rsoptpluginsfilename
|
||
msgctxt "ulng.rsoptpluginsfilename"
|
||
msgid "File name"
|
||
msgstr "Nom de fichier"
|
||
|
||
#: ulng.rsoptpluginsname
|
||
msgctxt "ulng.rsoptpluginsname"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: ulng.rsoptpluginsregisteredfor
|
||
msgctxt "ulng.rsoptpluginsregisteredfor"
|
||
msgid "Registered for"
|
||
msgstr "Enregistré pour"
|
||
|
||
#: ulng.rsoptsearchcase
|
||
msgid "&Sensitive;&Insensitive"
|
||
msgstr "Sensible;Insensible"
|
||
|
||
#: ulng.rsoptsearchitems
|
||
msgid "&Files;Di&rectories;Files a&nd Directories"
|
||
msgstr "Fichiers;Dossiers;Fichiers et Dossiers"
|
||
|
||
#: ulng.rsoptsearchopt
|
||
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
||
msgstr "Cacher le panneau de filtre s'il n'est pas actif;conserver ces options pour les prochaines sessions"
|
||
|
||
#: ulng.rsoptsortcasesens
|
||
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
||
msgstr "non sensible à la casse;selon paramètres régionaux (aAbBcC);Première en majuscule, le reste en minuscule (ABCabc)"
|
||
|
||
#: ulng.rsoptsortfoldermode
|
||
msgid "sort by name and show first;sort like files and show first;sort like files"
|
||
msgstr "trier par nom et montrer en premier;trier comme les fichiers et montrer en premier;trier comme les fichiers"
|
||
|
||
#: ulng.rsoptsortmethod
|
||
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
||
msgstr "Alphabétique avec prise en considération des accents;Tri naturel alphanumérique (lettres et chiffres)"
|
||
|
||
#: ulng.rsopttabsposition
|
||
msgid "Top;Bottom;"
|
||
msgstr "Haut;Bas;"
|
||
|
||
#: ulng.rsopttoolbarbuttontype
|
||
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
||
msgstr "Séparateur;Commande interne;Commande externe;Menu"
|
||
|
||
#: ulng.rsopttypeofduplicatedrename
|
||
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
||
msgstr "DC classique - Copy (x) nom_de_fichier.ext;Windows - nom_de_fichier (x).ext;Autre - nom_de_fichier(x).ext"
|
||
|
||
#: ulng.rsoptupdatedfilesposition
|
||
msgid "don't change position;use the same setting as for new files;to sorted position"
|
||
msgstr "ne change pas de position;utilise les mêmes option que pour les nouveaux fichiers;à l'endroit normal du tri en cours"
|
||
|
||
#: ulng.rspropscontains
|
||
msgid "Files: %d, folders: %d"
|
||
msgstr "Fichiers : %d, Dossiers : %d"
|
||
|
||
#: ulng.rspropserrchmod
|
||
msgid "Can not change access rights for \"%s\""
|
||
msgstr "Impossible de changer les droits pour \"%s\""
|
||
|
||
#: ulng.rspropserrchown
|
||
msgid "Can not change owner for \"%s\""
|
||
msgstr "Impossible de changer le propriétaire pour \"%s\""
|
||
|
||
#: ulng.rspropsfile
|
||
msgctxt "ulng.rspropsfile"
|
||
msgid "File"
|
||
msgstr "Fichier"
|
||
|
||
#: ulng.rspropsfolder
|
||
msgctxt "ulng.rspropsfolder"
|
||
msgid "Directory"
|
||
msgstr "Dossier"
|
||
|
||
#: ulng.rspropsnmdpipe
|
||
msgid "Named pipe"
|
||
msgstr "Tube nommé"
|
||
|
||
#: ulng.rspropssocket
|
||
msgid "Socket"
|
||
msgstr "Socket"
|
||
|
||
#: ulng.rspropsspblkdev
|
||
msgid "Special block device"
|
||
msgstr "Périphérique spécial bloc"
|
||
|
||
#: ulng.rspropsspchrdev
|
||
msgid "Special character device"
|
||
msgstr "Périphérique spécial caractères"
|
||
|
||
#: ulng.rspropssymlink
|
||
msgid "Symbolic link"
|
||
msgstr "Lien symbolique"
|
||
|
||
#: ulng.rspropsunknowntype
|
||
msgid "Unknown type"
|
||
msgstr "Type inconnu"
|
||
|
||
#: ulng.rssearchresult
|
||
msgid "Search result"
|
||
msgstr "Résultat de la recherche"
|
||
|
||
#: ulng.rssearchstatus
|
||
msgid "SEARCH"
|
||
msgstr "RECHERCHE"
|
||
|
||
#: ulng.rssearchtemplateunnamed
|
||
msgid "<unnamed template>"
|
||
msgstr "<modèle sans nom>"
|
||
|
||
#: ulng.rssearchwithdsxplugininprogress
|
||
msgid ""
|
||
"A file search using DSX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Une recherche de fichiers avec un plugin DSX est déjà en cours.\n"
|
||
"Nous devons attendre qu'elle soit complété avant dans lancer une nouvelle .\n"
|
||
|
||
#: ulng.rssearchwithwdxplugininprogress
|
||
msgid ""
|
||
"A file search using WDX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Une recherche de fichiers avec un plugin WDX est déjà en cours.\n"
|
||
"Nous devons attendre qu'elle soit complété avant dans lancer une nouvelle .\n"
|
||
|
||
#: ulng.rsselectdir
|
||
msgid "Select a directory"
|
||
msgstr "Sélectionner un dossier"
|
||
|
||
#: ulng.rsselectyoufindfileswindow
|
||
msgid "Select your window"
|
||
msgstr "Choisissez"
|
||
|
||
#: ulng.rsshowhelpfor
|
||
msgid "&Show help for %s"
|
||
msgstr "Affiche de l'aide pour %s"
|
||
|
||
#: ulng.rssimplewordall
|
||
msgctxt "ulng.rssimplewordall"
|
||
msgid "All"
|
||
msgstr "Tous"
|
||
|
||
#: ulng.rssimplewordcategory
|
||
msgctxt "ulng.rssimplewordcategory"
|
||
msgid "Category"
|
||
msgstr "Catégorie"
|
||
|
||
#: ulng.rssimplewordcolumnsingular
|
||
msgid "Column"
|
||
msgstr "Colonne"
|
||
|
||
#: ulng.rssimplewordcommand
|
||
msgctxt "ulng.rssimplewordcommand"
|
||
msgid "Command"
|
||
msgstr "Commande"
|
||
|
||
#: ulng.rssimplewordfilename
|
||
msgid "Filename"
|
||
msgstr "Nom de fichier"
|
||
|
||
#: ulng.rssimplewordfiles
|
||
msgid "files"
|
||
msgstr "fichiers"
|
||
|
||
#: ulng.rssimplewordletter
|
||
msgid "Letter"
|
||
msgstr "Lettre"
|
||
|
||
#: ulng.rssimplewordparameter
|
||
msgid "Param"
|
||
msgstr "Paramètre"
|
||
|
||
#: ulng.rssimplewordresult
|
||
msgid "Result"
|
||
msgstr "Résultat"
|
||
|
||
#: ulng.rssimplewordworkdir
|
||
msgid "WorkDir"
|
||
msgstr "Dossier de travail"
|
||
|
||
#: ulng.rssizeunitbytes
|
||
msgid "Bytes"
|
||
msgstr "Octets"
|
||
|
||
#: ulng.rssizeunitgbytes
|
||
msgctxt "ulng.rssizeunitgbytes"
|
||
msgid "Gigabytes"
|
||
msgstr "Gigaoctets"
|
||
|
||
#: ulng.rssizeunitkbytes
|
||
msgctxt "ulng.rssizeunitkbytes"
|
||
msgid "Kilobytes"
|
||
msgstr "Kilooctets"
|
||
|
||
#: ulng.rssizeunitmbytes
|
||
msgctxt "ulng.rssizeunitmbytes"
|
||
msgid "Megabytes"
|
||
msgstr "Mégaoctets"
|
||
|
||
#: ulng.rssizeunittbytes
|
||
msgid "Terabytes"
|
||
msgstr "Téraoctets"
|
||
|
||
#: ulng.rsspacemsg
|
||
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
||
msgstr "Fichiers : %d, Dossiers : %d, Taille : %s (%s octets)"
|
||
|
||
#: ulng.rsspliterrdirectory
|
||
msgid "Unable to create target directory!"
|
||
msgstr "Impossible de créer le dossier cible !"
|
||
|
||
#: ulng.rsspliterrfilesize
|
||
msgid "Incorrect file size format!"
|
||
msgstr "Format de fichier incorrect !"
|
||
|
||
#: ulng.rsspliterrsplitfile
|
||
msgid "Unable to split the file!"
|
||
msgstr "Impossible de scinder le fichier !"
|
||
|
||
#: ulng.rssplitmsgmanyparts
|
||
msgid "The number of parts is more than 100! Continue?"
|
||
msgstr "Le nombre de partie est supérieur à 100 ! Continuer ?"
|
||
|
||
#: ulng.rssplitpredefinedsizes
|
||
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
msgstr "Automatique;1457664B - 3.5\" Haute densité 1.44M;1213952B - 5.25\" Haute densité 1.2M;730112B - 3.5\" Double densité 720K;362496B - 5.25\" Double densité 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
|
||
#: ulng.rssplitseldir
|
||
msgid "Select directory:"
|
||
msgstr "Sélectionner un dossier :"
|
||
|
||
#: ulng.rsstraccents
|
||
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;#195€;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
|
||
#: ulng.rsstraccentsstripped
|
||
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
|
||
#: ulng.rsstrpreviewjustpreview
|
||
msgid "Just preview"
|
||
msgstr "Simplement un avant-goût"
|
||
|
||
#: ulng.rsstrpreviewothers
|
||
msgid "Others"
|
||
msgstr "Autres"
|
||
|
||
#: ulng.rsstrpreviewsearchingletters
|
||
msgid "OU"
|
||
msgstr "EU"
|
||
|
||
#: ulng.rsstrpreviewsidenote
|
||
msgid "Side note"
|
||
msgstr "Texte secondaire"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched1
|
||
msgid "Flat"
|
||
msgstr "Plat"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched2
|
||
msgid "Limited"
|
||
msgstr "Limité"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched3
|
||
msgid "Simple"
|
||
msgstr "Simpliste"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched1
|
||
msgid "Fabulous"
|
||
msgstr "Fabuleux"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched2
|
||
msgid "Marvelous"
|
||
msgstr "Merveilleux"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched3
|
||
msgid "Tremendous"
|
||
msgstr "Prodigieux"
|
||
|
||
#: ulng.rsstrtvmchoosedirhistory
|
||
msgid "Choose your directory from Dir History"
|
||
msgstr "Choisissez votre dossier dans l'historique"
|
||
|
||
#: ulng.rsstrtvmchoosefavoritetabs
|
||
msgid "Choose you Favorite Tabs:"
|
||
msgstr "Choisissez votre groupe d'onglets favoris :"
|
||
|
||
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
||
msgid "Choose your command from Command Line History"
|
||
msgstr "Choisissez votre commande de l'historique des commandes"
|
||
|
||
#: ulng.rsstrtvmchoosefrommainmenu
|
||
msgid "Choose your action from Main Menu"
|
||
msgstr "Choisissez votre action du menu principal"
|
||
|
||
#: ulng.rsstrtvmchoosefromtoolbar
|
||
msgid "Choose your action from Maintool bar"
|
||
msgstr "Choisissez votre action de la barre d'outil principale"
|
||
|
||
#: ulng.rsstrtvmchoosehotdirectory
|
||
msgid "Choose your directory from Hot Directory:"
|
||
msgstr "Choisissez votre répertoire de la liste des répertoires favoris"
|
||
|
||
#: ulng.rsstrtvmchooseviewhistory
|
||
msgid "Choose your directory from File View History"
|
||
msgstr "Choisissez votre dossier dans l'historique selon cette vue"
|
||
|
||
#: ulng.rsstrtvmchooseyourfileordir
|
||
msgid "Choose your file or your directory"
|
||
msgstr "Choisissez votre fichier ou votre dossier"
|
||
|
||
#: ulng.rssymerrcreate
|
||
msgid "Error creating symlink."
|
||
msgstr "Erreur à la création du lien symbolique."
|
||
|
||
#: ulng.rssyndefaulttext
|
||
msgctxt "ulng.rssyndefaulttext"
|
||
msgid "Default text"
|
||
msgstr "Texte par défaut :"
|
||
|
||
#: ulng.rssynlangplaintext
|
||
msgctxt "ulng.rssynlangplaintext"
|
||
msgid "Plain text"
|
||
msgstr "Texte simple"
|
||
|
||
#: ulng.rstabsactionondoubleclickchoices
|
||
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
||
msgstr "Ne fait rien;Ferme l'onglet;Accéder aux groupes d'onglets favoris;Le menu des onglets"
|
||
|
||
#: ulng.rstimeunitday
|
||
msgctxt "ulng.rstimeunitday"
|
||
msgid "Day(s)"
|
||
msgstr "Jour(s)"
|
||
|
||
#: ulng.rstimeunithour
|
||
msgid "Hour(s)"
|
||
msgstr "Heure(s)"
|
||
|
||
#: ulng.rstimeunitminute
|
||
msgid "Minute(s)"
|
||
msgstr "Minute(s)"
|
||
|
||
#: ulng.rstimeunitmonth
|
||
msgid "Month(s)"
|
||
msgstr "Mois"
|
||
|
||
#: ulng.rstimeunitsecond
|
||
msgid "Second(s)"
|
||
msgstr "Seconde(s)"
|
||
|
||
#: ulng.rstimeunitweek
|
||
msgid "Week(s)"
|
||
msgstr "Semaine(s)"
|
||
|
||
#: ulng.rstimeunityear
|
||
msgid "Year(s)"
|
||
msgstr "Année(s)"
|
||
|
||
#: ulng.rstitlerenamefavtabs
|
||
msgid "Rename Favorite Tabs"
|
||
msgstr "Renomme l'onglet favori"
|
||
|
||
#: ulng.rstitlerenamefavtabsmenu
|
||
msgid "Rename Favorite Tabs sub-menu"
|
||
msgstr "Renomme le sous-menu"
|
||
|
||
#: ulng.rstooldiffer
|
||
msgctxt "ulng.rstooldiffer"
|
||
msgid "Differ"
|
||
msgstr "Différences"
|
||
|
||
#: ulng.rstooleditor
|
||
msgctxt "ulng.rstooleditor"
|
||
msgid "Editor"
|
||
msgstr "Éditeur"
|
||
|
||
#: ulng.rstoolerroropeningdiffer
|
||
msgid "Error opening differ"
|
||
msgstr "Erreur d'ouverture de l'outil comparateur"
|
||
|
||
#: ulng.rstoolerroropeningeditor
|
||
msgid "Error opening editor"
|
||
msgstr "Erreur de lancement de l'éditeur"
|
||
|
||
#: ulng.rstoolerroropeningterminal
|
||
msgid "Error opening terminal"
|
||
msgstr "Erreur de lancement du terminal"
|
||
|
||
#: ulng.rstoolerroropeningviewer
|
||
msgid "Error opening viewer"
|
||
msgstr "Erreur de lancement de la visionneuse"
|
||
|
||
#: ulng.rstoolterminal
|
||
msgctxt "ulng.rstoolterminal"
|
||
msgid "Terminal"
|
||
msgstr "Terminal"
|
||
|
||
#: ulng.rstoolviewer
|
||
msgctxt "ulng.rstoolviewer"
|
||
msgid "Viewer"
|
||
msgstr "Visionneuse"
|
||
|
||
#: ulng.rsunhandledexceptionmessage
|
||
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
||
msgstr "Merci de rapporter cette erreur sur le \"bug tracker\" avec une description de ce que vous étiez en train de faire ainsi que le fichier suivant : %sCliquez %s pour continuer ou %s pour quitter le programme."
|
||
|
||
#: ulng.rsvarbothpanelactivetoinactive
|
||
msgid "Both panels, from active to inactive"
|
||
msgstr "Les deux panneaux, de l'actif à l'inactif"
|
||
|
||
#: ulng.rsvarbothpanellefttoright
|
||
msgid "Both panels, from left to right"
|
||
msgstr "Les deux panneaux, de gauche à droite"
|
||
|
||
#: ulng.rsvarcurrentpath
|
||
msgid "Path of panel"
|
||
msgstr "Chemin du panneau"
|
||
|
||
#: ulng.rsvarencloseelement
|
||
msgid "Enclose each name in brackets or what you want"
|
||
msgstr "Isole chaque nom entre crochers ou ce que vous voulez"
|
||
|
||
#: ulng.rsvarfilenamenoext
|
||
msgid "Just filename, no extension"
|
||
msgstr "Simplement le nom du fichier, sans extension"
|
||
|
||
#: ulng.rsvarfullpath
|
||
msgid "Complete filename (path+filename)"
|
||
msgstr "Nom de fichier complet (chemin+nom de fichier)"
|
||
|
||
#: ulng.rsvarhelpwith
|
||
msgid "Help with \"%\" variables"
|
||
msgstr "Aide avec les variables \"%\""
|
||
|
||
#: ulng.rsvarinputparam
|
||
msgid "Will request request user to enter a parameter with a default suggested value"
|
||
msgstr "Va demander à l'utilisateur d'entre un paramètre avec une valeur par défaut suggérée"
|
||
|
||
#: ulng.rsvarleftpanel
|
||
msgid "Left panel"
|
||
msgstr "Panneau de gauche"
|
||
|
||
#: ulng.rsvarlistfilename
|
||
msgid "Temporary filename of list of filenames"
|
||
msgstr "Nom de fichier temporaire de la liste des noms de fichiers"
|
||
|
||
#: ulng.rsvarlistfullfilename
|
||
msgid "Temporary filename of list of complete filenames (path+filename)"
|
||
msgstr "Nom de fichier temporaire de la liste des noms complets de fichier (chemin+nom de fichier)"
|
||
|
||
#: ulng.rsvarlistinutf16
|
||
msgid "Filenames in list in UTF-16 with BOM"
|
||
msgstr "Liste de fichiers en UTF-16"
|
||
|
||
#: ulng.rsvarlistinutf16quoted
|
||
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
||
msgstr "Liste de fichiers en UTF-16 avec BOM, entre guillemets"
|
||
|
||
#: ulng.rsvarlistinutf8
|
||
msgid "Filenames in list in UTF-8"
|
||
msgstr "Liste de fichiers en UTF-8"
|
||
|
||
#: ulng.rsvarlistinutf8quoted
|
||
msgid "Filenames in list in UTF-8, inside double quotes"
|
||
msgstr "Liste de fichiers en UTF-8, entre guillemets"
|
||
|
||
#: ulng.rsvarlistrelativefilename
|
||
msgid "Temporary filename of list of filenames with relative path"
|
||
msgstr "Nom de fichier temporaire de la liste des noms de fichiers avec chemins relatifs"
|
||
|
||
#: ulng.rsvaronlyextension
|
||
msgid "Only file extension"
|
||
msgstr "Seulement extension de fichier"
|
||
|
||
#: ulng.rsvaronlyfilename
|
||
msgid "Only filename"
|
||
msgstr "Seulement nom de fichier"
|
||
|
||
#: ulng.rsvarotherexamples
|
||
msgid "Other example of what's possible"
|
||
msgstr "Autres exemples de ce qui est possible"
|
||
|
||
#: ulng.rsvarpath
|
||
msgid "Path, with ending delimiter"
|
||
msgstr "Chemin, avec le séparateur de dossier à la fin"
|
||
|
||
#: ulng.rsvarpercentchangetopound
|
||
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
||
msgstr "À partir d'ici jusqu'à la fin de la ligne, la variable-pourcent est indiquer par le symbole \"#\""
|
||
|
||
#: ulng.rsvarpercentsign
|
||
msgid "Return the percent sign"
|
||
msgstr "Retourne le signe de pourcentage"
|
||
|
||
#: ulng.rsvarpoundchangetopercent
|
||
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
||
msgstr "À partir d'ici jusqu'à la fin de la ligne, la variable-pourcent est de retour indiquer par le symbole \"%\""
|
||
|
||
#: ulng.rsvarprependelement
|
||
msgid "Prepend each name with \"-a \" or what you want"
|
||
msgstr "Faire précéder chaque nom avec \"-a\" ou ce que vous désirez"
|
||
|
||
#: ulng.rsvarpromptuserforparam
|
||
msgid "%[Prompt user for param;Default value proposed]"
|
||
msgstr "%[Interroge l'usager pour un paramètre;La valeur par défaut proposée]"
|
||
|
||
#: ulng.rsvarrelativepathandfilename
|
||
msgid "Filename with relative path"
|
||
msgstr "Nom de fichier avec chemin relatif"
|
||
|
||
#: ulng.rsvarrightpanel
|
||
msgid "Right panel"
|
||
msgstr "Panneau droit"
|
||
|
||
#: ulng.rsvarsecondelementrightpanel
|
||
msgid "Full path of second selected file in right panel"
|
||
msgstr "Le chemin cmplet du second fichier sélectionné dans le panneau de droite"
|
||
|
||
#: ulng.rsvarshowcommandprior
|
||
msgid "Show command prior execute"
|
||
msgstr "Montre la commande avant de l'exécuter"
|
||
|
||
#: ulng.rsvarsimplemessage
|
||
msgid "%[Simple message]"
|
||
msgstr "%[Simplement un message]"
|
||
|
||
#: ulng.rsvarsimpleshowmessage
|
||
msgid "Will show a simple message"
|
||
msgstr "Va afficher un message simplement"
|
||
|
||
#: ulng.rsvarsourcepanel
|
||
msgid "Active panel (source)"
|
||
msgstr "Panneau actif (source)"
|
||
|
||
#: ulng.rsvartargetpanel
|
||
msgid "Inactive panel (target)"
|
||
msgstr "Panneau inactif"
|
||
|
||
#: ulng.rsvarwillbequoted
|
||
msgid "Filenames will be quoted from here (default)"
|
||
msgstr "Les noms de fichiers seront mis entre guillemets à partir d'ici (défaut)"
|
||
|
||
#: ulng.rsvarwilldointerminal
|
||
msgid "Command will be done in terminal, remaining opened at the end"
|
||
msgstr "La commande sera faite en mode terminal qui demeurera ouver à la fin."
|
||
|
||
#: ulng.rsvarwillhaveendingdelimiter
|
||
msgid "Paths will have ending delimiter"
|
||
msgstr "Les chemins auront un séparateur de dossier à la fin"
|
||
|
||
#: ulng.rsvarwillnotbequoted
|
||
msgid "Filenames will not be quoted from here"
|
||
msgstr "Les noms de fichiers ne seront pas mis entre guillemets à partir d'ici"
|
||
|
||
#: ulng.rsvarwillnotdointerminal
|
||
msgid "Command will be done in terminal, closed at the end"
|
||
msgstr "La commande sera faite en mode terminal qui sera fermé à la fin"
|
||
|
||
#: ulng.rsvarwillnothaveendingdelimiter
|
||
msgid "Paths will not have ending delimiter (default)"
|
||
msgstr "Les chemins n'auront pas de séparateur de dossier à la fin (défaut)"
|
||
|
||
#: ulng.rsvfsnetwork
|
||
msgctxt "ulng.rsvfsnetwork"
|
||
msgid "Network"
|
||
msgstr "Réseau"
|
||
|
||
#: ulng.rsviewabouttext
|
||
msgid "Internal Viewer of Double Commander."
|
||
msgstr "Visionneuse interne de Double Commander."
|
||
|
||
#: ulng.rsviewbadquality
|
||
msgid "Bad Quality"
|
||
msgstr "Maubaise qualité"
|
||
|
||
#: ulng.rsviewencoding
|
||
msgctxt "ulng.rsviewencoding"
|
||
msgid "Encoding"
|
||
msgstr "Encodage"
|
||
|
||
#: ulng.rsviewimagetype
|
||
msgid "Image Type"
|
||
msgstr "Type d'image"
|
||
|
||
#: ulng.rsviewnewsize
|
||
msgctxt "ulng.rsviewnewsize"
|
||
msgid "New Size"
|
||
msgstr "Nouvelle Taille"
|
||
|
||
#: ulng.rsviewnotfound
|
||
msgid "%s not found!"
|
||
msgstr "%s introuvable !"
|
||
|
||
#: ulng.rsviewwithexternalviewer
|
||
msgid "with external viewer"
|
||
msgstr "avec une visionneuse externe"
|
||
|
||
#: ulng.rsviewwithinternalviewer
|
||
msgid "with internal viewer"
|
||
msgstr "avec la visionneuse interne"
|
||
|
||
#: ulng.rsxreplacements
|
||
msgid "Number of replacement: %d"
|
||
msgstr "Nombre de remplacements : %d"
|
||
|
||
#: ulng.rszeroreplacement
|
||
msgid "No replacement took place."
|
||
msgstr "Aucun remplacement n'a eu lieu."
|
||
|