mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-21 09:58:13 +00:00
11952 lines
325 KiB
Text
11952 lines
325 KiB
Text
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: Double Commander 0.8.0 alpha\n"
|
||
"Report-Msgid-Bugs-To: \n"
|
||
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
|
||
"PO-Revision-Date: 2016-12-09 07:50+0200\n"
|
||
"Last-Translator: Maciej Bojakowski <maciejbojakowski@gmail.com>\n"
|
||
"Language-Team: \n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Native-Language: Polski\n"
|
||
|
||
#: fsyncdirsdlg.rscomparingpercent
|
||
msgid "Comparing... %d%% (ESC to cancel)"
|
||
msgstr "Porównywanie... %d%% (ESC, aby anulować)"
|
||
|
||
#: fsyncdirsdlg.rsdeleteright
|
||
msgid "Right: Delete %d file(s)"
|
||
msgstr "Prawy: Usuń %d plik(ów)"
|
||
|
||
#: fsyncdirsdlg.rsfilesfound
|
||
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
||
msgstr "Znaleziono plików: %d (Identycznych: %d, Różnych: %d, Unikalnych po lewej: %d, Unikalnych po prawej: %d)"
|
||
|
||
#: fsyncdirsdlg.rslefttorightcopy
|
||
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
||
msgstr "Z lewej do prawej: Kopiowanie %d plików, całkowity rozmiar: %d bajtów"
|
||
|
||
#: fsyncdirsdlg.rsrighttoleftcopy
|
||
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
||
msgstr "Z prawej do lewej: Kopiowanie %d plików, całkowity rozmiar: %d bajtów"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
||
msgid "Choose template..."
|
||
msgstr "Wybierz szablon..."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
||
msgid "C&heck free space"
|
||
msgstr "Sprawdź wolne miejsce"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
||
msgid "Cop&y attributes"
|
||
msgstr "K&opiuj atrybuty"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
||
msgid "Copy o&wnership"
|
||
msgstr "Kopiuj własność"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
||
msgid "Copy &permissions"
|
||
msgstr "Kopiuj u&prawnienia"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Kopiuj d&atę/czas"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
||
msgid "Correct lin&ks"
|
||
msgstr "Popraw lin&ki"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
||
msgid "Drop readonly fla&g"
|
||
msgstr "Zdejmij flagę \"Tylko do odczytu\""
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
||
msgid "E&xclude empty directories"
|
||
msgstr "Usuń puste katalogi"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
||
msgid "Fo&llow links"
|
||
msgstr "Idź za linkami"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
||
msgid "&Reserve space"
|
||
msgstr "Za&rezerwuj miejsce"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
||
msgid "&Verify"
|
||
msgstr "&Weryfikuj"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
||
msgid "What to do when cannot set file time, attributes, etc."
|
||
msgstr "Co zrobić, gdy nie można ustawić czasu pliku, atrybutów, itp."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
||
msgid "Use file template"
|
||
msgstr "Użyj pliku szablonu"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
||
msgid "When dir&ectory exists"
|
||
msgstr "Gdy katalog istnieje"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
||
msgid "When &file exists"
|
||
msgstr "Gdy plik istnieje"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
||
msgid "When ca&nnot set property"
|
||
msgstr "Gdy nie moż&na ustawić właściwości"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
||
msgid "<no template>"
|
||
msgstr "<brak szablonu>"
|
||
|
||
#: tfrmabout.btnclose.caption
|
||
msgctxt "tfrmabout.btnclose.caption"
|
||
msgid "&Close"
|
||
msgstr "&Zamknij"
|
||
|
||
#: tfrmabout.btncopytoclipboard.caption
|
||
msgid "Copy to clipboard"
|
||
msgstr "Kopiuj do schowka"
|
||
|
||
#: tfrmabout.caption
|
||
msgctxt "tfrmabout.caption"
|
||
msgid "About"
|
||
msgstr "O programie"
|
||
|
||
#: tfrmabout.lblbuild.caption
|
||
msgctxt "tfrmabout.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Kompilacja"
|
||
|
||
#: tfrmabout.lblfreepascalver.caption
|
||
msgctxt "tfrmabout.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmabout.lblhomepage.caption
|
||
msgid "Home Page:"
|
||
msgstr "Strona domowa:"
|
||
|
||
#: tfrmabout.lblhomepageaddress.caption
|
||
msgid "http://doublecmd.sourceforge.net"
|
||
msgstr "http://doublecmd.sourceforge.net"
|
||
|
||
#: tfrmabout.lbllazarusver.caption
|
||
msgctxt "tfrmabout.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmabout.lblrevision.caption
|
||
msgctxt "tfrmabout.lblrevision.caption"
|
||
msgid "Revision"
|
||
msgstr "Wydanie"
|
||
|
||
#: tfrmabout.lbltitle.caption
|
||
msgctxt "tfrmabout.lbltitle.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmabout.lblversion.caption
|
||
msgctxt "tfrmabout.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Wersja"
|
||
|
||
#: tfrmattributesedit.btncancel.caption
|
||
msgctxt "tfrmattributesedit.btncancel.caption"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmattributesedit.btnok.caption
|
||
msgctxt "tfrmattributesedit.btnok.caption"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmattributesedit.btnreset.caption
|
||
msgid "&Reset"
|
||
msgstr "&Resetuj"
|
||
|
||
#: tfrmattributesedit.caption
|
||
msgid "Choose attributes"
|
||
msgstr "Wybierz atrybuty"
|
||
|
||
#: tfrmattributesedit.cbarchive.caption
|
||
msgid "&Archive"
|
||
msgstr "&Archiwum"
|
||
|
||
#: tfrmattributesedit.cbcompressed.caption
|
||
msgid "Co&mpressed"
|
||
msgstr "Sko&mpresowany"
|
||
|
||
#: tfrmattributesedit.cbdirectory.caption
|
||
msgid "&Directory"
|
||
msgstr "Katalog"
|
||
|
||
#: tfrmattributesedit.cbencrypted.caption
|
||
msgid "&Encrypted"
|
||
msgstr "Zaszyfrowany"
|
||
|
||
#: tfrmattributesedit.cbhidden.caption
|
||
msgid "&Hidden"
|
||
msgstr "Ukryty"
|
||
|
||
#: tfrmattributesedit.cbreadonly.caption
|
||
msgid "Read o&nly"
|
||
msgstr "Tylko do odczytu"
|
||
|
||
#: tfrmattributesedit.cbsgid.caption
|
||
msgctxt "tfrmattributesedit.cbsgid.caption"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmattributesedit.cbsparse.caption
|
||
msgid "S&parse"
|
||
msgstr "Rzadki"
|
||
|
||
#: tfrmattributesedit.cbsticky.caption
|
||
msgctxt "tfrmattributesedit.cbsticky.caption"
|
||
msgid "Sticky"
|
||
msgstr "Przyklejony"
|
||
|
||
#: tfrmattributesedit.cbsuid.caption
|
||
msgctxt "tfrmattributesedit.cbsuid.caption"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmattributesedit.cbsymlink.caption
|
||
msgid "&Symlink"
|
||
msgstr "Link symboliczny"
|
||
|
||
#: tfrmattributesedit.cbsystem.caption
|
||
msgid "S&ystem"
|
||
msgstr "S&ystemowy"
|
||
|
||
#: tfrmattributesedit.cbtemporary.caption
|
||
msgid "&Temporary"
|
||
msgstr "&Tymczasowy"
|
||
|
||
#: tfrmattributesedit.gbntfsattributes.caption
|
||
msgid "NTFS attributes"
|
||
msgstr "Atrybuty NTFS"
|
||
|
||
#: tfrmattributesedit.gbwingeneral.caption
|
||
msgid "General attributes"
|
||
msgstr "Atrybuty ogólne"
|
||
|
||
#: tfrmattributesedit.lblattrbitsstr.caption
|
||
msgctxt "tfrmattributesedit.lblattrbitsstr.caption"
|
||
msgid "Bits:"
|
||
msgstr "Bity:"
|
||
|
||
#: tfrmattributesedit.lblattrgroupstr.caption
|
||
msgctxt "tfrmattributesedit.lblattrgroupstr.caption"
|
||
msgid "Group"
|
||
msgstr "Grupa"
|
||
|
||
#: tfrmattributesedit.lblattrotherstr.caption
|
||
msgctxt "tfrmattributesedit.lblattrotherstr.caption"
|
||
msgid "Other"
|
||
msgstr "Inne"
|
||
|
||
#: tfrmattributesedit.lblattrownerstr.caption
|
||
msgctxt "tfrmattributesedit.lblattrownerstr.caption"
|
||
msgid "Owner"
|
||
msgstr "Właściciel"
|
||
|
||
#: tfrmattributesedit.lblexec.caption
|
||
msgctxt "tfrmattributesedit.lblexec.caption"
|
||
msgid "Execute"
|
||
msgstr "Uruchom"
|
||
|
||
#: tfrmattributesedit.lblread.caption
|
||
msgctxt "tfrmattributesedit.lblread.caption"
|
||
msgid "Read"
|
||
msgstr "Odczyt"
|
||
|
||
#: tfrmattributesedit.lbltextattrs.caption
|
||
msgid "As te&xt:"
|
||
msgstr "Jako tekst:"
|
||
|
||
#: tfrmattributesedit.lblwrite.caption
|
||
msgctxt "tfrmattributesedit.lblwrite.caption"
|
||
msgid "Write"
|
||
msgstr "Zapis"
|
||
|
||
#: tfrmchecksumcalc.caption
|
||
msgctxt "tfrmchecksumcalc.caption"
|
||
msgid "Calculate checksum..."
|
||
msgstr "Oblicz sumę kontrolną..."
|
||
|
||
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
||
msgid "Open checksum file after job is completed"
|
||
msgstr "Otwórz plik sumy kontrolnej po zakończeniu pracy"
|
||
|
||
#: tfrmchecksumcalc.cbseparatefile.caption
|
||
msgid "C&reate separate checksum file for each file"
|
||
msgstr "Dla każdego pliku utwó&rz oddzielny plik sumy kontrolnej"
|
||
|
||
#: tfrmchecksumcalc.lblsaveto.caption
|
||
msgid "&Save checksum file(s) to:"
|
||
msgstr "Zapi&sz plik(i) sumy kontrolnej do:"
|
||
|
||
#: tfrmchecksumverify.btnclose.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zamknij"
|
||
|
||
#: tfrmchecksumverify.caption
|
||
msgctxt "tfrmchecksumverify.caption"
|
||
msgid "Verify checksum..."
|
||
msgstr "Sprawdź sumę kontrolną..."
|
||
|
||
#: tfrmconnectionmanager.btnadd.caption
|
||
msgctxt "tfrmconnectionmanager.btnadd.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmconnectionmanager.btncancel.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmconnectionmanager.btnconnect.caption
|
||
msgid "C&onnect"
|
||
msgstr "P&ołącz"
|
||
|
||
#: tfrmconnectionmanager.btndelete.caption
|
||
msgctxt "tfrmconnectionmanager.btndelete.caption"
|
||
msgid "&Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmconnectionmanager.btnedit.caption
|
||
msgctxt "tfrmconnectionmanager.btnedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "&Edytuj"
|
||
|
||
#: tfrmconnectionmanager.caption
|
||
msgid "Connection manager"
|
||
msgstr "Menedżer połączeń"
|
||
|
||
#: tfrmconnectionmanager.gbconnectto.caption
|
||
msgid "Connect to:"
|
||
msgstr "Połącz z:"
|
||
|
||
#: tfrmcopydlg.btnaddtoqueue.caption
|
||
msgid "A&dd To Queue"
|
||
msgstr "Dodaj do kolejki"
|
||
|
||
#: tfrmcopydlg.btncancel.caption
|
||
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmcopydlg.btnoptions.caption
|
||
msgid "O&ptions"
|
||
msgstr "O&pcje"
|
||
|
||
#: tfrmcopydlg.btnsaveoptions.caption
|
||
msgid "Sa&ve these options as default"
|
||
msgstr "Zapisz te opcje jako domyślne"
|
||
|
||
#: tfrmcopydlg.caption
|
||
msgctxt "tfrmcopydlg.caption"
|
||
msgid "Copy file(s)"
|
||
msgstr "Kopiuj plik(i)"
|
||
|
||
#: tfrmcopydlg.mnunewqueue.caption
|
||
msgid "New queue"
|
||
msgstr "Nowa kolejka"
|
||
|
||
#: tfrmcopydlg.mnuqueue1.caption
|
||
msgid "Queue 1"
|
||
msgstr "Kolejka 1"
|
||
|
||
#: tfrmcopydlg.mnuqueue2.caption
|
||
msgid "Queue 2"
|
||
msgstr "Kolejka 2"
|
||
|
||
#: tfrmcopydlg.mnuqueue3.caption
|
||
msgid "Queue 3"
|
||
msgstr "Kolejka 3"
|
||
|
||
#: tfrmcopydlg.mnuqueue4.caption
|
||
msgid "Queue 4"
|
||
msgstr "Kolejka 4"
|
||
|
||
#: tfrmcopydlg.mnuqueue5.caption
|
||
msgid "Queue 5"
|
||
msgstr "Kolejka 5"
|
||
|
||
#: tfrmdescredit.actsavedescription.caption
|
||
msgid "Save Description"
|
||
msgstr "Zapisz opis"
|
||
|
||
#: tfrmdescredit.btncancel.caption
|
||
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmdescredit.btnok.caption
|
||
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmdescredit.caption
|
||
msgid "File/folder comment"
|
||
msgstr "Komentarz do pliku/katalogu"
|
||
|
||
#: tfrmdescredit.lbleditcommentfor.caption
|
||
msgid "E&dit comment for:"
|
||
msgstr "E&dytuj komentarz dla:"
|
||
|
||
#: tfrmdescredit.lblencoding.caption
|
||
msgid "&Encoding:"
|
||
msgstr "Kodowani&e:"
|
||
|
||
#: tfrmdescredit.lblfilename.caption
|
||
msgctxt "tfrmdescredit.lblfilename.caption"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmdiffer.actabout.caption
|
||
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "O programie"
|
||
|
||
#: tfrmdiffer.actautocompare.caption
|
||
msgid "Auto Compare"
|
||
msgstr "Porównaj automatycznie"
|
||
|
||
#: tfrmdiffer.actbinarycompare.caption
|
||
msgid "Binary Mode"
|
||
msgstr "Tryb binarny"
|
||
|
||
#: tfrmdiffer.actcancelcompare.caption
|
||
msgctxt "tfrmdiffer.actcancelcompare.caption"
|
||
msgid "Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmdiffer.actcancelcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
||
msgid "Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.caption
|
||
msgctxt "tfrmdiffer.actcopylefttoright.caption"
|
||
msgid "Copy Block Right"
|
||
msgstr "Kopiuj blok na prawo"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
||
msgid "Copy Block Right"
|
||
msgstr "Kopiuj blok na prawo"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.caption
|
||
msgctxt "tfrmdiffer.actcopyrighttoleft.caption"
|
||
msgid "Copy Block Left"
|
||
msgstr "Kopiuj blok na lewo"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
||
msgid "Copy Block Left"
|
||
msgstr "Kopiuj blok na lewo"
|
||
|
||
#: tfrmdiffer.acteditcopy.caption
|
||
msgctxt "tfrmdiffer.acteditcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmdiffer.acteditcut.caption
|
||
msgctxt "tfrmdiffer.acteditcut.caption"
|
||
msgid "Cut"
|
||
msgstr "Wytnij"
|
||
|
||
#: tfrmdiffer.acteditdelete.caption
|
||
msgctxt "tfrmdiffer.acteditdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmdiffer.acteditpaste.caption
|
||
msgctxt "tfrmdiffer.acteditpaste.caption"
|
||
msgid "Paste"
|
||
msgstr "Wstaw"
|
||
|
||
#: tfrmdiffer.acteditredo.caption
|
||
msgctxt "tfrmdiffer.acteditredo.caption"
|
||
msgid "Redo"
|
||
msgstr "Wykonaj ponownie"
|
||
|
||
#: tfrmdiffer.acteditselectall.caption
|
||
msgid "Select &All"
|
||
msgstr "Zaznacz &wszystko"
|
||
|
||
#: tfrmdiffer.acteditundo.caption
|
||
msgctxt "tfrmdiffer.acteditundo.caption"
|
||
msgid "Undo"
|
||
msgstr "Cofnij"
|
||
|
||
#: tfrmdiffer.actexit.caption
|
||
msgctxt "tfrmdiffer.actexit.caption"
|
||
msgid "E&xit"
|
||
msgstr "Koniec"
|
||
|
||
#: tfrmdiffer.actfirstdifference.caption
|
||
msgctxt "tfrmdiffer.actfirstdifference.caption"
|
||
msgid "First Difference"
|
||
msgstr "Pierwsza różnica"
|
||
|
||
#: tfrmdiffer.actfirstdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
|
||
msgid "First Difference"
|
||
msgstr "Pierwsza różnica"
|
||
|
||
#: tfrmdiffer.actignorecase.caption
|
||
msgid "Ignore Case"
|
||
msgstr "Ignoruj wielkość liter"
|
||
|
||
#: tfrmdiffer.actignorewhitespace.caption
|
||
msgid "Ignore Blanks"
|
||
msgstr "Ignoruj puste"
|
||
|
||
#: tfrmdiffer.actkeepscrolling.caption
|
||
msgid "Keep Scrolling"
|
||
msgstr "Kontynuuj przewijanie"
|
||
|
||
#: tfrmdiffer.actlastdifference.caption
|
||
msgctxt "tfrmdiffer.actlastdifference.caption"
|
||
msgid "Last Difference"
|
||
msgstr "Ostatnia różnica"
|
||
|
||
#: tfrmdiffer.actlastdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
|
||
msgid "Last Difference"
|
||
msgstr "Ostatnia różnica"
|
||
|
||
#: tfrmdiffer.actlinedifferences.caption
|
||
msgid "Line Differences"
|
||
msgstr "Różnice linii"
|
||
|
||
#: tfrmdiffer.actnextdifference.caption
|
||
msgctxt "tfrmdiffer.actnextdifference.caption"
|
||
msgid "Next Difference"
|
||
msgstr "Następna różnica"
|
||
|
||
#: tfrmdiffer.actnextdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
|
||
msgid "Next Difference"
|
||
msgstr "Następna różnica"
|
||
|
||
#: tfrmdiffer.actopenleft.caption
|
||
msgid "Open Left..."
|
||
msgstr "Otwórz lewy..."
|
||
|
||
#: tfrmdiffer.actopenright.caption
|
||
msgid "Open Right..."
|
||
msgstr "Otwórz prawy..."
|
||
|
||
#: tfrmdiffer.actpaintbackground.caption
|
||
msgid "Paint Background"
|
||
msgstr "Maluj tło"
|
||
|
||
#: tfrmdiffer.actprevdifference.caption
|
||
msgctxt "tfrmdiffer.actprevdifference.caption"
|
||
msgid "Previous Difference"
|
||
msgstr "Poprzednia różnica"
|
||
|
||
#: tfrmdiffer.actprevdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
|
||
msgid "Previous Difference"
|
||
msgstr "Poprzednia różnica"
|
||
|
||
#: tfrmdiffer.actreload.caption
|
||
msgid "&Reload"
|
||
msgstr "Wczytaj ponownie"
|
||
|
||
#: tfrmdiffer.actreload.hint
|
||
msgctxt "tfrmdiffer.actreload.hint"
|
||
msgid "Reload"
|
||
msgstr "Wczytaj ponownie"
|
||
|
||
#: tfrmdiffer.actsave.caption
|
||
msgctxt "tfrmdiffer.actsave.caption"
|
||
msgid "Save"
|
||
msgstr "Zapisz"
|
||
|
||
#: tfrmdiffer.actsave.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Zapisz"
|
||
|
||
#: tfrmdiffer.actsaveas.caption
|
||
msgctxt "tfrmdiffer.actsaveas.caption"
|
||
msgid "Save as..."
|
||
msgstr "Zapisz jako..."
|
||
|
||
#: tfrmdiffer.actsaveas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
||
msgid "Save as..."
|
||
msgstr "Zapisz jako..."
|
||
|
||
#: tfrmdiffer.actsaveleft.caption
|
||
msgctxt "tfrmdiffer.actsaveleft.caption"
|
||
msgid "Save Left"
|
||
msgstr "Zapisz lewy"
|
||
|
||
#: tfrmdiffer.actsaveleft.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
||
msgid "Save Left"
|
||
msgstr "Zapisz lewy"
|
||
|
||
#: tfrmdiffer.actsaveleftas.caption
|
||
msgctxt "tfrmdiffer.actsaveleftas.caption"
|
||
msgid "Save Left As..."
|
||
msgstr "Zapisz lewy jako..."
|
||
|
||
#: tfrmdiffer.actsaveleftas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
||
msgid "Save Left As..."
|
||
msgstr "Zapisz lewy jako..."
|
||
|
||
#: tfrmdiffer.actsaveright.caption
|
||
msgctxt "tfrmdiffer.actsaveright.caption"
|
||
msgid "Save Right"
|
||
msgstr "Zapisz prawy"
|
||
|
||
#: tfrmdiffer.actsaveright.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
||
msgid "Save Right"
|
||
msgstr "Zapisz prawy"
|
||
|
||
#: tfrmdiffer.actsaverightas.caption
|
||
msgctxt "tfrmdiffer.actsaverightas.caption"
|
||
msgid "Save Right As..."
|
||
msgstr "Zapisz prawy jako..."
|
||
|
||
#: tfrmdiffer.actsaverightas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
||
msgid "Save Right As..."
|
||
msgstr "Zapisz prawy jako..."
|
||
|
||
#: tfrmdiffer.actstartcompare.caption
|
||
msgctxt "tfrmdiffer.actstartcompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Porównaj"
|
||
|
||
#: tfrmdiffer.actstartcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
||
msgid "Compare"
|
||
msgstr "Porównaj"
|
||
|
||
#: tfrmdiffer.btnleftencoding.hint
|
||
msgctxt "tfrmdiffer.btnleftencoding.hint"
|
||
msgid "Encoding"
|
||
msgstr "Kodowanie"
|
||
|
||
#: tfrmdiffer.btnrightencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Kodowanie"
|
||
|
||
#: tfrmdiffer.caption
|
||
msgid "Compare files"
|
||
msgstr "Porównaj pliki"
|
||
|
||
#: tfrmdiffer.midivider1.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider10.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider2.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider3.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider4.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider5.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider6.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider7.caption
|
||
msgctxt "tfrmdiffer.midivider7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider8.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider9.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miencodingleft.caption
|
||
msgid "&Left"
|
||
msgstr "&Lewy"
|
||
|
||
#: tfrmdiffer.miencodingright.caption
|
||
msgid "&Right"
|
||
msgstr "P&rawy"
|
||
|
||
#: tfrmdiffer.miseparator1.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miseparator2.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.mnuactions.caption
|
||
msgid "&Actions"
|
||
msgstr "&Akcje"
|
||
|
||
#: tfrmdiffer.mnuedit.caption
|
||
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Edycja"
|
||
|
||
#: tfrmdiffer.mnuencoding.caption
|
||
msgctxt "tfrmdiffer.mnuencoding.caption"
|
||
msgid "En&coding"
|
||
msgstr "Kodowanie"
|
||
|
||
#: tfrmdiffer.mnufile.caption
|
||
msgctxt "tfrmdiffer.mnufile.caption"
|
||
msgid "&File"
|
||
msgstr "Plik"
|
||
|
||
#: tfrmdiffer.mnuoptions.caption
|
||
msgid "&Options"
|
||
msgstr "&Opcje"
|
||
|
||
#: tfrmedithotkey.btnaddshortcut.hint
|
||
msgid "Add new shortcut to sequence"
|
||
msgstr "Dodaj nowy skrót do sekwencji"
|
||
|
||
#: tfrmedithotkey.btncancel.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Anuluj"
|
||
|
||
#: tfrmedithotkey.btnok.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmedithotkey.btnremoveshortcut.hint
|
||
msgid "Remove last shortcut from sequence"
|
||
msgstr "Usuń ostatni skrót z sekwencji"
|
||
|
||
#: tfrmedithotkey.btnselectfromlist.hint
|
||
msgid "Select shortcut from list of remaining free available keys"
|
||
msgstr "Wybierz skrót klawiaturowy z listy pozostałych dostępnych"
|
||
|
||
#: tfrmedithotkey.cghkcontrols.caption
|
||
msgid "Only for these controls"
|
||
msgstr "Tylko dla tych kontrolek"
|
||
|
||
#: tfrmedithotkey.lblparameters.caption
|
||
msgid "&Parameters (each in a separate line):"
|
||
msgstr "&Parametry (każdy w osobnym wierszu):"
|
||
|
||
#: tfrmedithotkey.lblshortcuts.caption
|
||
msgid "Shortcuts:"
|
||
msgstr "Skróty:"
|
||
|
||
#: tfrmeditor.actabout.caption
|
||
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "O programie"
|
||
|
||
#: tfrmeditor.actabout.hint
|
||
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
|
||
msgid "About"
|
||
msgstr "O programie"
|
||
|
||
#: tfrmeditor.actconfhigh.caption
|
||
msgid "&Configuration"
|
||
msgstr "Konfiguracja"
|
||
|
||
#: tfrmeditor.actconfhigh.hint
|
||
msgctxt "tfrmeditor.actconfhigh.hint"
|
||
msgid "Configuration"
|
||
msgstr "Konfiguracja"
|
||
|
||
#: tfrmeditor.acteditcopy.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmeditor.acteditcopy.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmeditor.acteditcut.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Wytnij"
|
||
|
||
#: tfrmeditor.acteditcut.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
|
||
msgid "Cut"
|
||
msgstr "Wytnij"
|
||
|
||
#: tfrmeditor.acteditdelete.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmeditor.acteditdelete.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmeditor.acteditfind.caption
|
||
msgctxt "tfrmeditor.acteditfind.caption"
|
||
msgid "&Find"
|
||
msgstr "Znajdź"
|
||
|
||
#: tfrmeditor.acteditfind.hint
|
||
msgctxt "tfrmeditor.acteditfind.hint"
|
||
msgid "Find"
|
||
msgstr "Znajdź"
|
||
|
||
#: tfrmeditor.acteditfindnext.caption
|
||
msgctxt "tfrmeditor.acteditfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Znajdź następny"
|
||
|
||
#: tfrmeditor.acteditfindnext.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
|
||
msgid "Find next"
|
||
msgstr "Znajdź następny"
|
||
|
||
#: tfrmeditor.acteditfindprevious.caption
|
||
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
||
msgid "Find previous"
|
||
msgstr "Znajdź poprzedni"
|
||
|
||
#: tfrmeditor.acteditgotoline.caption
|
||
msgid "Goto Line..."
|
||
msgstr "Idź do linii..."
|
||
|
||
#: tfrmeditor.acteditlineendcr.caption
|
||
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcr.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditpaste.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Wstaw"
|
||
|
||
#: tfrmeditor.acteditpaste.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
|
||
msgid "Paste"
|
||
msgstr "Wstaw"
|
||
|
||
#: tfrmeditor.acteditredo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Powtórz"
|
||
|
||
#: tfrmeditor.acteditredo.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
|
||
msgid "Redo"
|
||
msgstr "Powtórz szukanie"
|
||
|
||
#: tfrmeditor.acteditrplc.caption
|
||
msgid "&Replace"
|
||
msgstr "Zamień"
|
||
|
||
#: tfrmeditor.acteditrplc.hint
|
||
msgctxt "tfrmeditor.acteditrplc.hint"
|
||
msgid "Replace"
|
||
msgstr "Zamień"
|
||
|
||
#: tfrmeditor.acteditselectall.caption
|
||
msgid "Select&All"
|
||
msgstr "Zaznacz &wszystko"
|
||
|
||
#: tfrmeditor.acteditselectall.hint
|
||
msgctxt "tfrmeditor.acteditselectall.hint"
|
||
msgid "Select All"
|
||
msgstr "Zaznacz wszystko"
|
||
|
||
#: tfrmeditor.acteditundo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Cofnij"
|
||
|
||
#: tfrmeditor.acteditundo.hint
|
||
msgctxt "tfrmeditor.acteditundo.hint"
|
||
msgid "Undo"
|
||
msgstr "Cofnij"
|
||
|
||
#: tfrmeditor.actfileclose.caption
|
||
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Zamknij"
|
||
|
||
#: tfrmeditor.actfileclose.hint
|
||
msgctxt "tfrmeditor.actfileclose.hint"
|
||
msgid "Close"
|
||
msgstr "Zamknij"
|
||
|
||
#: tfrmeditor.actfileexit.caption
|
||
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Zakończ"
|
||
|
||
#: tfrmeditor.actfileexit.hint
|
||
msgctxt "tfrmeditor.actfileexit.hint"
|
||
msgid "Exit"
|
||
msgstr "Zakończ"
|
||
|
||
#: tfrmeditor.actfilenew.caption
|
||
msgid "&New"
|
||
msgstr "&Nowy"
|
||
|
||
#: tfrmeditor.actfilenew.hint
|
||
msgctxt "tfrmeditor.actfilenew.hint"
|
||
msgid "New"
|
||
msgstr "Nowy"
|
||
|
||
#: tfrmeditor.actfileopen.caption
|
||
msgid "&Open"
|
||
msgstr "&Otwórz"
|
||
|
||
#: tfrmeditor.actfileopen.hint
|
||
msgctxt "tfrmeditor.actfileopen.hint"
|
||
msgid "Open"
|
||
msgstr "Otwórz"
|
||
|
||
#: tfrmeditor.actfilesave.caption
|
||
msgctxt "tfrmeditor.actfilesave.caption"
|
||
msgid "&Save"
|
||
msgstr "Zapi&sz"
|
||
|
||
#: tfrmeditor.actfilesave.hint
|
||
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Zapisz"
|
||
|
||
#: tfrmeditor.actfilesaveas.caption
|
||
msgid "Save &As..."
|
||
msgstr "Zapisz j&ako..."
|
||
|
||
#: tfrmeditor.actfilesaveas.hint
|
||
msgid "Save As"
|
||
msgstr "Zapisz jako"
|
||
|
||
#: tfrmeditor.actsaveall.caption
|
||
msgid "Sa&ve All"
|
||
msgstr "Zapisz wszystko"
|
||
|
||
#: tfrmeditor.actsaveall.hint
|
||
msgid "Save All"
|
||
msgstr "Zapisz wszystko"
|
||
|
||
#: tfrmeditor.caption
|
||
msgctxt "tfrmeditor.caption"
|
||
msgid "Editor"
|
||
msgstr "Edytor"
|
||
|
||
#: tfrmeditor.help1.caption
|
||
msgctxt "tfrmeditor.help1.caption"
|
||
msgid "&Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmeditor.menuitem1.caption
|
||
msgctxt "TFRMEDITOR.MENUITEM1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.midiv.caption
|
||
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miedit.caption
|
||
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Edycja"
|
||
|
||
#: tfrmeditor.miencoding.caption
|
||
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Kodowanie"
|
||
|
||
#: tfrmeditor.miencodingin.caption
|
||
msgid "Open as"
|
||
msgstr "Otwórz jako"
|
||
|
||
#: tfrmeditor.miencodingout.caption
|
||
msgctxt "tfrmeditor.miencodingout.caption"
|
||
msgid "Save as"
|
||
msgstr "Zapisz jako"
|
||
|
||
#: tfrmeditor.mifile.caption
|
||
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "Plik"
|
||
|
||
#: tfrmeditor.mihighlight.caption
|
||
msgid "Syntax highlight"
|
||
msgstr "Kolorowanie składni"
|
||
|
||
#: tfrmeditor.milineendtype.caption
|
||
msgid "End Of Line"
|
||
msgstr "Koniec linii"
|
||
|
||
#: tfrmeditor.miseparator1.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miseparator2.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n1.caption
|
||
msgctxt "TFRMEDITOR.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n3.caption
|
||
msgctxt "TFRMEDITOR.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n4.caption
|
||
msgctxt "TFRMEDITOR.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n5.caption
|
||
msgctxt "TFRMEDITOR.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.OKBUTTON.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
||
msgid "C&ase sensitivity"
|
||
msgstr "&Uwzględniaj wielkość liter"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
||
msgid "S&earch from caret"
|
||
msgstr "Szukaj od kursora"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
||
msgid "&Regular expressions"
|
||
msgstr "Wyrażenie ®ularne"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
||
msgid "Selected &text only"
|
||
msgstr "Tylko w zaznaczonym tekście"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
||
msgid "&Whole words only"
|
||
msgstr "Tylko całe wyrazy"
|
||
|
||
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
||
msgid "Option"
|
||
msgstr "Opcje"
|
||
|
||
#: tfrmeditsearchreplace.lblreplacewith.caption
|
||
msgid "&Replace with:"
|
||
msgstr "Zamień na:"
|
||
|
||
#: tfrmeditsearchreplace.lblsearchfor.caption
|
||
msgid "&Search for:"
|
||
msgstr "Znajdź:"
|
||
|
||
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
||
msgid "Direction"
|
||
msgstr "Kierunek"
|
||
|
||
#: tfrmextractdlg.caption
|
||
msgid "Unpack files"
|
||
msgstr "Rozpakuj plik(i)"
|
||
|
||
#: tfrmextractdlg.cbextractpath.caption
|
||
msgid "&Unpack path names if stored with files"
|
||
msgstr "Rozpakuj z podkatalogami"
|
||
|
||
#: tfrmextractdlg.cbfilemask.text
|
||
msgctxt "tfrmextractdlg.cbfilemask.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmextractdlg.cbinseparatefolder.caption
|
||
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
||
msgstr "Każde archiwum rozpakuj do oddzielnego katalogu (z nazwą archiwum)"
|
||
|
||
#: tfrmextractdlg.cboverwrite.caption
|
||
msgid "O&verwrite existing files"
|
||
msgstr "Nadpisz istniejące pliki"
|
||
|
||
#: tfrmextractdlg.lblextractto.caption
|
||
msgid "To the &directory:"
|
||
msgstr "Do katalogu:"
|
||
|
||
#: tfrmextractdlg.lblfilemask.caption
|
||
msgid "&Extract files matching file mask:"
|
||
msgstr "Rozpakuj pliki zgodne z maską:"
|
||
|
||
#: tfrmextractdlg.lblpassword.caption
|
||
msgid "&Password for encrypted files:"
|
||
msgstr "Hasło dla zaszyfrowanych plików:"
|
||
|
||
#: tfrmfileexecuteyourself.btnclose.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Zamknij"
|
||
|
||
#: tfrmfileexecuteyourself.caption
|
||
msgid "Wait..."
|
||
msgstr "Czekaj..."
|
||
|
||
#: tfrmfileexecuteyourself.lblfilename.caption
|
||
msgid "File name:"
|
||
msgstr "Nazwa pliku:"
|
||
|
||
#: tfrmfileexecuteyourself.lblfrompath.caption
|
||
msgctxt "tfrmfileexecuteyourself.lblfrompath.caption"
|
||
msgid "From:"
|
||
msgstr "Z:"
|
||
|
||
#: tfrmfileexecuteyourself.lblprompt.caption
|
||
msgid "Click on Close when the temporary file can be deleted!"
|
||
msgstr "Kliknij na Zamknij, gdy plik tymczasowy może zostać usunięty!"
|
||
|
||
#: tfrmfileop.btncancel.caption
|
||
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Anuluj"
|
||
|
||
#: tfrmfileop.btnminimizetopanel.caption
|
||
msgid "&To panel"
|
||
msgstr "Idź do panelu"
|
||
|
||
#: tfrmfileop.btnviewoperations.caption
|
||
msgid "&View all"
|
||
msgstr "Zobacz wszystko"
|
||
|
||
#: tfrmfileop.lblcurrentoperation.caption
|
||
msgid "Current operation:"
|
||
msgstr "Bieżąca operacja:"
|
||
|
||
#: tfrmfileop.lblfrom.caption
|
||
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
||
msgid "From:"
|
||
msgstr "Z:"
|
||
|
||
#: tfrmfileop.lblto.caption
|
||
msgid "To:"
|
||
msgstr "Do:"
|
||
|
||
#: tfrmfileproperties.btnclose.caption
|
||
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Zamknij"
|
||
|
||
#: tfrmfileproperties.btnsetproperties.caption
|
||
msgid "&Set properties"
|
||
msgstr "U&staw właściwości"
|
||
|
||
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
||
msgid "Set to &all selected files"
|
||
msgstr "Ustaw dla wszystkich wybranych plików"
|
||
|
||
#: tfrmfileproperties.btnskipfile.caption
|
||
msgid "Ski&p this file"
|
||
msgstr "Pomiń ten plik"
|
||
|
||
#: tfrmfileproperties.caption
|
||
msgctxt "tfrmfileproperties.caption"
|
||
msgid "Properties"
|
||
msgstr "Właściwości"
|
||
|
||
#: tfrmfileproperties.cbsgid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmfileproperties.cbsticky.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Przyklejony"
|
||
|
||
#: tfrmfileproperties.cbsuid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmfileproperties.chkexecutable.caption
|
||
msgid "Allow &executing file as program"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.gbowner.caption
|
||
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Właściciel"
|
||
|
||
#: tfrmfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Bity:"
|
||
|
||
#: tfrmfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Grupa"
|
||
|
||
#: tfrmfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Inne"
|
||
|
||
#: tfrmfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Właściciel"
|
||
|
||
#: tfrmfileproperties.lblattrtext.caption
|
||
msgctxt "tfrmfileproperties.lblattrtext.caption"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmfileproperties.lblattrtextstr.caption
|
||
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
|
||
msgid "Text:"
|
||
msgstr "Tekst:"
|
||
|
||
#: tfrmfileproperties.lblcontains.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblcontainsstr.caption
|
||
msgid "Contains:"
|
||
msgstr "Zawartość:"
|
||
|
||
#: tfrmfileproperties.lblexec.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Wykonywalny"
|
||
|
||
#: tfrmfileproperties.lblexecutable.caption
|
||
msgid "Execute:"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.lblfile.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Nazwa pliku"
|
||
|
||
#: tfrmfileproperties.lblfilename.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfilestr.caption
|
||
msgctxt "tfrmfileproperties.lblfilestr.caption"
|
||
msgid "File name"
|
||
msgstr "Nazwa pliku"
|
||
|
||
#: tfrmfileproperties.lblfolder.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfolderstr.caption
|
||
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
||
msgid "Path:"
|
||
msgstr "Ścieżka:"
|
||
|
||
#: tfrmfileproperties.lblgroupstr.caption
|
||
msgid "&Group"
|
||
msgstr "Grupa"
|
||
|
||
#: tfrmfileproperties.lbllastaccess.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastaccessstr.caption
|
||
msgid "Last access:"
|
||
msgstr "Ostatnio używany:"
|
||
|
||
#: tfrmfileproperties.lbllastmodif.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastmodifstr.caption
|
||
msgid "Last modification:"
|
||
msgstr "Ostatnio zmieniony:"
|
||
|
||
#: tfrmfileproperties.lbllaststchange.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllaststchangestr.caption
|
||
msgid "Last status change:"
|
||
msgstr "Ostatnia zmiana statusu:"
|
||
|
||
#: tfrmfileproperties.lbloctal.caption
|
||
msgctxt "tfrmfileproperties.lbloctal.caption"
|
||
msgid "Octal:"
|
||
msgstr "Ósemkowo:"
|
||
|
||
#: tfrmfileproperties.lblownerstr.caption
|
||
msgid "O&wner"
|
||
msgstr "Właściciel"
|
||
|
||
#: tfrmfileproperties.lblread.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Odczyt"
|
||
|
||
#: tfrmfileproperties.lblsize.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsizestr.caption
|
||
msgctxt "tfrmfileproperties.lblsizestr.caption"
|
||
msgid "Size:"
|
||
msgstr "Rozmiar:"
|
||
|
||
#: tfrmfileproperties.lblsymlink.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsymlinkstr.caption
|
||
msgid "Symlink to:"
|
||
msgstr "Link symboliczny do:"
|
||
|
||
#: tfrmfileproperties.lbltype.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbltypestr.caption
|
||
msgid "Type:"
|
||
msgstr "Typ:"
|
||
|
||
#: tfrmfileproperties.lblwrite.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Zapis"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Nazwa"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
||
msgid "Value"
|
||
msgstr "Wartość"
|
||
|
||
#: tfrmfileproperties.tsattributes.caption
|
||
msgctxt "tfrmfileproperties.tsattributes.caption"
|
||
msgid "Attributes"
|
||
msgstr "Atrybuty"
|
||
|
||
#: tfrmfileproperties.tsimage.caption
|
||
msgid "Image"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.tsproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Właściwości"
|
||
|
||
#: tfrmfinddlg.actcancel.caption
|
||
msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION"
|
||
msgid "C&ancel"
|
||
msgstr "&Anuluj"
|
||
|
||
#: tfrmfinddlg.actcancelclose.caption
|
||
msgid "Cancel search and close window"
|
||
msgstr "Anuluj wyszukiwanie i zamknij okno"
|
||
|
||
#: tfrmfinddlg.actclose.caption
|
||
msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zamknij"
|
||
|
||
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
||
msgctxt "TFRMFINDDLG.ACTCONFIGFILESEARCHHOTKEYS.CAPTION"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Konfiguracja skrótów klawiszowych"
|
||
|
||
#: tfrmfinddlg.actedit.caption
|
||
msgctxt "tfrmfinddlg.actedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "&Edycja"
|
||
|
||
#: tfrmfinddlg.actfeedtolistbox.caption
|
||
msgid "Feed to &listbox"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actfreefrommem.caption
|
||
msgid "Cancel search, close and free from memory"
|
||
msgstr "Anuluj wyszukiwanie, zamknij i uwolnij z pamięci"
|
||
|
||
#: tfrmfinddlg.actfreefrommemallothers.caption
|
||
msgid "For all other \"Find files\", cancel, close and free from memory"
|
||
msgstr "Dla wszystkich innych \"Znajdź pliki\", anuluj, zamknij i uwolnij z pamięci"
|
||
|
||
#: tfrmfinddlg.actgotofile.caption
|
||
msgid "&Go to file"
|
||
msgstr "Idź do pliku"
|
||
|
||
#: tfrmfinddlg.actintellifocus.caption
|
||
msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION"
|
||
msgid "Find Data"
|
||
msgstr "Znajdź dane"
|
||
|
||
#: tfrmfinddlg.actlastsearch.caption
|
||
msgid "&Last search"
|
||
msgstr "Ostatnie wyszukiwanie"
|
||
|
||
#: tfrmfinddlg.actnewsearch.caption
|
||
msgid "&New search"
|
||
msgstr "&Nowe wyszukiwanie"
|
||
|
||
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
||
msgid "New search (clear filters)"
|
||
msgstr "Nowe wyszukiwanie (wyczyszczone filtry)"
|
||
|
||
#: tfrmfinddlg.actpageadvanced.caption
|
||
msgid "Go to page \"Advanced\""
|
||
msgstr "Idź do strony \"Zaawansowane\""
|
||
|
||
#: tfrmfinddlg.actpageloadsave.caption
|
||
msgid "Go to page \"Load/Save\""
|
||
msgstr "Idź do strony \"Wczytaj/Zapisz\""
|
||
|
||
#: tfrmfinddlg.actpageplugins.caption
|
||
msgid "Go to page \"Plugins\""
|
||
msgstr "Idź do strony \"Wtyczki\""
|
||
|
||
#: tfrmfinddlg.actpageresults.caption
|
||
msgid "Go to page \"Results\""
|
||
msgstr "Idź do strony \"Wyniki\""
|
||
|
||
#: tfrmfinddlg.actpagestandard.caption
|
||
msgid "Go to page \"Standard\""
|
||
msgstr "Idź do strony \"Standard\""
|
||
|
||
#: tfrmfinddlg.actstart.caption
|
||
msgctxt "tfrmfinddlg.actstart.caption"
|
||
msgid "&Start"
|
||
msgstr "Rozpocznij"
|
||
|
||
#: tfrmfinddlg.actview.caption
|
||
msgctxt "tfrmfinddlg.actview.caption"
|
||
msgid "&View"
|
||
msgstr "&Widok"
|
||
|
||
#: tfrmfinddlg.btnaddattribute.caption
|
||
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "Dod&aj"
|
||
|
||
#: tfrmfinddlg.btnattrshelp.caption
|
||
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmfinddlg.btnsavetemplate.caption
|
||
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Zapisz"
|
||
|
||
#: tfrmfinddlg.btnsearchdelete.caption
|
||
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmfinddlg.btnsearchload.caption
|
||
msgid "L&oad"
|
||
msgstr "Wczytaj"
|
||
|
||
#: tfrmfinddlg.btnsearchsave.caption
|
||
msgid "S&ave"
|
||
msgstr "&Zapisz"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
||
msgid "Sa&ve with \"Start in directory\""
|
||
msgstr "Zapisz z \"Start w katalogu\""
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
||
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
||
msgstr "Jeśli zapiszesz jako \"Start w katalogu\" zostanie przywrócony podczas ładowania szablonu. Użyj, jeśli chcesz naprawić wyszukiwanie do określonych katalogów"
|
||
|
||
#: tfrmfinddlg.btnusetemplate.caption
|
||
msgid "Use template"
|
||
msgstr "Użyj szblonu"
|
||
|
||
#: tfrmfinddlg.caption
|
||
msgctxt "tfrmfinddlg.caption"
|
||
msgid "Find files"
|
||
msgstr "Znajdź pliki"
|
||
|
||
#: tfrmfinddlg.cbcasesens.caption
|
||
msgid "Case sens&itive"
|
||
msgstr "Rozróżniaj wielkość liter"
|
||
|
||
#: tfrmfinddlg.cbdatefrom.caption
|
||
msgid "&Date from:"
|
||
msgstr "Od daty:"
|
||
|
||
#: tfrmfinddlg.cbdateto.caption
|
||
msgid "Dat&e to:"
|
||
msgstr "Do daty:"
|
||
|
||
#: tfrmfinddlg.cbfilesizefrom.caption
|
||
msgid "S&ize from:"
|
||
msgstr "Wielkość od:"
|
||
|
||
#: tfrmfinddlg.cbfilesizeto.caption
|
||
msgid "Si&ze to:"
|
||
msgstr "Wielkość do:"
|
||
|
||
#: tfrmfinddlg.cbfindinarchive.caption
|
||
msgid "Search in &archives"
|
||
msgstr "Wyszukaj w &archiwach"
|
||
|
||
#: tfrmfinddlg.cbfindtext.caption
|
||
msgid "Find &text in file"
|
||
msgstr "Znajdź &tekst w pliku"
|
||
|
||
#: tfrmfinddlg.cbfollowsymlinks.caption
|
||
msgid "Follow s&ymlinks"
|
||
msgstr "Śledź linki symboliczne"
|
||
|
||
#: tfrmfinddlg.cbnotcontainingtext.caption
|
||
msgid "Find files N&OT containing the text"
|
||
msgstr "Pliki &NIE zawierające tekstu"
|
||
|
||
#: tfrmfinddlg.cbnotolderthan.caption
|
||
msgid "N&ot older than:"
|
||
msgstr "Nie starsze niż:"
|
||
|
||
#: tfrmfinddlg.cbopenedtabs.caption
|
||
msgid "Opened tabs"
|
||
msgstr "Otwarte zakładki"
|
||
|
||
#: tfrmfinddlg.cbpartialnamesearch.caption
|
||
msgid "Searc&h for part of file name"
|
||
msgstr "Szukaj części nazwy pliku"
|
||
|
||
#: tfrmfinddlg.cbregexp.caption
|
||
msgid "&Regular expression"
|
||
msgstr "Wyrażenie regularne"
|
||
|
||
#: tfrmfinddlg.cbreplacetext.caption
|
||
msgid "Re&place by"
|
||
msgstr "Za&mień tekst"
|
||
|
||
#: tfrmfinddlg.cbselectedfiles.caption
|
||
msgid "Selected directories and &files"
|
||
msgstr "Wybrane katalogi i pliki"
|
||
|
||
#: tfrmfinddlg.cbtextregexp.caption
|
||
msgid "Regular &expression"
|
||
msgstr "Wyrażenie regularne"
|
||
|
||
#: tfrmfinddlg.cbtimefrom.caption
|
||
msgid "&Time from:"
|
||
msgstr "Czas od:"
|
||
|
||
#: tfrmfinddlg.cbtimeto.caption
|
||
msgid "Ti&me to:"
|
||
msgstr "Czas do:"
|
||
|
||
#: tfrmfinddlg.cbuseplugin.caption
|
||
msgid "&Use search plugin:"
|
||
msgstr "&Użyj wtyczki wyszukiwania:"
|
||
|
||
#: tfrmfinddlg.cmbexcludedirectories.hint
|
||
msgid "Enter directories names that should be excluded from search separated with \";\""
|
||
msgstr "Wprowadź nazwy katalogów, które powinny być wyłączone z wyszukiwania oddzielone \";\""
|
||
|
||
#: tfrmfinddlg.cmbexcludefiles.hint
|
||
msgid "Enter files names that should be excluded from search separated with \";\""
|
||
msgstr "Wprowadź nazwy plików, które powinny być wyłączone z wyszukiwania oddzielone \";\""
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.hint
|
||
msgid "Enter files names separated with \";\""
|
||
msgstr "Wpisz nazwy plików oddzielone \";\""
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.text
|
||
msgctxt "tfrmfinddlg.cmbfindfilemask.text"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmfinddlg.gbdirectories.caption
|
||
msgctxt "tfrmfinddlg.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Katalogi"
|
||
|
||
#: tfrmfinddlg.gbfiles.caption
|
||
msgctxt "tfrmfinddlg.gbfiles.caption"
|
||
msgid "Files"
|
||
msgstr "Pliki"
|
||
|
||
#: tfrmfinddlg.gbfinddata.caption
|
||
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
||
msgid "Find Data"
|
||
msgstr "Znajdź dane"
|
||
|
||
#: tfrmfinddlg.lblattributes.caption
|
||
msgid "Attri&butes"
|
||
msgstr "Atry&buty"
|
||
|
||
#: tfrmfinddlg.lblencoding.caption
|
||
msgid "Encodin&g:"
|
||
msgstr "Kodowanie:"
|
||
|
||
#: tfrmfinddlg.lblexcludedirectories.caption
|
||
msgid "E&xclude subdirectories"
|
||
msgstr "Wyklucz podkatalogi"
|
||
|
||
#: tfrmfinddlg.lblexcludefiles.caption
|
||
msgid "&Exclude files"
|
||
msgstr "Wyklucz pliki"
|
||
|
||
#: tfrmfinddlg.lblfindfilemask.caption
|
||
msgid "&File mask"
|
||
msgstr "Maska &pliku"
|
||
|
||
#: tfrmfinddlg.lblfindpathstart.caption
|
||
msgid "Start in &directory"
|
||
msgstr "Rozpocznij w &katalogu"
|
||
|
||
#: tfrmfinddlg.lblsearchdepth.caption
|
||
msgid "Search su&bdirectories:"
|
||
msgstr "Przeszukuj po&dkatalogi:"
|
||
|
||
#: tfrmfinddlg.lbltemplateheader.caption
|
||
msgid "&Previous searches:"
|
||
msgstr "&Poprzednie wyszukiwanie:"
|
||
|
||
#: tfrmfinddlg.miaction.caption
|
||
msgid "&Action"
|
||
msgstr "Akcja"
|
||
|
||
#: tfrmfinddlg.mifreefrommemallothers.caption
|
||
msgid "For all others, cancel, close and free from memory"
|
||
msgstr "Dla wszystkich innych, anuluj, zamknij i zwolnij z pamięci"
|
||
|
||
#: tfrmfinddlg.miopeninnewtab.caption
|
||
msgid "Open In New Tab(s)"
|
||
msgstr "Otwórz w nowej zakładce(zakładkach)"
|
||
|
||
#: tfrmfinddlg.mioptions.caption
|
||
msgctxt "TFRMFINDDLG.MIOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Opcje"
|
||
|
||
#: tfrmfinddlg.miremovefromllist.caption
|
||
msgid "Remove from list"
|
||
msgstr "Usuń z listy"
|
||
|
||
#: tfrmfinddlg.miresult.caption
|
||
msgid "&Result"
|
||
msgstr "Wynik"
|
||
|
||
#: tfrmfinddlg.miseparator1.caption
|
||
msgctxt "TFRMFINDDLG.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.miseparator2.caption
|
||
msgctxt "TFRMFINDDLG.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.mishowallfound.caption
|
||
msgid "Show all found items"
|
||
msgstr "Pokaż wszystkie znalezione pozycje"
|
||
|
||
#: tfrmfinddlg.mishowineditor.caption
|
||
msgid "Show In Editor"
|
||
msgstr "Pokaż w Edytorze"
|
||
|
||
#: tfrmfinddlg.mishowinviewer.caption
|
||
msgid "Show In Viewer"
|
||
msgstr "Podgląd"
|
||
|
||
#: tfrmfinddlg.miviewtab.caption
|
||
msgctxt "TFRMFINDDLG.MIVIEWTAB.CAPTION"
|
||
msgid "&View"
|
||
msgstr "Widok"
|
||
|
||
#: tfrmfinddlg.tsadvanced.caption
|
||
msgid "Advanced"
|
||
msgstr "Zaawansowane"
|
||
|
||
#: tfrmfinddlg.tsloadsave.caption
|
||
msgid "Load/Save"
|
||
msgstr "Wczytaj/zapisz"
|
||
|
||
#: tfrmfinddlg.tsplugins.caption
|
||
msgctxt "tfrmfinddlg.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Wtyczki"
|
||
|
||
#: tfrmfinddlg.tsresults.caption
|
||
msgid "Results"
|
||
msgstr "Wyniki"
|
||
|
||
#: tfrmfinddlg.tsstandard.caption
|
||
msgid "Standard"
|
||
msgstr "Podstawowe"
|
||
|
||
#: tfrmfindview.btnclose.caption
|
||
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmfindview.btnfind.caption
|
||
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
||
msgid "&Find"
|
||
msgstr "Szukaj"
|
||
|
||
#: tfrmfindview.caption
|
||
msgctxt "TFRMFINDVIEW.CAPTION"
|
||
msgid "Find"
|
||
msgstr "Szukaj"
|
||
|
||
#: tfrmfindview.cbcasesens.caption
|
||
msgid "C&ase sensitive"
|
||
msgstr "Uwzględniaj wielość liter"
|
||
|
||
#: tfrmhardlink.btncancel.caption
|
||
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmhardlink.btnok.caption
|
||
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmhardlink.caption
|
||
msgid "Create hard link"
|
||
msgstr "Utwórz link twardy"
|
||
|
||
#: tfrmhardlink.lblexistingfile.caption
|
||
msgctxt "tfrmhardlink.lblexistingfile.caption"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "Obiekt docelowy, który będzie wskazywał link"
|
||
|
||
#: tfrmhardlink.lbllinktocreate.caption
|
||
msgctxt "tfrmhardlink.lbllinktocreate.caption"
|
||
msgid "&Link name"
|
||
msgstr "Nazwa &linku"
|
||
|
||
#: tfrmhotdirexportimport.btnselectall.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
|
||
msgid "Import all!"
|
||
msgstr "Importuj wszystko!"
|
||
|
||
#: tfrmhotdirexportimport.btnselectiondone.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
|
||
msgid "Import selected"
|
||
msgstr "Importuj wybrane"
|
||
|
||
#: tfrmhotdirexportimport.caption
|
||
msgid "Select the entries your want to import"
|
||
msgstr "Wybierz wpisy do zaimportowania"
|
||
|
||
#: tfrmhotdirexportimport.lbhint.caption
|
||
msgid "When clicking a sub-menu, it will select the whole menu"
|
||
msgstr "Po kliknięciu podmenu, wybierz całe menu"
|
||
|
||
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
||
msgid "Hold CTRL and click entries to select multiple ones"
|
||
msgstr "Przytrzymaj klawisz CTRL i kliknij, aby zaznaczyć wiele wpisów"
|
||
|
||
#: tfrmlinker.btnsave.caption
|
||
msgctxt "tfrmlinker.btnsave.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmlinker.caption
|
||
msgid "Linker"
|
||
msgstr "Linkowanie"
|
||
|
||
#: tfrmlinker.gbsaveto.caption
|
||
msgid "Save to..."
|
||
msgstr "Zapisz jako..."
|
||
|
||
#: tfrmlinker.grbxcontrol.caption
|
||
msgid "Item"
|
||
msgstr "Obiekt"
|
||
|
||
#: tfrmlinker.lblfilename.caption
|
||
msgid "&File name"
|
||
msgstr "Nazwa pliku"
|
||
|
||
#: tfrmlinker.spbtndown.caption
|
||
msgid "Do&wn"
|
||
msgstr "W dół"
|
||
|
||
#: tfrmlinker.spbtndown.hint
|
||
msgid "Down"
|
||
msgstr "W dół"
|
||
|
||
#: tfrmlinker.spbtnrem.caption
|
||
msgctxt "tfrmlinker.spbtnrem.caption"
|
||
msgid "&Remove"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmlinker.spbtnrem.hint
|
||
msgctxt "TFRMLINKER.SPBTNREM.HINT"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmlinker.spbtnup.caption
|
||
msgctxt "tfrmlinker.spbtnup.caption"
|
||
msgid "&Up"
|
||
msgstr "W górę"
|
||
|
||
#: tfrmlinker.spbtnup.hint
|
||
msgid "Up"
|
||
msgstr "W górę"
|
||
|
||
#: tfrmmain.actabout.caption
|
||
msgid "&About"
|
||
msgstr "O programie"
|
||
|
||
#: tfrmmain.actaddfilenametocmdline.caption
|
||
msgid "Add file name to command line"
|
||
msgstr "Dodaj nazwę pliku do paska poleceń"
|
||
|
||
#: tfrmmain.actaddnewsearch.caption
|
||
msgid "New search instance..."
|
||
msgstr "Nowe wystąpienie wyszukiwania..."
|
||
|
||
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
||
msgid "Add path and file name to command line"
|
||
msgstr "Dodaj ścieżkę i nazwę pliku do paska poleceń"
|
||
|
||
#: tfrmmain.actaddpathtocmdline.caption
|
||
msgid "Copy path to command line"
|
||
msgstr "Kopiuj ścieżkę do paska poleceń"
|
||
|
||
#: tfrmmain.actbriefview.caption
|
||
msgid "Brief view"
|
||
msgstr "Krótki"
|
||
|
||
#: tfrmmain.actbriefview.hint
|
||
msgid "Brief View"
|
||
msgstr "Krótki widok"
|
||
|
||
#: tfrmmain.actcalculatespace.caption
|
||
msgid "Calculate &Occupied Space"
|
||
msgstr "Oblicz zajmowane &miejsce"
|
||
|
||
#: tfrmmain.actchangedir.caption
|
||
msgid "Change directory"
|
||
msgstr "Zmień katalog"
|
||
|
||
#: tfrmmain.actchangedirtohome.caption
|
||
msgid "Change directory to home"
|
||
msgstr "Zmień katalog na domowy"
|
||
|
||
#: tfrmmain.actchangedirtoparent.caption
|
||
msgid "Change Directory To Parent"
|
||
msgstr "Zmień katalog na wyższy"
|
||
|
||
#: tfrmmain.actchangedirtoroot.caption
|
||
msgid "Change directory to root"
|
||
msgstr "Przejdź do katalogu głównego"
|
||
|
||
#: tfrmmain.actchecksumcalc.caption
|
||
msgid "Calculate Check&sum..."
|
||
msgstr "O&blicz sumy kontrolne..."
|
||
|
||
#: tfrmmain.actchecksumverify.caption
|
||
msgid "&Verify Checksum..."
|
||
msgstr "Sprawdź s&umy kontrolne..."
|
||
|
||
#: tfrmmain.actclearlogfile.caption
|
||
msgid "Clear log file"
|
||
msgstr "Wyczyść plik logów"
|
||
|
||
#: tfrmmain.actclearlogwindow.caption
|
||
msgid "Clear log window"
|
||
msgstr "Wyczyść okno logów"
|
||
|
||
#: tfrmmain.actclosealltabs.caption
|
||
msgid "Close &All Tabs"
|
||
msgstr "Zamknij wszystkie k&arty"
|
||
|
||
#: tfrmmain.actcloseduplicatetabs.caption
|
||
msgid "Close Duplicate Tabs"
|
||
msgstr "Zamknij zduplikowane zakładki"
|
||
|
||
#: tfrmmain.actclosetab.caption
|
||
msgid "&Close Tab"
|
||
msgstr "Zamknij zakładkę"
|
||
|
||
#: tfrmmain.actcmdlinenext.caption
|
||
msgid "Next Command Line"
|
||
msgstr "Następny wiersz polecenia"
|
||
|
||
#: tfrmmain.actcmdlinenext.hint
|
||
msgid "Set command line to next command in history"
|
||
msgstr "Ustaw wiersz polecenia do następnego polecenia w historii"
|
||
|
||
#: tfrmmain.actcmdlineprev.caption
|
||
msgid "Previous Command Line"
|
||
msgstr "Poprzedni wiersz polecenia"
|
||
|
||
#: tfrmmain.actcmdlineprev.hint
|
||
msgid "Set command line to previous command in history"
|
||
msgstr "Ustaw wiersz polecenia do poprzedniego polecenia w historii"
|
||
|
||
#: tfrmmain.actcolumnsview.caption
|
||
msgid "Full"
|
||
msgstr "Pełny"
|
||
|
||
#: tfrmmain.actcolumnsview.hint
|
||
msgid "Columns View"
|
||
msgstr "Widok kolumn"
|
||
|
||
#: tfrmmain.actcomparecontents.caption
|
||
msgid "Compare by &Contents"
|
||
msgstr "Porównaj &zawartość"
|
||
|
||
#: tfrmmain.actcomparedirectories.caption
|
||
msgctxt "tfrmmain.actcomparedirectories.caption"
|
||
msgid "Compare Directories"
|
||
msgstr "Porównaj katalogi"
|
||
|
||
#: tfrmmain.actcomparedirectories.hint
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
||
msgid "Compare Directories"
|
||
msgstr "Porównaj katalogi"
|
||
|
||
#: tfrmmain.actconfigdirhotlist.caption
|
||
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Konfiguracja ulubionych katalogów"
|
||
|
||
#: tfrmmain.actconfigfavoritetabs.caption
|
||
msgid "Configuration of Favorite Tabs"
|
||
msgstr "Konfiguracja ulubionych zakładek"
|
||
|
||
#: tfrmmain.actconfigfoldertabs.caption
|
||
msgid "Configuration of folder tabs"
|
||
msgstr "Konfiguracja zakładek folderów"
|
||
|
||
#: tfrmmain.actconfighotkeys.caption
|
||
msgctxt "tfrmmain.actconfighotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Konfiguracja skrótów klawiszowych"
|
||
|
||
#: tfrmmain.actconfigsavesettings.caption
|
||
msgid "Save Settings"
|
||
msgstr "Zapisz ustawienia"
|
||
|
||
#: tfrmmain.actconfigsearches.caption
|
||
msgid "Configuration of searches"
|
||
msgstr "Konfiguracja wyszukiwań"
|
||
|
||
#: tfrmmain.actconfigtoolbars.caption
|
||
msgid "Toolbar..."
|
||
msgstr "Pasek narzędzi..."
|
||
|
||
#: tfrmmain.actconfigtreeviewmenus.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Konfiguracja menu widoku drzewa"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Konfiguracja kolorów menu widoku drzewa"
|
||
|
||
#: tfrmmain.actcontextmenu.caption
|
||
msgid "Show context menu"
|
||
msgstr "Pokaż menu kontekstowe"
|
||
|
||
#: tfrmmain.actcopy.caption
|
||
msgctxt "TFRMMAIN.ACTCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmmain.actcopyalltabstoopposite.caption
|
||
msgid "Copy all tabs to opposite side"
|
||
msgstr "Skopiuj wszystkie zakładki na przeciwną stronę"
|
||
|
||
#: tfrmmain.actcopyfiledetailstoclip.caption
|
||
msgid "Copy all shown &columns"
|
||
msgstr "Skopiuj wszystkie pokazane &kolumny"
|
||
|
||
#: tfrmmain.actcopyfullnamestoclip.caption
|
||
msgid "Copy Filename(s) with Full &Path"
|
||
msgstr "Kopiuj nazwę pliku(ów) ze ścieżką &dostępu"
|
||
|
||
#: tfrmmain.actcopynamestoclip.caption
|
||
msgid "Copy &Filename(s) to Clipboard"
|
||
msgstr "&Kopiuj nazwę(y) pliku(ów) do schowka"
|
||
|
||
#: tfrmmain.actcopynoask.caption
|
||
msgid "Copy files without asking for confirmation"
|
||
msgstr "Kopiuj bez pytania o potwierdzenie"
|
||
|
||
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
||
msgstr "Kopiuj pełną scieżkę wybranego pliku(ów) bez końcowego separatora katalogu"
|
||
|
||
#: tfrmmain.actcopypathoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s)"
|
||
msgstr "Kopiuj pełną ścieżkę wybranego pliku(ów)"
|
||
|
||
#: tfrmmain.actcopysamepanel.caption
|
||
msgid "Copy to same panel"
|
||
msgstr "Kopiuj do tego samego panelu"
|
||
|
||
#: tfrmmain.actcopytoclipboard.caption
|
||
msgid "&Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmmain.actcountdircontent.caption
|
||
msgid "Sho&w Occupied Space"
|
||
msgstr "Pokaż zajęte miejsce"
|
||
|
||
#: tfrmmain.actcuttoclipboard.caption
|
||
msgid "Cu&t"
|
||
msgstr "Wytnij"
|
||
|
||
#: tfrmmain.actdebugshowcommandparameters.caption
|
||
msgid "Show Command Parameters"
|
||
msgstr "Pokaż parametry polecenia"
|
||
|
||
#: tfrmmain.actdelete.caption
|
||
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmmain.actdeletesearches.caption
|
||
msgid "For all searches, cancel, close and free memory"
|
||
msgstr "Dla wszystkich wyszukiwań, anuluj, zamknij i zwolnij z pamięci"
|
||
|
||
#: tfrmmain.actdirhistory.caption
|
||
msgid "Directory history"
|
||
msgstr "Historia katalogów"
|
||
|
||
#: tfrmmain.actdirhotlist.caption
|
||
msgid "Directory &Hotlist"
|
||
msgstr "Ulubione katalogi"
|
||
|
||
#: tfrmmain.actdoanycmcommand.caption
|
||
msgid "Select any command and execute it"
|
||
msgstr "Wybierz dowolne polecenie i wykonaj je"
|
||
|
||
#: tfrmmain.actedit.caption
|
||
msgctxt "TFRMMAIN.ACTEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Edytuj"
|
||
|
||
#: tfrmmain.acteditcomment.caption
|
||
msgid "Edit Co&mment..."
|
||
msgstr "Edytuj k&omentarz..."
|
||
|
||
#: tfrmmain.acteditnew.caption
|
||
msgid "Edit new file"
|
||
msgstr "Utwórz plik"
|
||
|
||
#: tfrmmain.acteditpath.caption
|
||
msgid "Edit path field above file list"
|
||
msgstr "Edycja ścieżki nad listą plików"
|
||
|
||
#: tfrmmain.actexchange.caption
|
||
msgid "Swap &Panels"
|
||
msgstr "Zamień panele"
|
||
|
||
#: tfrmmain.actexecutescript.caption
|
||
msgid "Execute Script"
|
||
msgstr "Uruchom skrypt"
|
||
|
||
#: tfrmmain.actexit.caption
|
||
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Zakończ"
|
||
|
||
#: tfrmmain.actextractfiles.caption
|
||
msgid "&Extract Files..."
|
||
msgstr "&Rozpakuj pliki..."
|
||
|
||
#: tfrmmain.actfileassoc.caption
|
||
msgid "Configuration of File &Associations"
|
||
msgstr "Skoj&arzenia plików..."
|
||
|
||
#: tfrmmain.actfilelinker.caption
|
||
msgid "Com&bine Files..."
|
||
msgstr "P&ołącz pliki..."
|
||
|
||
#: tfrmmain.actfileproperties.caption
|
||
msgid "Show &File Properties"
|
||
msgstr "Pokaż &właściwości pliku"
|
||
|
||
#: tfrmmain.actfilespliter.caption
|
||
msgid "Spl&it File..."
|
||
msgstr "Po&dziel plik"
|
||
|
||
#: tfrmmain.actflatview.caption
|
||
msgid "&Flat view"
|
||
msgstr "Płaski widok (bez podkatalogów)"
|
||
|
||
#: tfrmmain.actfocuscmdline.caption
|
||
msgid "Focus command line"
|
||
msgstr "Przejdź do lini poleceń"
|
||
|
||
#: tfrmmain.actfocusswap.caption
|
||
msgid "Swap focus"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actfocusswap.hint
|
||
msgid "Switch between left and right file list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actgotofirstfile.caption
|
||
msgid "Place cursor on first file in list"
|
||
msgstr "Umieść kursor na pierwszym pliku listy"
|
||
|
||
#: tfrmmain.actgotolastfile.caption
|
||
msgid "Place cursor on last file in list"
|
||
msgstr "Umieść kursor na ostatnim pliku listy"
|
||
|
||
#: tfrmmain.acthardlink.caption
|
||
msgid "Create &Hard Link..."
|
||
msgstr "Utwórz link &twardy..."
|
||
|
||
#: tfrmmain.acthelpindex.caption
|
||
msgid "&Contents"
|
||
msgstr "Zawartość"
|
||
|
||
#: tfrmmain.acthorizontalfilepanels.caption
|
||
msgid "&Horizontal Panels Mode"
|
||
msgstr "Poziome ustawienie paneli"
|
||
|
||
#: tfrmmain.actkeyboard.caption
|
||
msgid "&Keyboard"
|
||
msgstr "Skróty klawiaturowe"
|
||
|
||
#: tfrmmain.actleftbriefview.caption
|
||
msgid "Brief view on left panel"
|
||
msgstr "Krótki widok w lewym panelu"
|
||
|
||
#: tfrmmain.actleftcolumnsview.caption
|
||
msgid "Columns view on left panel"
|
||
msgstr "Widok kolumn w lewym panelu"
|
||
|
||
#: tfrmmain.actleftequalright.caption
|
||
msgid "Left &= Right"
|
||
msgstr "Lewa &= Prawa"
|
||
|
||
#: tfrmmain.actleftflatview.caption
|
||
msgid "&Flat view on left panel"
|
||
msgstr "Płaski widok w lewym panelu"
|
||
|
||
#: tfrmmain.actleftopendrives.caption
|
||
msgid "Open left drive list"
|
||
msgstr "Otwórz listę dysków z lewej"
|
||
|
||
#: tfrmmain.actleftreverseorder.caption
|
||
msgid "Re&verse order on left panel"
|
||
msgstr "Odwrotna kolejność w lewym panelu"
|
||
|
||
#: tfrmmain.actleftsortbyattr.caption
|
||
msgid "Sort left panel by &Attributes"
|
||
msgstr "Sortuj lewy panel wg &Atrybutów"
|
||
|
||
#: tfrmmain.actleftsortbydate.caption
|
||
msgid "Sort left panel by &Date"
|
||
msgstr "Sortuj lewy panel wg &Daty"
|
||
|
||
#: tfrmmain.actleftsortbyext.caption
|
||
msgid "Sort left panel by &Extension"
|
||
msgstr "Sortuj lewy panel wg Rozsz&erzenia"
|
||
|
||
#: tfrmmain.actleftsortbyname.caption
|
||
msgid "Sort left panel by &Name"
|
||
msgstr "SOrtuj lewy panel wg &Nazwy"
|
||
|
||
#: tfrmmain.actleftsortbysize.caption
|
||
msgid "Sort left panel by &Size"
|
||
msgstr "Sortuj lewy panel wg Rozmiaru"
|
||
|
||
#: tfrmmain.actleftthumbview.caption
|
||
msgid "Thumbnails view on left panel"
|
||
msgstr "Widok miniatur w lewym panelu"
|
||
|
||
#: tfrmmain.actloadfavoritetabs.caption
|
||
msgid "Load tabs from Favorite Tabs"
|
||
msgstr "Załaduj zakładki z Ulubionych zakładek"
|
||
|
||
#: tfrmmain.actloadselectionfromclip.caption
|
||
msgid "Load Selection from Clip&board"
|
||
msgstr "Wczytaj zaznaczenie ze S&chowka"
|
||
|
||
#: tfrmmain.actloadselectionfromfile.caption
|
||
msgid "&Load Selection from File..."
|
||
msgstr "Wczytaj wybór z p&liku..."
|
||
|
||
#: tfrmmain.actloadtabs.caption
|
||
msgid "&Load Tabs from File"
|
||
msgstr "Wczytaj zakładki z p&liku"
|
||
|
||
#: tfrmmain.actmakedir.caption
|
||
msgid "Create &Directory"
|
||
msgstr "Utwórz katalog"
|
||
|
||
#: tfrmmain.actmarkcurrentextension.caption
|
||
msgid "Select All with the Same E&xtension"
|
||
msgstr "Zaznacz wszystko z tym samym &rozszerzeniem"
|
||
|
||
#: tfrmmain.actmarkcurrentname.caption
|
||
msgid "Select all files with same name"
|
||
msgstr "Zaznacz wszystkie pliki z tą samą nazwą"
|
||
|
||
#: tfrmmain.actmarkcurrentnameext.caption
|
||
msgid "Select all files with same name and extension"
|
||
msgstr "Zaznacz wszystkie pliki z tą samą nazwą i rozszerzeniem"
|
||
|
||
#: tfrmmain.actmarkcurrentpath.caption
|
||
msgid "Select all in same path"
|
||
msgstr "Zaznacz wszystkie z tą samą ścieżką"
|
||
|
||
#: tfrmmain.actmarkinvert.caption
|
||
msgid "&Invert Selection"
|
||
msgstr "&Odwróć zaznaczenie"
|
||
|
||
#: tfrmmain.actmarkmarkall.caption
|
||
msgid "&Select All"
|
||
msgstr "Zaznacz &wszystko"
|
||
|
||
#: tfrmmain.actmarkminus.caption
|
||
msgid "Unselect a Gro&up..."
|
||
msgstr "Odznacz grupę..."
|
||
|
||
#: tfrmmain.actmarkplus.caption
|
||
msgid "Select a &Group..."
|
||
msgstr "Zaznacz &grupę..."
|
||
|
||
#: tfrmmain.actmarkunmarkall.caption
|
||
msgid "&Unselect All"
|
||
msgstr "&Usuń zaznaczenie"
|
||
|
||
#: tfrmmain.actminimize.caption
|
||
msgid "Minimize window"
|
||
msgstr "Minimalizuj okno"
|
||
|
||
#: tfrmmain.actmultirename.caption
|
||
msgid "Multi &Rename Tool"
|
||
msgstr "Zmiany w&ielokrotne"
|
||
|
||
#: tfrmmain.actnetworkconnect.caption
|
||
msgid "Network &Connect..."
|
||
msgstr "Połączenie sieciowe"
|
||
|
||
#: tfrmmain.actnetworkdisconnect.caption
|
||
msgid "Network &Disconnect"
|
||
msgstr "Rozłącz sieć"
|
||
|
||
#: tfrmmain.actnetworkquickconnect.caption
|
||
msgid "Network &Quick Connect..."
|
||
msgstr "Szybkie połączenie sieciowe..."
|
||
|
||
#: tfrmmain.actnewtab.caption
|
||
msgid "&New Tab"
|
||
msgstr "&Nowa zakładka"
|
||
|
||
#: tfrmmain.actnextfavoritetabs.caption
|
||
msgid "Load the Next Favorite Tabs in the list"
|
||
msgstr "Wczytaj następne Ulubione zakładki z listy"
|
||
|
||
#: tfrmmain.actnexttab.caption
|
||
msgid "Switch to Nex&t Tab"
|
||
msgstr "Przełącz do &kolejnej zakładki"
|
||
|
||
#: tfrmmain.actopen.caption
|
||
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Otwórz"
|
||
|
||
#: tfrmmain.actopenarchive.caption
|
||
msgid "Try open archive"
|
||
msgstr "Otwórz archiwum"
|
||
|
||
#: tfrmmain.actopenbar.caption
|
||
msgid "Open bar file"
|
||
msgstr "Otwórz plik paska"
|
||
|
||
#: tfrmmain.actopendirinnewtab.caption
|
||
msgid "Open &Folder in a New Tab"
|
||
msgstr "Otwórz katalog w &nowej zakładce"
|
||
|
||
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
||
msgid "Open &VFS List"
|
||
msgstr "Otwórz listę VFS"
|
||
|
||
#: tfrmmain.actoperationsviewer.caption
|
||
msgid "Operations &Viewer"
|
||
msgstr "Podgląd &operacji"
|
||
|
||
#: tfrmmain.actoptions.caption
|
||
msgid "&Options..."
|
||
msgstr "Opcje"
|
||
|
||
#: tfrmmain.actpackfiles.caption
|
||
msgid "&Pack Files..."
|
||
msgstr "S&pakuj pliki"
|
||
|
||
#: tfrmmain.actpanelssplitterperpos.caption
|
||
msgid "Set splitter position"
|
||
msgstr "Ustaw położenie elementu rozdzielającego"
|
||
|
||
#: tfrmmain.actpastefromclipboard.caption
|
||
msgid "&Paste"
|
||
msgstr "Wklej"
|
||
|
||
#: tfrmmain.actpreviousfavoritetabs.caption
|
||
msgid "Load the Previous Favorite Tabs in the list"
|
||
msgstr "Wczytaj poprzednie Ulubione zakładki z listy"
|
||
|
||
#: tfrmmain.actprevtab.caption
|
||
msgid "Switch to &Previous Tab"
|
||
msgstr "Wróć do &poprzedniej zakładki"
|
||
|
||
#: tfrmmain.actquickfilter.caption
|
||
msgid "Quick filter"
|
||
msgstr "Szybki filtr"
|
||
|
||
#: tfrmmain.actquicksearch.caption
|
||
msgid "Quick search"
|
||
msgstr "Szybkie wyszukiwanie"
|
||
|
||
#: tfrmmain.actquickview.caption
|
||
msgid "&Quick View Panel"
|
||
msgstr "&Panel szybkiego podglądu"
|
||
|
||
#: tfrmmain.actrefresh.caption
|
||
msgid "&Refresh"
|
||
msgstr "Odśwież"
|
||
|
||
#: tfrmmain.actreloadfavoritetabs.caption
|
||
msgid "Reload the last Favorite Tabs loaded"
|
||
msgstr "Wczytaj ponownie ostatnio wczytane Ulubione zakładki"
|
||
|
||
#: tfrmmain.actrename.caption
|
||
msgctxt "tfrmmain.actrename.caption"
|
||
msgid "Move"
|
||
msgstr "Przenieś"
|
||
|
||
#: tfrmmain.actrenamenoask.caption
|
||
msgid "Move/Rename files without asking for confirmation"
|
||
msgstr "Przenieś/zmień nazwę bez potwierdzania"
|
||
|
||
#: tfrmmain.actrenameonly.caption
|
||
msgctxt "tfrmmain.actrenameonly.caption"
|
||
msgid "Rename"
|
||
msgstr "Zmień nazwę"
|
||
|
||
#: tfrmmain.actrenametab.caption
|
||
msgid "&Rename Tab"
|
||
msgstr "Zmień &nazwę zakładki"
|
||
|
||
#: tfrmmain.actresavefavoritetabs.caption
|
||
msgid "Resave on the last Favorite Tabs loaded"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrestoreselection.caption
|
||
msgid "&Restore Selection"
|
||
msgstr "&Przywróć wybór"
|
||
|
||
#: tfrmmain.actreverseorder.caption
|
||
msgid "Re&verse Order"
|
||
msgstr "&Odwrotna kolejność"
|
||
|
||
#: tfrmmain.actrightbriefview.caption
|
||
msgid "Brief view on right panel"
|
||
msgstr "Krótki widok z prawym panelu"
|
||
|
||
#: tfrmmain.actrightcolumnsview.caption
|
||
msgid "Columns view on right panel"
|
||
msgstr "Widok kolumn w prawym panelu"
|
||
|
||
#: tfrmmain.actrightequalleft.caption
|
||
msgid "Right &= Left"
|
||
msgstr "Prawy &= lewy"
|
||
|
||
#: tfrmmain.actrightflatview.caption
|
||
msgid "&Flat view on right panel"
|
||
msgstr "Płaski widok w prawym panelu"
|
||
|
||
#: tfrmmain.actrightopendrives.caption
|
||
msgid "Open right drive list"
|
||
msgstr "Otwórz listę dysków z prawej"
|
||
|
||
#: tfrmmain.actrightreverseorder.caption
|
||
msgid "Re&verse order on right panel"
|
||
msgstr "Odwróć kolejnoś w prawym panelu"
|
||
|
||
#: tfrmmain.actrightsortbyattr.caption
|
||
msgid "Sort right panel by &Attributes"
|
||
msgstr "Sortuj prawy panel wg &Atrybutów"
|
||
|
||
#: tfrmmain.actrightsortbydate.caption
|
||
msgid "Sort right panel by &Date"
|
||
msgstr "Sortuj prawy panel wg &Daty"
|
||
|
||
#: tfrmmain.actrightsortbyext.caption
|
||
msgid "Sort right panel by &Extension"
|
||
msgstr "Sortuj prawy panel wg Rozsz&erzenia"
|
||
|
||
#: tfrmmain.actrightsortbyname.caption
|
||
msgid "Sort right panel by &Name"
|
||
msgstr "Sortuj prawy panel wg &Nazwy"
|
||
|
||
#: tfrmmain.actrightsortbysize.caption
|
||
msgid "Sort right panel by &Size"
|
||
msgstr "SOrtuj prawy panel wg Rozmiaru"
|
||
|
||
#: tfrmmain.actrightthumbview.caption
|
||
msgid "Thumbnails view on right panel"
|
||
msgstr "Widok miniatur w prawym panelu"
|
||
|
||
#: tfrmmain.actrunterm.caption
|
||
msgid "Run &Terminal"
|
||
msgstr "Otwórz &terminal"
|
||
|
||
#: tfrmmain.actsavefavoritetabs.caption
|
||
msgid "Save current tabs to a New Favorite Tabs"
|
||
msgstr "Zapisz bieżące zakładki do Nowych Ulubionych Zakładek"
|
||
|
||
#: tfrmmain.actsaveselection.caption
|
||
msgid "Sa&ve Selection"
|
||
msgstr "&Zapisz wybór"
|
||
|
||
#: tfrmmain.actsaveselectiontofile.caption
|
||
msgid "Save S&election to File..."
|
||
msgstr "Z&apisz wybór do pliku..."
|
||
|
||
#: tfrmmain.actsavetabs.caption
|
||
msgid "&Save Tabs to File"
|
||
msgstr "Zapi&sz zakładki do pliku"
|
||
|
||
#: tfrmmain.actsearch.caption
|
||
msgid "&Search..."
|
||
msgstr "&Znajdź..."
|
||
|
||
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
||
msgid "All tabs Locked with Dir Opened in New Tabs"
|
||
msgstr "Wszystkie zakładki Zablokowane z otwieraniem katalogów w nowych zakładkach"
|
||
|
||
#: tfrmmain.actsetalltabsoptionnormal.caption
|
||
msgid "Set all tabs to Normal"
|
||
msgstr "Ustaw wszystkie zakładki jako Normalne"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
||
msgid "Set all tabs to Locked"
|
||
msgstr "Ustaw wszystkie zakładki jako Zablokowane"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
||
msgid "All tabs Locked with Dir Changes Allowed"
|
||
msgstr "Wszystkie zakładki Zablokowane z możliwością zmiany katalogu"
|
||
|
||
#: tfrmmain.actsetfileproperties.caption
|
||
msgid "Change &Attributes..."
|
||
msgstr "Zmień &atrybuty..."
|
||
|
||
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
||
msgid "Locked with Directories Opened in New &Tabs"
|
||
msgstr "Katalogi otwierane w &nowych zakładkach"
|
||
|
||
#: tfrmmain.actsettaboptionnormal.caption
|
||
msgid "&Normal"
|
||
msgstr "&Normalna"
|
||
|
||
#: tfrmmain.actsettaboptionpathlocked.caption
|
||
msgid "&Locked"
|
||
msgstr "&Zablokowana"
|
||
|
||
#: tfrmmain.actsettaboptionpathresets.caption
|
||
msgid "Locked with &Directory Changes Allowed"
|
||
msgstr "Zablokowana, ale możliwa zmiana &katalogu"
|
||
|
||
#: tfrmmain.actshellexecute.caption
|
||
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Otwórz"
|
||
|
||
#: tfrmmain.actshellexecute.hint
|
||
msgid "Open using system associations"
|
||
msgstr "Otwórz za pomocą skojarzeń systemowych"
|
||
|
||
#: tfrmmain.actshowbuttonmenu.caption
|
||
msgid "Show button menu"
|
||
msgstr "Pokaż menu na przyciskach"
|
||
|
||
#: tfrmmain.actshowcmdlinehistory.caption
|
||
msgid "Show command line history"
|
||
msgstr "Pokaż historie linii poleceń"
|
||
|
||
#: tfrmmain.actshowmainmenu.caption
|
||
msgid "Menu"
|
||
msgstr "Menu"
|
||
|
||
#: tfrmmain.actshowsysfiles.caption
|
||
msgid "Show &Hidden/System Files"
|
||
msgstr "Pokaż pliki &ukryte/systemowe"
|
||
|
||
#: tfrmmain.actsortbyattr.caption
|
||
msgid "Sort by &Attributes"
|
||
msgstr "Sortuj wg &atrybutów"
|
||
|
||
#: tfrmmain.actsortbydate.caption
|
||
msgid "Sort by &Date"
|
||
msgstr "Sortuj wg &daty"
|
||
|
||
#: tfrmmain.actsortbyext.caption
|
||
msgid "Sort by &Extension"
|
||
msgstr "Sortuj wg rozszerzenia"
|
||
|
||
#: tfrmmain.actsortbyname.caption
|
||
msgid "Sort by &Name"
|
||
msgstr "Sortuj wg &nazwy"
|
||
|
||
#: tfrmmain.actsortbysize.caption
|
||
msgid "Sort by &Size"
|
||
msgstr "Sortuj wg &wielkości"
|
||
|
||
#: tfrmmain.actsrcopendrives.caption
|
||
msgid "Open drive list"
|
||
msgstr "Otwórz listę dysków"
|
||
|
||
#: tfrmmain.actswitchignorelist.caption
|
||
msgid "Enable/disable ignore list file to not show file names"
|
||
msgstr "Włącz/wyłącz plik ignorowania plików, aby nie pokazywać nazw plików"
|
||
|
||
#: tfrmmain.actsymlink.caption
|
||
msgid "Create Symbolic &Link..."
|
||
msgstr "Utwórz link &symboliczny..."
|
||
|
||
#: tfrmmain.actsyncdirs.caption
|
||
msgid "Synchronize dirs..."
|
||
msgstr "Synchronizuj katalogi..."
|
||
|
||
#: tfrmmain.acttargetequalsource.caption
|
||
msgid "Target &= Source"
|
||
msgstr "Wyrównaj zawartości okien"
|
||
|
||
#: tfrmmain.acttestarchive.caption
|
||
msgid "&Test Archive(s)"
|
||
msgstr "Testuj ar&chiwum"
|
||
|
||
#: tfrmmain.actthumbnailsview.caption
|
||
msgctxt "tfrmmain.actthumbnailsview.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Miniatury"
|
||
|
||
#: tfrmmain.actthumbnailsview.hint
|
||
msgid "Thumbnails View"
|
||
msgstr "Widok miniatur"
|
||
|
||
#: tfrmmain.acttogglefullscreenconsole.caption
|
||
msgid "Toggle fullscreen mode console"
|
||
msgstr "Przełącz pełnoekranowy tryb konsoli"
|
||
|
||
#: tfrmmain.acttransferleft.caption
|
||
msgid "Transfer dir under cursor to left window"
|
||
msgstr "Otwórz ten katalog w lewym oknie"
|
||
|
||
#: tfrmmain.acttransferright.caption
|
||
msgid "Transfer dir under cursor to right window"
|
||
msgstr "Otwórz ten katalog w prawym oknie"
|
||
|
||
#: tfrmmain.acttreeview.caption
|
||
msgid "&Tree View Panel"
|
||
msgstr "Panel widoku drzewa"
|
||
|
||
#: tfrmmain.actuniversalsingledirectsort.caption
|
||
msgid "Sort according to parameters"
|
||
msgstr "Sortuj według parametrów"
|
||
|
||
#: tfrmmain.actunmarkcurrentextension.caption
|
||
msgid "Unselect All with the Same Ex&tension"
|
||
msgstr "Odznacz wszystko z tym samym rozszerzeniem"
|
||
|
||
#: tfrmmain.actunmarkcurrentname.caption
|
||
msgid "Unselect all files with same name"
|
||
msgstr "Odznacz wszystkie pliki z tą samą nazwą"
|
||
|
||
#: tfrmmain.actunmarkcurrentnameext.caption
|
||
msgid "Unselect all files with same name and extension"
|
||
msgstr "Odznacz wszystkie pliki z tą samą nazwą i rozszerzeniem"
|
||
|
||
#: tfrmmain.actunmarkcurrentpath.caption
|
||
msgid "Unselect all in same path"
|
||
msgstr "Odznacz wszystkie z tą samą ścieżką"
|
||
|
||
#: tfrmmain.actview.caption
|
||
msgctxt "TFRMMAIN.ACTVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Podgląd"
|
||
|
||
#: tfrmmain.actviewhistory.caption
|
||
msgid "Show history of visited paths for active view"
|
||
msgstr "Pokaż historię odwiedzanych ścieżek dla aktywnego widoku"
|
||
|
||
#: tfrmmain.actviewhistorynext.caption
|
||
msgid "Go to next entry in history"
|
||
msgstr "Przejdź do następnego wpisu w historii"
|
||
|
||
#: tfrmmain.actviewhistoryprev.caption
|
||
msgid "Go to previous entry in history"
|
||
msgstr "Przejdź do poprzedniego wpisu w historii"
|
||
|
||
#: tfrmmain.actviewlogfile.caption
|
||
msgid "View log file"
|
||
msgstr "Podgląd pliku dziennika"
|
||
|
||
#: tfrmmain.actviewsearches.caption
|
||
msgid "View current search instances"
|
||
msgstr "Zobacz wystąpienia bieżącego wyszukiwania"
|
||
|
||
#: tfrmmain.actvisithomepage.caption
|
||
msgid "&Visit Double Commander Website"
|
||
msgstr "&Odwiedź stronę Double Commander"
|
||
|
||
#: tfrmmain.actwipe.caption
|
||
msgid "Wipe"
|
||
msgstr "Wyczyść"
|
||
|
||
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
||
msgid "Work with Directory Hotlist and parameters"
|
||
msgstr "Praca z ulubionymi katalogami i parametrami"
|
||
|
||
#: tfrmmain.btnf10.caption
|
||
msgctxt "TFRMMAIN.BTNF10.CAPTION"
|
||
msgid "Exit"
|
||
msgstr "Wyjście"
|
||
|
||
#: tfrmmain.btnf7.caption
|
||
msgctxt "tfrmmain.btnf7.caption"
|
||
msgid "Directory"
|
||
msgstr "Katalog"
|
||
|
||
#: tfrmmain.btnf8.caption
|
||
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmmain.btnf9.caption
|
||
msgctxt "tfrmmain.btnf9.caption"
|
||
msgid "Terminal"
|
||
msgstr "Terminal"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.hint
|
||
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Ulubione katalogi"
|
||
|
||
#: tfrmmain.btnleftequalright.caption
|
||
msgctxt "tfrmmain.btnleftequalright.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmmain.btnleftequalright.hint
|
||
msgid "Show current directory of the right panel in the left panel"
|
||
msgstr "Pokaż bieżący katalog prawego panelu w lewym panelu"
|
||
|
||
#: tfrmmain.btnlefthome.caption
|
||
msgctxt "tfrmmain.btnlefthome.caption"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnlefthome.hint
|
||
msgid "Go to home directory"
|
||
msgstr "Idź do katalogu domowego"
|
||
|
||
#: tfrmmain.btnleftroot.caption
|
||
msgctxt "tfrmmain.btnleftroot.caption"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnleftroot.hint
|
||
msgid "Go to root directory"
|
||
msgstr "Idź do katalogu głównego"
|
||
|
||
#: tfrmmain.btnleftup.caption
|
||
msgctxt "tfrmmain.btnleftup.caption"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.btnleftup.hint
|
||
msgid "Go to parent directory"
|
||
msgstr "Przejdź do katalogu nadrzędnego"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.hint
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Lista katalogów"
|
||
|
||
#: tfrmmain.btnrightequalleft.caption
|
||
msgctxt "tfrmmain.btnrightequalleft.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmmain.btnrightequalleft.hint
|
||
msgid "Show current directory of the left panel in the right panel"
|
||
msgstr "Pokaż bieżący katalog lewego panelu w prawym panelu"
|
||
|
||
#: tfrmmain.btnrighthome.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnrightroot.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnrightup.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.caption
|
||
msgctxt "TFRMMAIN.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmain.lblcommandpath.caption
|
||
msgctxt "tfrmmain.lblcommandpath.caption"
|
||
msgid "Path"
|
||
msgstr "Ścieżka"
|
||
|
||
#: tfrmmain.menuitem2.caption
|
||
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mi2080.caption
|
||
msgid "&20/80"
|
||
msgstr "&20/80"
|
||
|
||
#: tfrmmain.mi3070.caption
|
||
msgid "&30/70"
|
||
msgstr "&30/70"
|
||
|
||
#: tfrmmain.mi4060.caption
|
||
msgid "&40/60"
|
||
msgstr "&40/60"
|
||
|
||
#: tfrmmain.mi5050.caption
|
||
msgid "&50/50"
|
||
msgstr "&50/50"
|
||
|
||
#: tfrmmain.mi6040.caption
|
||
msgid "&60/40"
|
||
msgstr "&60/40"
|
||
|
||
#: tfrmmain.mi7030.caption
|
||
msgid "&70/30"
|
||
msgstr "&70/30"
|
||
|
||
#: tfrmmain.mi8020.caption
|
||
msgid "&80/20"
|
||
msgstr "&80/20"
|
||
|
||
#: tfrmmain.micancel.caption
|
||
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmmain.micopy.caption
|
||
msgid "Copy..."
|
||
msgstr "Kopiuj..."
|
||
|
||
#: tfrmmain.mihardlink.caption
|
||
msgid "Create link..."
|
||
msgstr "Utwórz link..."
|
||
|
||
#: tfrmmain.miline1.caption
|
||
msgctxt "TFRMMAIN.MILINE1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline10.caption
|
||
msgctxt "TFRMMAIN.MILINE10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline11.caption
|
||
msgctxt "TFRMMAIN.MILINE11.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline12.caption
|
||
msgctxt "TFRMMAIN.MILINE12.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline13.caption
|
||
msgctxt "TFRMMAIN.MILINE13.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline14.caption
|
||
msgctxt "TFRMMAIN.MILINE14.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline15.caption
|
||
msgctxt "TFRMMAIN.MILINE15.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline16.caption
|
||
msgctxt "TFRMMAIN.MILINE16.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline17.caption
|
||
msgctxt "TFRMMAIN.MILINE17.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline18.caption
|
||
msgctxt "TFRMMAIN.MILINE18.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline19.caption
|
||
msgctxt "TFRMMAIN.MILINE19.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline2.caption
|
||
msgctxt "TFRMMAIN.MILINE2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline20.caption
|
||
msgctxt "TFRMMAIN.MILINE20.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline21.caption
|
||
msgctxt "TFRMMAIN.MILINE21.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline22.caption
|
||
msgctxt "TFRMMAIN.MILINE22.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline23.caption
|
||
msgctxt "TFRMMAIN.MILINE23.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline24.caption
|
||
msgctxt "TFRMMAIN.MILINE24.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline25.caption
|
||
msgctxt "TFRMMAIN.MILINE25.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline26.caption
|
||
msgctxt "TFRMMAIN.MILINE26.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline3.caption
|
||
msgctxt "TFRMMAIN.MILINE3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline32.caption
|
||
msgctxt "TFRMMAIN.MILINE32.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline33.caption
|
||
msgctxt "TFRMMAIN.MILINE33.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline37.caption
|
||
msgctxt "TFRMMAIN.MILINE37.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline38.caption
|
||
msgctxt "TFRMMAIN.MILINE38.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline39.caption
|
||
msgctxt "TFRMMAIN.MILINE39.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline4.caption
|
||
msgctxt "TFRMMAIN.MILINE4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline40.caption
|
||
msgctxt "TFRMMAIN.MILINE40.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline47.caption
|
||
msgctxt "TFRMMAIN.MILINE47.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline5.caption
|
||
msgctxt "TFRMMAIN.MILINE5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline50.caption
|
||
msgctxt "TFRMMAIN.MILINE50.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline55.caption
|
||
msgctxt "TFRMMAIN.MILINE55.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline6.caption
|
||
msgctxt "TFRMMAIN.MILINE6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline7.caption
|
||
msgctxt "TFRMMAIN.MILINE7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline8.caption
|
||
msgctxt "TFRMMAIN.MILINE8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline9.caption
|
||
msgctxt "TFRMMAIN.MILINE9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.milogclear.caption
|
||
msgid "Clear"
|
||
msgstr "Wyczyść"
|
||
|
||
#: tfrmmain.milogcopy.caption
|
||
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmmain.miloghide.caption
|
||
msgid "Hide"
|
||
msgstr "Ukryj"
|
||
|
||
#: tfrmmain.milogselectall.caption
|
||
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Zaznacz wszystko"
|
||
|
||
#: tfrmmain.mimove.caption
|
||
msgid "Move..."
|
||
msgstr "Przenieś..."
|
||
|
||
#: tfrmmain.misymlink.caption
|
||
msgid "Create symlink..."
|
||
msgstr "Utwórz link symboliczny..."
|
||
|
||
#: tfrmmain.mitaboptions.caption
|
||
msgid "Tab options"
|
||
msgstr "Opcje zakładek"
|
||
|
||
#: tfrmmain.mitrayiconexit.caption
|
||
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Koniec"
|
||
|
||
#: tfrmmain.mitrayiconrestore.caption
|
||
msgid "Restore"
|
||
msgstr "Przywróć"
|
||
|
||
#: tfrmmain.mnualloperpause.caption
|
||
msgctxt "tfrmmain.mnualloperpause.caption"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmmain.mnualloperstart.caption
|
||
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
|
||
msgid "Start"
|
||
msgstr "Start"
|
||
|
||
#: tfrmmain.mnualloperstop.caption
|
||
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmmain.mnucmd.caption
|
||
msgid "&Commands"
|
||
msgstr "Polecenia"
|
||
|
||
#: tfrmmain.mnuconfig.caption
|
||
msgid "C&onfiguration"
|
||
msgstr "Konfiguracja"
|
||
|
||
#: tfrmmain.mnucontextline1.caption
|
||
msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnucontextline2.caption
|
||
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnufavoritetabs.caption
|
||
msgid "Favorites"
|
||
msgstr "Ulubione"
|
||
|
||
#: tfrmmain.mnufiles.caption
|
||
msgid "&Files"
|
||
msgstr "Pliki"
|
||
|
||
#: tfrmmain.mnuhelp.caption
|
||
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmmain.mnumark.caption
|
||
msgid "&Mark"
|
||
msgstr "Zaznacz"
|
||
|
||
#: tfrmmain.mnunetwork.caption
|
||
msgctxt "tfrmmain.mnunetwork.caption"
|
||
msgid "Network"
|
||
msgstr "Sieć"
|
||
|
||
#: tfrmmain.mnushow.caption
|
||
msgid "&Show"
|
||
msgstr "Widok"
|
||
|
||
#: tfrmmain.mnutaboptions.caption
|
||
msgid "Tab &Options"
|
||
msgstr "&Opcje"
|
||
|
||
#: tfrmmain.mnutabs.caption
|
||
msgid "&Tabs"
|
||
msgstr "Zakładki"
|
||
|
||
#: tfrmmain.tbchangedir.caption
|
||
msgid "CD"
|
||
msgstr "CD"
|
||
|
||
#: tfrmmain.tbcopy.caption
|
||
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmmain.tbcut.caption
|
||
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Wytnij"
|
||
|
||
#: tfrmmain.tbdelete.caption
|
||
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmmain.tbedit.caption
|
||
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Edytuj"
|
||
|
||
#: tfrmmain.tbpaste.caption
|
||
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Wstaw"
|
||
|
||
#: tfrmmain.tbseparator.caption
|
||
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmaincommandsdlg.btncancel.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmmaincommandsdlg.btnok.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmmaincommandsdlg.caption
|
||
msgid "Select your internal command"
|
||
msgstr "Wybierz wewnętrzne polecenie"
|
||
|
||
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
||
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
|
||
msgid "Legacy sorted"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
||
msgid "Select all categories by default"
|
||
msgstr "Wybierz wszystkie kategorie z domyślnych"
|
||
|
||
#: tfrmmaincommandsdlg.gbselection.caption
|
||
msgid "Selection:"
|
||
msgstr "Zaznaczenie:"
|
||
|
||
#: tfrmmaincommandsdlg.lblcategory.caption
|
||
msgid "&Categories:"
|
||
msgstr "&Kategorie:"
|
||
|
||
#: tfrmmaincommandsdlg.lblcommandname.caption
|
||
msgid "Command &name:"
|
||
msgstr "&Nazwa polecenia:"
|
||
|
||
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
||
msgid "&Filter:"
|
||
msgstr "&Filtr:"
|
||
|
||
#: tfrmmaincommandsdlg.lblhint.caption
|
||
msgid "Hint:"
|
||
msgstr "Wskazówka:"
|
||
|
||
#: tfrmmaincommandsdlg.lblhotkey.caption
|
||
msgid "Hotkey:"
|
||
msgstr "Skrót:"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
||
msgid "cm_name"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
||
msgid "Category"
|
||
msgstr "Kategoria"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
||
msgid "Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
||
msgid "Hint"
|
||
msgstr "Wskazówka"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
||
msgid "Hotkey"
|
||
msgstr "Skrót"
|
||
|
||
#: tfrmmaskinputdlg.btnaddattribute.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNADDATTRIBUTE.CAPTION"
|
||
msgid "&Add"
|
||
msgstr "Dod&aj"
|
||
|
||
#: tfrmmaskinputdlg.btnattrshelp.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmmaskinputdlg.btncancel.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
||
msgid "&Define..."
|
||
msgstr "Definiuj..."
|
||
|
||
#: tfrmmaskinputdlg.btnok.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
||
msgid "Case sensitive"
|
||
msgstr "Wielkość liter"
|
||
|
||
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
||
msgid "Ignore accents and ligatures"
|
||
msgstr "Ignoruj akcenty i ligatury"
|
||
|
||
#: tfrmmaskinputdlg.lblattributes.caption
|
||
msgid "Attri&butes:"
|
||
msgstr "Atry&buty:"
|
||
|
||
#: tfrmmaskinputdlg.lblprompt.caption
|
||
msgid "Input Mask:"
|
||
msgstr "Wprowadź maskę:"
|
||
|
||
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
||
msgid "O&r select predefined selection type:"
|
||
msgstr "Lub wybierz predefiniowany rodzaj zaznaczenia:"
|
||
|
||
#: tfrmmkdir.btncancel.caption
|
||
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmmkdir.btnok.caption
|
||
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmmkdir.caption
|
||
msgid "Create new directory"
|
||
msgstr "Utwórz nowy katalog"
|
||
|
||
#: tfrmmkdir.lblmakedir.caption
|
||
msgid "&Input new directory name:"
|
||
msgstr "Podaj nazwę katalogu:"
|
||
|
||
#: tfrmmodview.btnpath1.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath2.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath3.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath4.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath5.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.caption
|
||
msgctxt "tfrmmodview.caption"
|
||
msgid "New Size"
|
||
msgstr "Nowy rozmiar"
|
||
|
||
#: tfrmmodview.lblheight.caption
|
||
msgid "Height :"
|
||
msgstr "Wysokość:"
|
||
|
||
#: tfrmmodview.lblpath1.caption
|
||
msgctxt "tfrmmodview.lblpath1.caption"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmodview.lblpath2.caption
|
||
msgid "2"
|
||
msgstr "2"
|
||
|
||
#: tfrmmodview.lblpath3.caption
|
||
msgid "3"
|
||
msgstr "3"
|
||
|
||
#: tfrmmodview.lblpath4.caption
|
||
msgid "4"
|
||
msgstr "4"
|
||
|
||
#: tfrmmodview.lblpath5.caption
|
||
msgid "5"
|
||
msgstr "5"
|
||
|
||
#: tfrmmodview.lblquality.caption
|
||
msgid "Quality of compress to Jpg"
|
||
msgstr "Jakośc kompresji do Jpg"
|
||
|
||
#: tfrmmodview.lblwidth.caption
|
||
msgid "Width :"
|
||
msgstr "Szerokość:"
|
||
|
||
#: tfrmmodview.rbbmp.caption
|
||
msgid "BMP"
|
||
msgstr "BMP"
|
||
|
||
#: tfrmmodview.rbico.caption
|
||
msgid "ICO"
|
||
msgstr "ICO"
|
||
|
||
#: tfrmmodview.rbjpg.caption
|
||
msgid "JPG"
|
||
msgstr "JPG"
|
||
|
||
#: tfrmmodview.rbpng.caption
|
||
msgid "PNG"
|
||
msgstr "PNG"
|
||
|
||
#: tfrmmodview.rbpnm.caption
|
||
msgid "PNM"
|
||
msgstr "PNM"
|
||
|
||
#: tfrmmodview.teheight.text
|
||
msgctxt "tfrmmodview.teheight.text"
|
||
msgid "Height"
|
||
msgstr "Wysokość"
|
||
|
||
#: tfrmmodview.tequality.text
|
||
msgid "80"
|
||
msgstr "80"
|
||
|
||
#: tfrmmodview.tewidth.text
|
||
msgctxt "tfrmmodview.tewidth.text"
|
||
msgid "Width"
|
||
msgstr "Cyfry"
|
||
|
||
#: tfrmmsg.lblmsg.caption
|
||
msgid "456456465465465"
|
||
msgstr "456456465465465"
|
||
|
||
#: tfrmmultirename.btnclose.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Zamknij"
|
||
|
||
#: tfrmmultirename.btndeletepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmmultirename.btnedit.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Edytuj"
|
||
|
||
#: tfrmmultirename.btnextmenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnloadpreset.caption
|
||
msgid "&Load"
|
||
msgstr "Wczytaj"
|
||
|
||
#: tfrmmultirename.btnnamemenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnrename.caption
|
||
msgctxt "tfrmmultirename.btnrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "Zmień nazwę"
|
||
|
||
#: tfrmmultirename.btnrestore.caption
|
||
msgid "Reset &all"
|
||
msgstr "Porzuć wszystko"
|
||
|
||
#: tfrmmultirename.btnsavepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Zapisz"
|
||
|
||
#: tfrmmultirename.caption
|
||
msgid "MultiRename"
|
||
msgstr "Wielokrotna zmiana nazwy"
|
||
|
||
#: tfrmmultirename.cblog.caption
|
||
msgid "Ena&ble"
|
||
msgstr "Włącz"
|
||
|
||
#: tfrmmultirename.cbregexp.caption
|
||
msgid "Regular e&xpressions"
|
||
msgstr "Wyrażenie regularne"
|
||
|
||
#: tfrmmultirename.cbusesubs.caption
|
||
msgid "&Use substitution"
|
||
msgstr "Podmiana"
|
||
|
||
#: tfrmmultirename.cmbxwidth.text
|
||
msgid "01"
|
||
msgstr "01"
|
||
|
||
#: tfrmmultirename.edinterval.text
|
||
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.edpoc.text
|
||
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.extension.caption
|
||
msgid "[E] Extension"
|
||
msgstr "[E] Rozszerzenie"
|
||
|
||
#: tfrmmultirename.gbcounter.caption
|
||
msgid "Counter"
|
||
msgstr "Licznik"
|
||
|
||
#: tfrmmultirename.gbfindreplace.caption
|
||
msgid "Find && Replace"
|
||
msgstr "Znajdź i zamień"
|
||
|
||
#: tfrmmultirename.gblog.caption
|
||
msgid "Log Result"
|
||
msgstr "Rezultat"
|
||
|
||
#: tfrmmultirename.gbmaska.caption
|
||
msgid "Mask"
|
||
msgstr "Maska"
|
||
|
||
#: tfrmmultirename.gbpresets.caption
|
||
msgid "Presets"
|
||
msgstr "Wzorce"
|
||
|
||
#: tfrmmultirename.lbext.caption
|
||
msgid "&Extension"
|
||
msgstr "Rozszerzenie"
|
||
|
||
#: tfrmmultirename.lbfind.caption
|
||
msgid "&Find..."
|
||
msgstr "Znajdź"
|
||
|
||
#: tfrmmultirename.lbinterval.caption
|
||
msgid "&Interval"
|
||
msgstr "Przerwa"
|
||
|
||
#: tfrmmultirename.lbname.caption
|
||
msgid "File &Name"
|
||
msgstr "Nazwa pliku"
|
||
|
||
#: tfrmmultirename.lbreplace.caption
|
||
msgid "Re&place..."
|
||
msgstr "Zamień..."
|
||
|
||
#: tfrmmultirename.lbstnb.caption
|
||
msgid "S&tart Number"
|
||
msgstr "Liczba początkowa"
|
||
|
||
#: tfrmmultirename.lbwidth.caption
|
||
msgid "&Width"
|
||
msgstr "Szerokość"
|
||
|
||
#: tfrmmultirename.micounter.caption
|
||
msgid "[C] Counter"
|
||
msgstr "[C] Licznik"
|
||
|
||
#: tfrmmultirename.miday.caption
|
||
msgid "[D] Day"
|
||
msgstr "[D] Dzień"
|
||
|
||
#: tfrmmultirename.miday1.caption
|
||
msgid "[DD] Day (2 digits)"
|
||
msgstr "[DD] Dzień (2 cyfry)"
|
||
|
||
#: tfrmmultirename.miday2.caption
|
||
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
||
msgstr "[DDD] Dzień tygodnia (krótki, np. \"pon\")"
|
||
|
||
#: tfrmmultirename.miday3.caption
|
||
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
||
msgstr "[DDDD] Dzień tygodnia (długi, np. \"poniedziałek\")"
|
||
|
||
#: tfrmmultirename.miextensionx.caption
|
||
msgid "[Ex] Character at position x"
|
||
msgstr "[Ex] Znak na pozycji x"
|
||
|
||
#: tfrmmultirename.miextensionxx.caption
|
||
msgid "[Ex:y] Characters from position x to y"
|
||
msgstr "[Ex:y] Znaki na pozycjach od x do y"
|
||
|
||
#: tfrmmultirename.mihour.caption
|
||
msgid "[h] Hour"
|
||
msgstr "[h] Godzina"
|
||
|
||
#: tfrmmultirename.mihour1.caption
|
||
msgid "[hh] Hour (2 digits)"
|
||
msgstr "[hh] Godzina (2 cyfry)"
|
||
|
||
#: tfrmmultirename.miminute.caption
|
||
msgid "[n] Minute"
|
||
msgstr "[n] Minuta"
|
||
|
||
#: tfrmmultirename.miminute1.caption
|
||
msgid "[nn] Minute (2 digits)"
|
||
msgstr "[nn] Minuty (2 cyfry)"
|
||
|
||
#: tfrmmultirename.mimonth.caption
|
||
msgid "[M] Month"
|
||
msgstr "[М] Miesiąc"
|
||
|
||
#: tfrmmultirename.mimonth1.caption
|
||
msgid "[MM] Month (2 digits)"
|
||
msgstr "[MM] Miesiąc (2 cyfry)"
|
||
|
||
#: tfrmmultirename.mimonth2.caption
|
||
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
||
msgstr "[MMM] Nazwa miesiąca (krótka, np. \"sty\")"
|
||
|
||
#: tfrmmultirename.mimonth3.caption
|
||
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
||
msgstr "[MMMM] Nazwa miesiąca (długa, np. \"styczeń\")"
|
||
|
||
#: tfrmmultirename.miname.caption
|
||
msgid "[N] Name"
|
||
msgstr "[N] Nazwa"
|
||
|
||
#: tfrmmultirename.minamex.caption
|
||
msgid "[Nx] Character at position x"
|
||
msgstr "[Nx] Znak na pozycji x"
|
||
|
||
#: tfrmmultirename.minamexx.caption
|
||
msgid "[Nx:y] Characters from position x to y"
|
||
msgstr "[Nx:x] Znaki na pozycjach od x do y"
|
||
|
||
#: tfrmmultirename.minext.caption
|
||
msgid "Time..."
|
||
msgstr "Czas..."
|
||
|
||
#: tfrmmultirename.minextextension.caption
|
||
msgid "Extension..."
|
||
msgstr "Rozszerzenie..."
|
||
|
||
#: tfrmmultirename.minextname.caption
|
||
msgid "Name..."
|
||
msgstr "Nazwa..."
|
||
|
||
#: tfrmmultirename.miplugin.caption
|
||
msgctxt "tfrmmultirename.miplugin.caption"
|
||
msgid "Plugin"
|
||
msgstr "Wtyczka"
|
||
|
||
#: tfrmmultirename.misecond.caption
|
||
msgid "[s] Second"
|
||
msgstr "[s] sekunda"
|
||
|
||
#: tfrmmultirename.misecond1.caption
|
||
msgid "[ss] Second (2 digits)"
|
||
msgstr "[ss] Sekundy (2 cyfry)"
|
||
|
||
#: tfrmmultirename.miyear.caption
|
||
msgid "[Y] Year (2 digits)"
|
||
msgstr "[Y] Rok (2 cyfry)"
|
||
|
||
#: tfrmmultirename.miyear1.caption
|
||
msgid "[YYYY] Year (4 digits)"
|
||
msgstr "[YYYY] Rok (4 cyfry)"
|
||
|
||
#: tfrmmultirename.mnueditnames.caption
|
||
msgid "Edit names..."
|
||
msgstr "Edytuj nazw..."
|
||
|
||
#: tfrmmultirename.mnuloadfromfile.caption
|
||
msgid "Load names from file..."
|
||
msgstr "Wczytaj nazwy z pliku..."
|
||
|
||
#: tfrmmultirename.n1.caption
|
||
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n2.caption
|
||
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n3.caption
|
||
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n4.caption
|
||
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n5.caption
|
||
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
||
msgid "Old File Name"
|
||
msgstr "Stara nazwa pliku"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
||
msgid "New File Name"
|
||
msgstr "Nowa nazwa pliku"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
||
msgid "File Path"
|
||
msgstr "Ścieżka"
|
||
|
||
#: tfrmmultirenamewait.caption
|
||
msgctxt "TFRMMULTIRENAMEWAIT.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmultirenamewait.lblmessage.caption
|
||
msgid "Click OK when you have closed the editor to load the changed names!"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.caption
|
||
msgid "Choose an application"
|
||
msgstr "Wybierz aplikację"
|
||
|
||
#: tfrmopenwith.chkcustomcommand.caption
|
||
msgid "Custom command"
|
||
msgstr "Własne polecenie"
|
||
|
||
#: tfrmopenwith.chksaveassociation.caption
|
||
msgid "Save association"
|
||
msgstr "Zapisz skojarzenia"
|
||
|
||
#: tfrmopenwith.chkuseasdefault.caption
|
||
msgid "Set selected application as default action"
|
||
msgstr "Ustaw wybraną aplikację jako domyślną akcję"
|
||
|
||
#: tfrmopenwith.lblmimetype.caption
|
||
msgid "File type to be opened: %s"
|
||
msgstr "Typ pliku do otwarcia: %s"
|
||
|
||
#: tfrmopenwith.milistoffiles.caption
|
||
msgid "Multiple file names"
|
||
msgstr "Wiele nazw plików"
|
||
|
||
#: tfrmopenwith.milistoffiles.hint
|
||
msgid "%F"
|
||
msgstr "%F"
|
||
|
||
#: tfrmopenwith.milistofurls.caption
|
||
msgid "Multiple URIs"
|
||
msgstr "Wiele URI"
|
||
|
||
#: tfrmopenwith.milistofurls.hint
|
||
msgid "%U"
|
||
msgstr "%U"
|
||
|
||
#: tfrmopenwith.misinglefilename.caption
|
||
msgid "Single file name"
|
||
msgstr "Pojedyncza nazwa pliku"
|
||
|
||
#: tfrmopenwith.misinglefilename.hint
|
||
msgid "%f"
|
||
msgstr "%f"
|
||
|
||
#: tfrmopenwith.misingleurl.caption
|
||
msgid "Single URI"
|
||
msgstr "Pojedynczy URI"
|
||
|
||
#: tfrmopenwith.misingleurl.hint
|
||
msgid "%u"
|
||
msgstr "%u"
|
||
|
||
#: tfrmoptions.btnapply.caption
|
||
msgid "&Apply"
|
||
msgstr "Zastosuj"
|
||
|
||
#: tfrmoptions.btncancel.caption
|
||
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmoptions.btnok.caption
|
||
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmoptions.caption
|
||
msgctxt "tfrmoptions.caption"
|
||
msgid "Options"
|
||
msgstr "Opcje"
|
||
|
||
#: tfrmoptions.lblemptyeditor.caption
|
||
msgid "Please select one of the subpages, this page does not contain any settings."
|
||
msgstr "Proszę wybrać jedną z podstron, ta strona nie zawiera żadnych ustawień"
|
||
|
||
#: tfrmoptionsarchivers.btnautoconfig.caption
|
||
msgid "A&uto Configure"
|
||
msgstr "Auto konfiguracja"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcadd.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Dodaj"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcapply.caption
|
||
msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption"
|
||
msgid "A&pply"
|
||
msgstr "Zastosuj"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
|
||
msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption"
|
||
msgid "D&elete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcrename.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
|
||
msgid "&Rename"
|
||
msgstr "Zmień nazwę"
|
||
|
||
#: tfrmoptionsarchivers.btnrelativearchiver.hint
|
||
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
|
||
msgid "De&bug mode"
|
||
msgstr "Tryb debugowania"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
|
||
msgid "E&nabled"
|
||
msgstr "Włączone"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
|
||
msgid "S&how console output"
|
||
msgstr "Pokaż wyjście konsoli"
|
||
|
||
#: tfrmoptionsarchivers.gbarchiveroptions.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Opcje"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveadd.caption
|
||
msgid "Add&ing:"
|
||
msgstr "Dodaj:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextension.caption
|
||
msgid "E&xtension:"
|
||
msgstr "Rozszerzenia:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextract.caption
|
||
msgid "Ex&tract:"
|
||
msgstr "Wypakuj:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelist.caption
|
||
msgid "&List:"
|
||
msgstr "Listuj:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistend.caption
|
||
msgid "Listing &finish (optional):"
|
||
msgstr "Koniec listingu (opcjonalnie)"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistformat.caption
|
||
msgid "Listing for&mat:"
|
||
msgstr "Format listingu:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveliststart.caption
|
||
msgid "Listin&g start (optional):"
|
||
msgstr "Początek listingu (opcjonalnie):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiver.caption
|
||
msgid "Arc&hiver:"
|
||
msgstr "Archiwizer:"
|
||
|
||
#: tfrmoptionsarchivers.lbldescription.caption
|
||
msgid "De&scription:"
|
||
msgstr "Opis:"
|
||
|
||
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
||
msgid "Additional"
|
||
msgstr "Dodatkowe"
|
||
|
||
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
||
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
|
||
msgid "General"
|
||
msgstr "Ogólne"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
||
msgid "When &size, date or attributes change"
|
||
msgstr "Po zmianie &wielkości, daty lub atrybutów"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
||
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Dla następujących ścieżek i ich podkatalogów:"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
||
msgid "When &files are created, deleted or renamed"
|
||
msgstr "Po &utworzeniu pliku, skasowaniu i zmianie nazwy"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
||
msgid "When application is in the &background"
|
||
msgstr "Gdy program działa w &tle"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
||
msgid "Disable auto-refresh"
|
||
msgstr "Wyłącz autoodświeżanie"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
||
msgid "Refresh file list"
|
||
msgstr "Odśwież listę plików"
|
||
|
||
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
||
msgid "Al&ways show tray icon"
|
||
msgstr "Ikona zawsze widoczna na pasku"
|
||
|
||
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
||
msgid "Automatically &hide unmounted devices"
|
||
msgstr "Automatycznie ukryj odmontowane urządzenia"
|
||
|
||
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
||
msgid "Mo&ve icon to system tray when minimized"
|
||
msgstr "Pokazuj ikonę na pasku gdy zminimalizowany"
|
||
|
||
#: tfrmoptionsbehavior.cbonlyonce.caption
|
||
msgid "A&llow only one copy of DC at a time"
|
||
msgstr "Pozwól uruchomic tylko jedną kopię DC na raz"
|
||
|
||
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
||
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
||
msgstr "Tu można wpisać jeden lub więcej dysków oddzielonych średnikiem \";\"."
|
||
|
||
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
||
msgid "Drives &blacklist"
|
||
msgstr "Czarna lista napędów"
|
||
|
||
#: tfrmoptionsbriefview.gbcolumns.caption
|
||
msgid "Columns size"
|
||
msgstr "Rozmiar kolumn"
|
||
|
||
#: tfrmoptionsbriefview.gbshowfileext.caption
|
||
msgid "Show file extensions"
|
||
msgstr "Pokaż rozszerzenia pliku"
|
||
|
||
#: tfrmoptionsbriefview.rbaligned.caption
|
||
msgid "ali&gned (with Tab)"
|
||
msgstr "wyrównane (z Tabulatorem)"
|
||
|
||
#: tfrmoptionsbriefview.rbdirectly.caption
|
||
msgid "di&rectly after filename"
|
||
msgstr "bezpośrednio po nazwie pliku"
|
||
|
||
#: tfrmoptionsbriefview.rbuseautosize.caption
|
||
msgid "Auto"
|
||
msgstr "Automatycznie"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
||
msgid "Fixed columns count"
|
||
msgstr "Stała liczba kolumn"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
||
msgid "Fixed columns width"
|
||
msgstr "Stała szerokość kolumn"
|
||
|
||
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
||
msgid "Cut &text to column width"
|
||
msgstr "Obetnij tekst do szerokości kolumny"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
||
msgid "&Horizontal lines"
|
||
msgstr "Linie poziome"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
||
msgid "&Vertical lines"
|
||
msgstr "Linie pionowe"
|
||
|
||
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
||
msgid "A&uto fill columns"
|
||
msgstr "Automatycznie wypełniaj kolumny"
|
||
|
||
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
||
msgid "Show grid"
|
||
msgstr "Pokaż siatkę"
|
||
|
||
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
||
msgid "Auto-size columns"
|
||
msgstr "Autorozmiar kolumn"
|
||
|
||
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
||
msgid "Auto si&ze column:"
|
||
msgstr "Autorozmiar kolumn:"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Zastosuj"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Edytuj"
|
||
|
||
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
||
msgid "Co&mmand line history"
|
||
msgstr "Historię linii poleceń"
|
||
|
||
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
||
msgid "&Directory history"
|
||
msgstr "Historię katalogów"
|
||
|
||
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
||
msgid "&File mask history"
|
||
msgstr "Historię masek plików"
|
||
|
||
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
||
msgid "Sa&ve configuration"
|
||
msgstr "Konfigurację"
|
||
|
||
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
||
msgid "Searc&h/Replace history"
|
||
msgstr "Historię znajdź/zamień"
|
||
|
||
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
||
msgid "Location of configuration files"
|
||
msgstr "Położenie plików konfiguracji"
|
||
|
||
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
||
msgid "Save on exit"
|
||
msgstr "Zapisz przy wyjściu"
|
||
|
||
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
||
msgid "Sort order of configuration order in left tree"
|
||
msgstr "Kolejność sortowania porządku konfiguracji w drzewie po lewej"
|
||
|
||
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
||
msgid "Set on command line"
|
||
msgstr "Ustaw w linii komend"
|
||
|
||
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
||
msgid "P&rogram directory (portable version)"
|
||
msgstr "Katalog programu (wersja portable)"
|
||
|
||
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
||
msgid "&User home directory"
|
||
msgstr "Katalog domowy użytkownika"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszsytkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszytskich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Zastosuj zmiany do wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionscustomcolumns.btnfont.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
||
msgid "Go to set default"
|
||
msgstr "Przejdź do ustawień domyślnych"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
|
||
msgid "New"
|
||
msgstr "Nowy"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnext.caption
|
||
msgid "Next"
|
||
msgstr "Następny"
|
||
|
||
#: tfrmoptionscustomcolumns.btnprev.caption
|
||
msgid "Previous"
|
||
msgstr "Poprzedni"
|
||
|
||
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Zmień nazwę"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Przywróć domyślne"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
|
||
msgid "Save as"
|
||
msgstr "Zapisz jako"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Zapisz"
|
||
|
||
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Zezwól na nakładanie kolorów"
|
||
|
||
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
||
msgid "When clicking to change something, change for all columns"
|
||
msgstr "Po kliknięciu zmiany, zmień dla wszystkich kolumn"
|
||
|
||
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
|
||
msgid "General"
|
||
msgstr "Ogólne"
|
||
|
||
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Obramowanie kursora"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
||
msgid "Use Frame Cursor"
|
||
msgstr "Użyj ramki kursora"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Selection Color"
|
||
msgstr "Użyj koloru nieaktywnego zaznaczenia"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
||
msgid "Use Inverted Selection"
|
||
msgstr "Użyj odwrotnego zaznaczenia"
|
||
|
||
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
||
msgid "Use custom font and color for this view"
|
||
msgstr "Użyj niestandardowej czcionki i koloru dla tego widoku"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
||
msgid "BackGround:"
|
||
msgstr "Tło:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
||
msgid "Background 2:"
|
||
msgstr "Tło 2:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
||
msgid "Con&figure columns view:"
|
||
msgstr "Konfiguracja kolumn dla systemu plików:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
||
msgid "[Current Column Name]"
|
||
msgstr "[Bieżąca nazwa kolumny]"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
||
msgid "Cursor Color:"
|
||
msgstr "Kolor kursora:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
||
msgid "Cursor Text:"
|
||
msgstr "Kolor tekstu pod kursorem:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontname.caption
|
||
msgid "Font:"
|
||
msgstr "Czcionka:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
|
||
msgid "Size:"
|
||
msgstr "Rozmiar:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
||
msgid "Text Color:"
|
||
msgstr "Kolor tekstu:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Kolor nieaktywnego kursora:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Kolor nieaktywnego zazn.:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
||
msgid "Mark Color:"
|
||
msgstr "Kolor zaznaczenia:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
||
msgid "Settings for column:"
|
||
msgstr "Ustawienia dla kolumn:"
|
||
|
||
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
||
msgid "Add column"
|
||
msgstr "Dodaj kolumnę"
|
||
|
||
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
||
msgid "Position of frame panel after the comparison:"
|
||
msgstr "Położenie ramki panelu po porównaniu:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
||
msgid "Add..."
|
||
msgstr "Dodaj.."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
||
msgid "Backup..."
|
||
msgstr "Kopia zapasowa..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
||
msgid "Delete..."
|
||
msgstr "Usuń..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Eksportuj..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION"
|
||
msgid "Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Importuj..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
||
msgid "Insert..."
|
||
msgstr "Wstaw..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
||
msgid "Miscellaneous..."
|
||
msgstr "Różne..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
||
msgid "Some functions to select appropriate target"
|
||
msgstr "Niektóre funkcje by wybrać odpowiedni cel"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
||
msgid "Sort..."
|
||
msgstr "Sortuj..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
||
msgid "When adding directory, add also target"
|
||
msgstr "Gdy dodajesz katalog, dodaj także cel"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
||
msgid "Always expand tree"
|
||
msgstr "Zawsze rozwijaj drzewo"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
||
msgid "Show only valid environment variables"
|
||
msgstr "Pokaż tylko prawidłowe zmienne środowiskowe"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
||
msgid "In popup, show [path also]"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Nazwa, a-z"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
|
||
msgid "Name, a-z"
|
||
msgstr "Nazwa, a-z"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
||
msgid "Directory Hotlist (reorder by drag && drop)"
|
||
msgstr "Lista katalogów (zmień porządek przez \"przeciągnij i upuść\")"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Pozostałe opcje"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
|
||
msgid "Name:"
|
||
msgstr "Nazwa:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
|
||
msgid "Path:"
|
||
msgstr "Ścieżka:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
||
msgid "Target:"
|
||
msgstr "Cel:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miactiveframedirectory.caption
|
||
msgid "directory of the active frame"
|
||
msgstr "Katalog z aktywną ramką"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miactiveinactiveframedirectory.caption
|
||
msgid "directories of the active && inactive frames"
|
||
msgstr "katalogi z aktywnymi && nieaktywnymi ramkami"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcommand.caption
|
||
msgid "a command"
|
||
msgstr "polecenie"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcommand2.caption
|
||
msgid "Add a command"
|
||
msgstr "Dodaj polecenie"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected.caption
|
||
msgid "a copy of the selected entry"
|
||
msgstr "kopia wybranego wpisu"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected2.caption
|
||
msgid "Add a copy of the selected entry"
|
||
msgstr "Dodaj kopię wybranego wpisu"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddseparator.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddseparator.caption"
|
||
msgid "a separator"
|
||
msgstr "separator"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddseparator2.caption
|
||
msgid "Add a separator"
|
||
msgstr "Dodaj separator"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddsubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu.caption"
|
||
msgid "sub-menu"
|
||
msgstr "pod-menu"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption"
|
||
msgid "Add sub-menu"
|
||
msgstr "Dodaj pod-menu"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mibrowsetodirectory.caption
|
||
msgid "directory I will browse to"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micollapseall.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Zwiń wszystko"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentselectedoractivedirectories.caption
|
||
msgid "current selected or active directories of active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micutselection.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MICUTSELECTION.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Wytnij"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption"
|
||
msgid "delete all!"
|
||
msgstr "usuń wszystko!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "podmenu i wszystkie jego elementy"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "tylko podmenu ale zachowaj jego elemnty"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption"
|
||
msgid "selected item"
|
||
msgstr "wybrana pozycja"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Usuń wybraną pozycję"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
||
msgid "Scan all hotdir's path to validate the ones that actually exist"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
||
msgid "Scan all hotdir's path && target to validate the ones that actually exist"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
||
msgid "to a Directory Hotlist file (.hotlist)"
|
||
msgstr "do pliku ulubionych katalogów (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "do \"wincmd.ini\" z TC (zachowaj istniejące)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "do \"wincmd.ini\" z TC (usuń istniejące)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
||
msgid "Go to configure TC related info"
|
||
msgstr "Przejdź do powiązanej informacji konfiguracji TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
|
||
msgid "Go to configure TC related info"
|
||
msgstr "Przejdź do powiązanej informacji konfiguracji TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
||
msgid "HotDirTestMenu"
|
||
msgstr "Menu testowe ulubionych katalogów"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
||
msgid "from a Directory Hotlist file (.hotlist)"
|
||
msgstr "z pliku ulubionych katalogów (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
||
msgid "from \"wincmd.ini\" of TC"
|
||
msgstr "z TC \"wincmd.ini\""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miopenallbranches.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Otwórz wszystkie gałęzie"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mipasteselection.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIPASTESELECTION.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Wstaw"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
||
msgid "Restore a backup of Directory Hotlist"
|
||
msgstr "Przywróć kopię ulubionych katalogów"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
||
msgid "Save a backup of current Directory Hotlist"
|
||
msgstr "Zapisz kopię bieżących ulubionych katalogów"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
||
msgid "Search and replace..."
|
||
msgstr "Znajdź i zamień..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplaceinpath.caption
|
||
msgid "in path..."
|
||
msgstr "w ścieżce..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplaceintargetpath.caption
|
||
msgid "in target path..."
|
||
msgstr "w docelowej ścieżce..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchinreplaceinbothpaths.caption
|
||
msgid "in path and target path..."
|
||
msgstr "w ścieżce i w docelowej ścieżce..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator1.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator10.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator11.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR11.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator12.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR12.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator13.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR13.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator2.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator3.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator4.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator5.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator6.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator7.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator8.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator9.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "...wszystko od A do Z!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr "Testuj wynikowe menu"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory.caption
|
||
msgid "directory I will type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory2.caption
|
||
msgid "Add directory I will type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory3.caption
|
||
msgid "Insert directory I will type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
||
msgid "Addition from main panel:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
||
msgid "From all the supported formats, ask which one to use every time"
|
||
msgstr "Dla wszystkich obsługiwanych formatów, pytaj jakich użyć za każdym razem"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
||
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
||
msgstr "Podczas zapisywania tekstu Unicode, zapisz go w formacie UTF8 (w przeciwnym razie będzie UTF16)"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
||
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
||
msgstr "Po upuszczeniu tekstu, automatycznie generuj nazwę pliku (w przeciwnym razie będzie monitował użytkownika)"
|
||
|
||
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
||
msgid "&Show confirmation dialog after drop"
|
||
msgstr "Pokaż okno dialogowe potwierdzenia po upuszczeniu"
|
||
|
||
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
||
msgid "When drag && dropping text into panels:"
|
||
msgstr "Podczas przeciągania i upuszczania tekstu do paneli:"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
||
msgid "Place the most desired format on top of list (use dag && drop):"
|
||
msgstr "Umieścić najbardziej pożądany format na szczycie listy (użyj przeciągnij i upuść):"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
||
msgid "(if the most desired is not present, we'll take second one and so on)"
|
||
msgstr "(jeśli najbardziej pożądany nie jest obecny, bierzemy drugi i tak dalej)"
|
||
|
||
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
||
msgid "(will not work with some source application, so try to uncheck if problem)"
|
||
msgstr "(jeśli nie działa z jakąś źródłową aplikacją, spróbuj odznaczyć jeśli problem)"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
||
msgid "Show &file system"
|
||
msgstr "Pokaż system plików"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
||
msgid "Show fr&ee space"
|
||
msgstr "Pokaż wolne miejsce"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
||
msgid "Show &label"
|
||
msgstr "Pokaż nazwę"
|
||
|
||
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
||
msgid "Drives list"
|
||
msgstr "Lista urządzeń"
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.caption
|
||
msgid "Caret past end of line"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.caption
|
||
msgid "Show special characters"
|
||
msgstr "Pokaż znaki specjalne"
|
||
|
||
#: tfrmoptionseditor.gbinternaleditor.caption
|
||
msgid "Internal editor options"
|
||
msgstr "Opcje wewnętrznego edytora"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "Tło"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
||
msgid "Bac&kground"
|
||
msgstr "Tło"
|
||
|
||
#: tfrmoptionseditorcolors.btnresetmask.hint
|
||
msgid "Reset"
|
||
msgstr "Resetuj"
|
||
|
||
#: tfrmoptionseditorcolors.btnsavemask.hint
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
|
||
msgid "Save"
|
||
msgstr "Zapisz"
|
||
|
||
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
||
msgid "Element Attributes"
|
||
msgstr "Atrybuty jednostki"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
||
msgid "Fo®round"
|
||
msgstr "Kolor pierwszego planu"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
||
msgid "Fo®round"
|
||
msgstr "Kolor pierwszego planu"
|
||
|
||
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
||
msgid "&Text-mark"
|
||
msgstr "Zaznaczony tekst"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
||
msgid "Use (and edit) &global scheme settings"
|
||
msgstr "Używaj (i edytuj) globalny schemat kolorów"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
||
msgid "Use &local scheme settings"
|
||
msgstr "Używaj własny schemat kolorów"
|
||
|
||
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
||
msgid "&Bold"
|
||
msgstr "Pogrubienie"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "Odwróć"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "Wyłączony"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "Włączony"
|
||
|
||
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
||
msgid "&Italic"
|
||
msgstr "Kursywa"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "Odwróć"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "Wyłączony"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "Włączony"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
||
msgid "&Strike Out"
|
||
msgstr "Przekreślony"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "Odwróć"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "Wyłączony"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "Włączony"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
||
msgid "&Underline"
|
||
msgstr "Podkreślony"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "Odwróć"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "Wyłączony"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "Włączony"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnadd.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION"
|
||
msgid "Add..."
|
||
msgstr "Dodaj..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btndelete.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION"
|
||
msgid "Delete..."
|
||
msgstr "Usuń..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
||
msgid "Import/Export"
|
||
msgstr "Importuj/Eksportuj"
|
||
|
||
#: tfrmoptionsfavoritetabs.btninsert.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION"
|
||
msgid "Insert..."
|
||
msgstr "Wstaw..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnrename.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Zmień nazwę"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnsort.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION"
|
||
msgid "Sort..."
|
||
msgstr "Sortuj..."
|
||
|
||
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "Brak"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION"
|
||
msgid "Always expand tree"
|
||
msgstr "Zawsze rozwiń drzewo"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Nie"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
||
msgid "Left"
|
||
msgstr "Lewy"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
||
msgid "Right"
|
||
msgstr "Prawy"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
||
msgid "Favorite Tabs list (reorder by drag && drop)"
|
||
msgstr "Lista ulubionych zakładek (zmień kolejność przez \"przeciągnij i upuść\")"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION"
|
||
msgid "Other options"
|
||
msgstr "Inne opcje"
|
||
|
||
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
||
msgid "What to restore where for the selected entry:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
||
msgid "Existing tabs to keep:"
|
||
msgstr "Istniejące zakładki do zachowania:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
||
msgid "Save dir history:"
|
||
msgstr "Zapisz historię katalogów"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
||
msgid "Tabs saved on left to be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
||
msgid "Tabs saved on right to be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION"
|
||
msgid "a separator"
|
||
msgstr "separator"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
||
msgid "Add separator"
|
||
msgstr "Dodaj separator"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION"
|
||
msgid "sub-menu"
|
||
msgstr "pod-menu"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION"
|
||
msgid "Add sub-menu"
|
||
msgstr "Dodaj pod-menu"
|
||
|
||
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION"
|
||
msgid "Collapse all"
|
||
msgstr "Zwiń wszystko"
|
||
|
||
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.micutselection.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Wytnij"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION"
|
||
msgid "delete all!"
|
||
msgstr "usuń wszystko!"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "podmenu i wszystkie jego elementy"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "tylko podmenu ale zachowaj jego elemnty"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION"
|
||
msgid "selected item"
|
||
msgstr "wybrana pozycja"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION"
|
||
msgid "Delete selected item"
|
||
msgstr "Usuń wybraną pozycję"
|
||
|
||
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
||
msgid "Export selection to legacy .tab file(s)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
||
msgid "FavoriteTabsTestMenu"
|
||
msgstr "Menu testowe ulubionych zakładek"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
||
msgid "Import legacy .tab file(s) according to default setting"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
||
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
||
msgid "Insert separator"
|
||
msgstr "Wstaw separator"
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
||
msgid "Insert sub-menu"
|
||
msgstr "Wstaw pod-menu"
|
||
|
||
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION"
|
||
msgid "Open all branches"
|
||
msgstr "Otwórz wszystkie gałęzie"
|
||
|
||
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Wstaw"
|
||
|
||
#: tfrmoptionsfavoritetabs.mirename.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Zmień nazwę"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "...wszystko od A do Z!"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr "Testuj wynikowe menu"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddact.caption
|
||
msgid "Add"
|
||
msgstr "Dodaj"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
|
||
msgid "&Add"
|
||
msgstr "Dodaj"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
|
||
msgid "A&dd"
|
||
msgstr "Dodaj"
|
||
|
||
#: tfrmoptionsfileassoc.btncloneact.caption
|
||
msgid "Clone"
|
||
msgstr "Klonuj"
|
||
|
||
#: tfrmoptionsfileassoc.btndownact.caption
|
||
msgid "&Down"
|
||
msgstr "W dół"
|
||
|
||
#: tfrmoptionsfileassoc.btneditext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
|
||
msgid "Edit"
|
||
msgstr "Edytuj"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
||
msgid "Insert"
|
||
msgstr "Wstaw"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
|
||
msgid "Insert"
|
||
msgstr "Wstaw"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveact.caption
|
||
msgid "Remo&ve"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveext.caption
|
||
msgid "Re&move"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionsfileassoc.btnremovetype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
|
||
msgid "&Remove"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionsfileassoc.btnrenametype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
||
msgid "R&ename"
|
||
msgstr "Zmi&eń nazwę"
|
||
|
||
#: tfrmoptionsfileassoc.btnupact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
|
||
msgid "&Up"
|
||
msgstr "W górę"
|
||
|
||
#: tfrmoptionsfileassoc.destartpath.hint
|
||
msgid "Starting path of the command. Never quote this string."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.edbactionname.hint
|
||
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.edtparams.hint
|
||
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.fnecommand.hint
|
||
msgid "Command to execute. Long filename with space should be quoted."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
||
msgid "Action description:"
|
||
msgstr "Opis akcji:"
|
||
|
||
#: tfrmoptionsfileassoc.gbactions.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
||
msgid "Actions"
|
||
msgstr "Akcja"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.caption
|
||
msgid "Extensions"
|
||
msgstr "Rozszerzenie"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.hint
|
||
msgid "Can be sorted by drag & drop"
|
||
msgstr "Może być sortowane przez \"przeciągnij i upuść\""
|
||
|
||
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
||
msgid "File types"
|
||
msgstr "Typ pliku"
|
||
|
||
#: tfrmoptionsfileassoc.gbicon.caption
|
||
msgid "Icon"
|
||
msgstr "Ikona"
|
||
|
||
#: tfrmoptionsfileassoc.lbactions.hint
|
||
msgid "Actions may be sorted by drag & drop"
|
||
msgstr "Czynności mogą być sortowane przez \"przeciągnij i upuść\""
|
||
|
||
#: tfrmoptionsfileassoc.lbexts.hint
|
||
msgid "Extensions may be sorted by drag & drop"
|
||
msgstr "Rozszerzenia mogą być sortowane przez \"przeciągnij i upuść\""
|
||
|
||
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
||
msgid "File types may be sorted by drag & drop"
|
||
msgstr "Typy plików mogą być sortowane przez \"przeciągnij i upuść\""
|
||
|
||
#: tfrmoptionsfileassoc.lblaction.caption
|
||
msgid "Action name:"
|
||
msgstr "Nazwa akcji:"
|
||
|
||
#: tfrmoptionsfileassoc.lblcommand.caption
|
||
msgid "&Command:"
|
||
msgstr "Polecenie:"
|
||
|
||
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Parametry:"
|
||
|
||
#: tfrmoptionsfileassoc.lblstartpath.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "Ścieżka startowa:"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem1.caption
|
||
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem3.caption
|
||
msgid "Custom with..."
|
||
msgstr "Niestandardowe z..."
|
||
|
||
#: tfrmoptionsfileassoc.micustom.caption
|
||
msgid "Custom"
|
||
msgstr "Niestandardowe"
|
||
|
||
#: tfrmoptionsfileassoc.miedit.caption
|
||
msgctxt "tfrmoptionsfileassoc.miedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Edytuj"
|
||
|
||
#: tfrmoptionsfileassoc.mieditor.caption
|
||
msgid "Open in Editor"
|
||
msgstr "Otwórz w edytorze"
|
||
|
||
#: tfrmoptionsfileassoc.mieditwith.caption
|
||
msgid "Edit with..."
|
||
msgstr "Edytuj za pomocą..."
|
||
|
||
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
||
msgid "Get output from command"
|
||
msgstr "Wyświetl zwrócone komunikaty polecenia"
|
||
|
||
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
||
msgid "Open in Internal Editor"
|
||
msgstr "Otwórz w wewnętrznym Edytorze"
|
||
|
||
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
||
msgid "Open in Internal Viewer"
|
||
msgstr "Otwórz w wewnetrznej Przeglądarce"
|
||
|
||
#: tfrmoptionsfileassoc.miopen.caption
|
||
msgctxt "tfrmoptionsfileassoc.miopen.caption"
|
||
msgid "Open"
|
||
msgstr "Otwórz"
|
||
|
||
#: tfrmoptionsfileassoc.miopenwith.caption
|
||
msgid "Open with..."
|
||
msgstr "Otwórz za pomocą..."
|
||
|
||
#: tfrmoptionsfileassoc.miseparator.caption
|
||
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.mishell.caption
|
||
msgid "Run in terminal"
|
||
msgstr "Uruchom w terminalu"
|
||
|
||
#: tfrmoptionsfileassoc.miview.caption
|
||
msgctxt "tfrmoptionsfileassoc.miview.caption"
|
||
msgid "View"
|
||
msgstr "Podgląd"
|
||
|
||
#: tfrmoptionsfileassoc.miviewer.caption
|
||
msgid "Open in Viewer"
|
||
msgstr "Otwórz w przeglądarce"
|
||
|
||
#: tfrmoptionsfileassoc.miviewwith.caption
|
||
msgid "View with..."
|
||
msgstr "Podgląd za pomocą..."
|
||
|
||
#: tfrmoptionsfileassoc.sbtnicon.hint
|
||
msgid "Click me to change icon!"
|
||
msgstr "Kliknij by zmienić ikonę!"
|
||
|
||
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
||
msgid "Execute via shell"
|
||
msgstr "Uruchom przez shell"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
||
msgid "Extended context menu"
|
||
msgstr "Rozszerzone menu kontekstowe"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
||
msgid "File association configuration"
|
||
msgstr "Konfiguracja skojarzeń plików"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
||
msgid "Offer to add selection to file association when not included already"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Uruchom przez terminal i zamknij"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Uruchom przez terminal i pozostaw otwarty"
|
||
|
||
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
||
msgid "Extended options items:"
|
||
msgstr "Opcje rozszerzonych pozycji:"
|
||
|
||
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
||
msgid "Show confirmation window for:"
|
||
msgstr "Pokaż okno potwierdzenia dla:"
|
||
|
||
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
||
msgid "Cop&y operation"
|
||
msgstr "Operacja kopiowania"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
||
msgid "&Delete operation"
|
||
msgstr "Operacja usuwania"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
||
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
||
msgstr "Usuń do kosza (z Shiftem - usuwa bezpowrotnie)"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
||
msgid "D&elete to trash operation"
|
||
msgstr "Operacja usuwania do Kosza"
|
||
|
||
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
||
msgid "D&rop readonly flag"
|
||
msgstr "Zdejmij flagę \"Tylko do odczytu\""
|
||
|
||
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
||
msgid "&Move operation"
|
||
msgstr "Operacja przenoszenia"
|
||
|
||
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
||
msgid "&Process comments with files/folders"
|
||
msgstr "Komentarze do plików/katalogów"
|
||
|
||
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
||
msgid "Select &file name without extension when renaming"
|
||
msgstr "Przy zmianie nazwy edytuj tylko nazwę (bez rozszerzenia)"
|
||
|
||
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
||
msgid "Sho&w tab select panel in copy/move dialog"
|
||
msgstr "Pokaż pasek postępu podczas kopiowania/przenoszenia"
|
||
|
||
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
||
msgid "S&kip file operations errors and write them to log window"
|
||
msgstr "Komunikaty o błędach przy operacjach na plikach pokazuj tylko w oknie logów"
|
||
|
||
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
||
msgid "Executing operations"
|
||
msgstr "Wykonywanie operacji"
|
||
|
||
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
||
msgid "User interface"
|
||
msgstr "Interfejs użytkownika"
|
||
|
||
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
||
msgid "&Buffer size for file operations (in KB):"
|
||
msgstr "Rozmiar bufora do operacji na plikach (w KB):"
|
||
|
||
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
||
msgid "Buffer size for &hash calculation (in KB):"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
||
msgid "Show operations progress &initially in"
|
||
msgstr "Pokaż postęp operacji początkowo w"
|
||
|
||
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
||
msgid "Duplicated name auto-rename style:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
||
msgid "&Number of wipe passes:"
|
||
msgstr "Liczba przebiegów zacierania:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
||
msgid "Reset to DC default"
|
||
msgstr "Przywróć domyślne ustawienia DC"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Zezwól na nakładanie kolorów"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
||
msgid "Use &Frame Cursor"
|
||
msgstr "Używaj kursora jako ramki"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
||
msgid "Use &Gradient Indicator"
|
||
msgstr "Używaj gradientu kolorów wskaźnika"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Sel Color"
|
||
msgstr "Użyj koloru odwrotnej selekcji"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
||
msgid "U&se Inverted Selection"
|
||
msgstr "Używaj odwrotnej selekcji"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Obramowanie kursora"
|
||
|
||
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
||
msgid "Drive Free Space Indicator"
|
||
msgstr "Wskaźnik wolnego miejsca na dysku"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
||
msgid "Bac&kground:"
|
||
msgstr "Tło:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
||
msgid "Backg&round 2:"
|
||
msgstr "Tło 2:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
||
msgid "C&ursor Color:"
|
||
msgstr "Kolor kursora:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
||
msgid "Cursor Te&xt:"
|
||
msgstr "Tekst pod kursorem:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Kolor nieaktywnego kursora:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Kolor nieaktywnego zazn.:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
||
msgid "&Brightness level of inactive panel"
|
||
msgstr "Przyciemnienie nieaktywnego panelu"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
||
msgid "In&dicator Back Color:"
|
||
msgstr "Kolor tła wskaźnika:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
||
msgid "&Indicator Fore Color:"
|
||
msgstr "Kolor wskaźnika:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
||
msgid "&Mark Color:"
|
||
msgstr "Kolor zaznaczania:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
||
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
||
msgstr "Poniżej znajduje się podgląd. Można przesuwać kursor i wybierać pliki, aby natychmiast uzyskać rzeczywisty wygląd różnych ustawień."
|
||
|
||
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
||
msgid "T&ext Color:"
|
||
msgstr "Kolor tekstu:"
|
||
|
||
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
||
msgid "When launching file search, clear file mask filter"
|
||
msgstr "Po uruchomieniu wyszukiwania plików, wyczyść filtr maski pliku"
|
||
|
||
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
||
msgid "&Search for part of file name"
|
||
msgstr "&Szukaj części nazwy pliku"
|
||
|
||
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
||
msgid "Show menu bar in \"Find files\""
|
||
msgstr "Pokaż pasek menu w \"Znajdź pliki\""
|
||
|
||
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
||
msgid "Text search in files"
|
||
msgstr "Wyszukiwanie tekstu w plikach"
|
||
|
||
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
||
msgctxt "TFRMOPTIONSFILESEARCH.GBFILESEARCH.CAPTION"
|
||
msgid "File search"
|
||
msgstr "Wyszukiwanie plików"
|
||
|
||
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
||
msgid "Current filters with \"New search\" button:"
|
||
msgstr "Bieżące filtry z przyciskiem \"Nowe wyszukiwanie\":"
|
||
|
||
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
||
msgid "Default search template:"
|
||
msgstr "Domyślny szablon wyszukiwania:"
|
||
|
||
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
||
msgid "Use memory mapping for search te&xt in files"
|
||
msgstr "Użyj mapowania pamięci dla wyszukiwanego tekstu w plikach"
|
||
|
||
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
||
msgid "&Use stream for search text in files"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.BTNADDATTRIBUTE.CAPTION"
|
||
msgid "&Add"
|
||
msgstr "Dod&aj"
|
||
|
||
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
||
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
||
msgid "Do&n't load file list until a tab is activated"
|
||
msgstr "Nie ładuj listy plików aż zakładka zostanie wybrana"
|
||
|
||
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
||
msgid "S&how square brackets around directories"
|
||
msgstr "Pokazuj nazwy katalogów w nawiasach kwadratowych"
|
||
|
||
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
||
msgid "Hi&ghlight new and updated files"
|
||
msgstr "Wyróżnij nowe i zaktualizowane pliki"
|
||
|
||
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
||
msgid "Enable inplace &renaming when clicking twice on a name"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
||
msgid "Load &file list in separate thread"
|
||
msgstr "Wczytuj listę plików w oddzielnym wątku"
|
||
|
||
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
||
msgid "Load icons af&ter file list"
|
||
msgstr "Wczytuj ikony po liście plików"
|
||
|
||
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
||
msgid "Show s&ystem and hidden files"
|
||
msgstr "Pokaż pliki ukryte/systemowe"
|
||
|
||
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
||
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
||
msgstr "Klawisz <spacja> przenosi do następnego pliku (tak jak <INSERT>)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
||
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
||
msgid "Use an independant attribute filter in mask input dialog each time"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.gbformatting.caption
|
||
msgid "Formatting"
|
||
msgstr "Formatowanie"
|
||
|
||
#: tfrmoptionsfilesviews.gbmarking.caption
|
||
msgid "Marking/Unmarking entries"
|
||
msgstr "Zaznaczenie/Odznaczenie wpisów"
|
||
|
||
#: tfrmoptionsfilesviews.gbsorting.caption
|
||
msgid "Sorting"
|
||
msgstr "Sortowanie"
|
||
|
||
#: tfrmoptionsfilesviews.lbattributemask.caption
|
||
msgid "Default attribute mask value to use:"
|
||
msgstr "Domyślna wartość atrybutu maski do użycia:"
|
||
|
||
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
||
msgid "Case s&ensitivity:"
|
||
msgstr "Pisownia wielkich liter:"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
||
msgid "Incorrect format"
|
||
msgstr "Nieprawidłowy format"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
||
msgid "&Date and time format:"
|
||
msgstr "Format daty i czasu:"
|
||
|
||
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
||
msgid "File si&ze format:"
|
||
msgstr "Format rozmiaru pliku:"
|
||
|
||
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
||
msgid "&Insert new files:"
|
||
msgstr "Wstaw nowe pliki:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
||
msgid "So&rting directories:"
|
||
msgstr "Sortowanie katalogów:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
||
msgid "&Sort method:"
|
||
msgstr "&Metoda sortowania:"
|
||
|
||
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
||
msgid "&Move updated files:"
|
||
msgstr "Przenieś zaktualizowane pliki:"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Dodaj"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Zastosuj"
|
||
|
||
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Szablon..."
|
||
|
||
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
||
msgid "File types colors (sort by drag&&drop)"
|
||
msgstr "Kolor typu plików (sortuj przez \"przeciągnij i upuść\")"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
||
msgid "Category a&ttributes:"
|
||
msgstr "Atrybuty kategorii:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
||
msgid "Category co&lor:"
|
||
msgstr "Kolor kategorii:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "Maska kategorii:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "Nazwa kategorii:"
|
||
|
||
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnseleditfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsellogfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselmainfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.lblconsolefont.caption
|
||
msgid "&Console font"
|
||
msgstr "&Czcionka konsoli"
|
||
|
||
#: tfrmoptionsfonts.lbleditorfont.caption
|
||
msgid "&Editor font"
|
||
msgstr "Czcionka edytora"
|
||
|
||
#: tfrmoptionsfonts.lbllogfont.caption
|
||
msgid "&Log font"
|
||
msgstr "Czcionka logów"
|
||
|
||
#: tfrmoptionsfonts.lblmainfont.caption
|
||
msgid "Main &font"
|
||
msgstr "Czcionka podstawowa"
|
||
|
||
#: tfrmoptionsfonts.lblpatheditfont.caption
|
||
msgid "Path font"
|
||
msgstr "Czcionka ścieżki"
|
||
|
||
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
||
msgid "Search results font"
|
||
msgstr "Czcionka wyników eyszukiwania"
|
||
|
||
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
||
msgid "Viewer&Book Font"
|
||
msgstr "Czcionka przeglądarki książek"
|
||
|
||
#: tfrmoptionsfonts.lblviewerfont.caption
|
||
msgid "&Viewer font"
|
||
msgstr "Czcionka podglądu"
|
||
|
||
#: tfrmoptionshotkeys.actaddhotkey.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTADDHOTKEY.CAPTION"
|
||
msgid "Add &hotkey"
|
||
msgstr "Dodaj klawisz skrótu"
|
||
|
||
#: tfrmoptionshotkeys.actcopy.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmoptionshotkeys.actdelete.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETEHOTKEY.CAPTION"
|
||
msgid "&Delete hotkey"
|
||
msgstr "Usuń klawisz skrótu"
|
||
|
||
#: tfrmoptionshotkeys.actedithotkey.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTEDITHOTKEY.CAPTION"
|
||
msgid "&Edit hotkey"
|
||
msgstr "Edytuj klawisz skrótu"
|
||
|
||
#: tfrmoptionshotkeys.actnextcategory.caption
|
||
msgid "Next category"
|
||
msgstr "Następna kategoria"
|
||
|
||
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
||
msgid "Make popup the file related menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
||
msgid "Previous category"
|
||
msgstr "Poprzednia kategoria"
|
||
|
||
#: tfrmoptionshotkeys.actrename.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTRENAME.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Zmień nazwę"
|
||
|
||
#: tfrmoptionshotkeys.actrestoredefault.caption
|
||
msgid "Restore DC default"
|
||
msgstr "Przyuwróć domyślne"
|
||
|
||
#: tfrmoptionshotkeys.actsavenow.caption
|
||
msgid "Save now"
|
||
msgstr "Zapisz teraz"
|
||
|
||
#: tfrmoptionshotkeys.actsortbycommand.caption
|
||
msgid "Sort by command name"
|
||
msgstr "Sortuj według nazwy polecenia"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
||
msgid "Sort by hotkeys (grouped)"
|
||
msgstr "Sortuj według skrótów klawiszowych (pogrupowane)"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
||
msgid "Sort by hotkeys (one per row)"
|
||
msgstr "Sortuj według skrótów klawiszowych (po jednym w linii)"
|
||
|
||
#: tfrmoptionshotkeys.lbfilter.caption
|
||
msgid "&Filter"
|
||
msgstr "Filtr"
|
||
|
||
#: tfrmoptionshotkeys.lblcategories.caption
|
||
msgid "C&ategories:"
|
||
msgstr "Kategorie:"
|
||
|
||
#: tfrmoptionshotkeys.lblcommands.caption
|
||
msgid "Co&mmands:"
|
||
msgstr "Polecenia:"
|
||
|
||
#: tfrmoptionshotkeys.lblscfiles.caption
|
||
msgid "&Shortcut files:"
|
||
msgstr "Pliki skrótów:"
|
||
|
||
#: tfrmoptionshotkeys.lblsortorder.caption
|
||
msgid "So&rt order:"
|
||
msgstr "Kolejność so&rtowania:"
|
||
|
||
#: tfrmoptionshotkeys.micategories.caption
|
||
msgid "Categories"
|
||
msgstr "Kategorie"
|
||
|
||
#: tfrmoptionshotkeys.micommands.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.MICOMMANDS.CAPTION"
|
||
msgid "Command"
|
||
msgstr "Polecenie"
|
||
|
||
#: tfrmoptionshotkeys.miseparator1.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionshotkeys.misortorder.caption
|
||
msgid "Sort order"
|
||
msgstr "Kolejność sortowania"
|
||
|
||
#: tfrmoptionsicons.cbiconsexclude.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Dla następujących ścieżek i ich podkatalogów:"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenus.caption
|
||
msgid "Show icons for actions in &menus"
|
||
msgstr "Pokaż ikony dla działań w &menu"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenussize.text
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
||
msgid "Show icons on buttons"
|
||
msgstr "Pokaż ikony na przyciskach"
|
||
|
||
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
||
msgid "Show o&verlay icons, e.g. for links"
|
||
msgstr "Pokazuj ikony nakładkowo (np dla linków symbolicznych)"
|
||
|
||
#: tfrmoptionsicons.cbiconssize.text
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSSIZE.TEXT"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
||
msgid "Disable special icons"
|
||
msgstr "Wyłącz specjalne ikony"
|
||
|
||
#: tfrmoptionsicons.gbiconsinmenus.caption
|
||
msgid "Icons in menus"
|
||
msgstr "Ikony w menu"
|
||
|
||
#: tfrmoptionsicons.gbiconsonbuttons.caption
|
||
msgid "Icons on buttons"
|
||
msgstr "Ikony na przyciskach"
|
||
|
||
#: tfrmoptionsicons.gbiconssize.caption
|
||
msgid " Icon size "
|
||
msgstr " Rozmiar ikon"
|
||
|
||
#: tfrmoptionsicons.gbshowiconsmode.caption
|
||
msgid " Show icons to the left of the filename "
|
||
msgstr " Pokazuj ikony po lewej stronie nazwy pliku"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowall.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
||
msgid "A&ll"
|
||
msgstr "Wszystkie"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
||
msgid "All associated + &EXE/LNK (slow)"
|
||
msgstr "Wszystkie skojarzone + &EXE/LNK (wolne)"
|
||
|
||
#: tfrmoptionsicons.rbiconsshownone.caption
|
||
msgid "&No icons"
|
||
msgstr "Bez ikon"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
||
msgid "Only &standard icons"
|
||
msgstr "Tylko standardowe ikony"
|
||
|
||
#: tfrmoptionsignorelist.btnaddsel.caption
|
||
msgid "A&dd selected names"
|
||
msgstr "Dodaj wybrane nazwy"
|
||
|
||
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
||
msgid "Add selected names with &full path"
|
||
msgstr "Dodaj wybrane nazwy z pełną ścieżką"
|
||
|
||
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
|
||
|
||
#: tfrmoptionsignorelist.chkignoreenable.caption
|
||
msgid "&Ignore (don't show) the following files and folders:"
|
||
msgstr "&Ignoruj (nie pokazuj) następujących plików i katalogów:"
|
||
|
||
#: tfrmoptionsignorelist.lblsavein.caption
|
||
msgid "&Save in:"
|
||
msgstr "&Zapisz w:"
|
||
|
||
#: tfrmoptionskeyboard.cblynxlike.caption
|
||
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
||
msgstr "Strzałki w prawo, lewo zmieniają katalog (nawigacja w stylu Lynksa)"
|
||
|
||
#: tfrmoptionskeyboard.gbtyping.caption
|
||
msgid "Typing"
|
||
msgstr "Pisanie"
|
||
|
||
#: tfrmoptionskeyboard.lblalt.caption
|
||
msgid "Alt+L&etters:"
|
||
msgstr "Alt+Litery:"
|
||
|
||
#: tfrmoptionskeyboard.lblctrlalt.caption
|
||
msgid "Ctrl+Alt+Le&tters:"
|
||
msgstr "Ctrl+Alt+Litery:"
|
||
|
||
#: tfrmoptionskeyboard.lblnomodifier.caption
|
||
msgid "&Letters:"
|
||
msgstr "Litery:"
|
||
|
||
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
|
||
msgid "&Flat buttons"
|
||
msgstr "Płaskie przyciski"
|
||
|
||
#: tfrmoptionslayout.cbflatinterface.caption
|
||
msgid "Flat i&nterface"
|
||
msgstr "Płaski wygląd"
|
||
|
||
#: tfrmoptionslayout.cbflattoolbar.caption
|
||
msgid "Flat b&uttons"
|
||
msgstr "Płaskie przyciski"
|
||
|
||
#: tfrmoptionslayout.cbfreespaceind.caption
|
||
msgid "Show fr&ee space indicator on drive label"
|
||
msgstr "Pokaż pasek wolnego miejsca przy etykiecie napędu"
|
||
|
||
#: tfrmoptionslayout.cblogwindow.caption
|
||
msgid "Show lo&g window"
|
||
msgstr "Pokaż okno dziennika"
|
||
|
||
#: tfrmoptionslayout.cbpanelofoperations.caption
|
||
msgid "Show panel of operation in background"
|
||
msgstr "Pokaż panel operacji w tle"
|
||
|
||
#: tfrmoptionslayout.cbproginmenubar.caption
|
||
msgid "Show common progress in menu bar"
|
||
msgstr "Pokaż postęp ogólny na pasku menu"
|
||
|
||
#: tfrmoptionslayout.cbshowcmdline.caption
|
||
msgid "Show command l&ine"
|
||
msgstr "Pokaż &linię poleceń"
|
||
|
||
#: tfrmoptionslayout.cbshowcurdir.caption
|
||
msgid "Show current director&y"
|
||
msgstr "Pokaż nazwę &bieżącego katalogu"
|
||
|
||
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
||
msgid "Show &drive buttons"
|
||
msgstr "Pokaż przyciski &dysków"
|
||
|
||
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
||
msgid "Show free s&pace label"
|
||
msgstr "Pokaż wolne miejsce na dysku"
|
||
|
||
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
||
msgid "Show drives list bu&tton"
|
||
msgstr "Pokaż p&rzycisk listy dysków"
|
||
|
||
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
||
msgid "Show function &key buttons"
|
||
msgstr "Pokaż przyciski klawiszy &funkcyjnych"
|
||
|
||
#: tfrmoptionslayout.cbshowmainmenu.caption
|
||
msgid "Show &main menu"
|
||
msgstr "Pokaż główne menu"
|
||
|
||
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
||
msgid "Show tool&bar"
|
||
msgstr "Pokaż pasek &przycisków"
|
||
|
||
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
||
msgid "Show short free space &label"
|
||
msgstr "Pokaż mały opis wolnego miejsca"
|
||
|
||
#: tfrmoptionslayout.cbshowstatusbar.caption
|
||
msgid "Show &status bar"
|
||
msgstr "Pokaż pasek &stanu"
|
||
|
||
#: tfrmoptionslayout.cbshowtabheader.caption
|
||
msgid "S&how tabstop header"
|
||
msgstr "Pokaż nagłówki &kolumn"
|
||
|
||
#: tfrmoptionslayout.cbshowtabs.caption
|
||
msgid "Sho&w folder tabs"
|
||
msgstr "Pokaż &zakładki katalogów"
|
||
|
||
#: tfrmoptionslayout.cbtermwindow.caption
|
||
msgid "Show te&rminal window"
|
||
msgstr "Pokaż okno terminala"
|
||
|
||
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
||
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
||
msgstr "Pokazuj dwa paski napędów (zmienna szerokość, nad oknami plików)"
|
||
|
||
#: tfrmoptionslayout.gbscreenlayout.caption
|
||
msgid " Screen layout "
|
||
msgstr " Wygląd ekranu głównego"
|
||
|
||
#: tfrmoptionslog.btnrelativelogfile.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
|
||
|
||
#: tfrmoptionslog.btnviewlogfile.hint
|
||
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Podgląd zawartości pliku dziennika"
|
||
|
||
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
||
msgid "Include date in log filename"
|
||
msgstr "Dołącz datę w nazwie pliku dziennika"
|
||
|
||
#: tfrmoptionslog.cblogarcop.caption
|
||
msgid "&Pack/Unpack"
|
||
msgstr "Pakowanie/Rozpakowywanie"
|
||
|
||
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
||
msgid "External command line execution"
|
||
msgstr "Wykonanie wiersza polecenia zewnętrznego"
|
||
|
||
#: tfrmoptionslog.cblogcpmvln.caption
|
||
msgid "Cop&y/Move/Create link/symlink"
|
||
msgstr "Kopiowanie/Przenoszenie/Tworzenie dowiązań"
|
||
|
||
#: tfrmoptionslog.cblogdelete.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Usuwanie"
|
||
|
||
#: tfrmoptionslog.cblogdirop.caption
|
||
msgid "Crea&te/Delete directories"
|
||
msgstr "Tworzenie/Usuwanie katalogów"
|
||
|
||
#: tfrmoptionslog.cblogerrors.caption
|
||
msgid "Log &errors"
|
||
msgstr "Błędy"
|
||
|
||
#: tfrmoptionslog.cblogfile.caption
|
||
msgid "C&reate a log file:"
|
||
msgstr "&Utwórz plik dziennika:"
|
||
|
||
#: tfrmoptionslog.cbloginfo.caption
|
||
msgid "Log &information messages"
|
||
msgstr "Wyświetlanie komunikatów"
|
||
|
||
#: tfrmoptionslog.cblogstartshutdown.caption
|
||
msgid "Start/shutdown"
|
||
msgstr "Uruchomienie/zamknięcie"
|
||
|
||
#: tfrmoptionslog.cblogsuccess.caption
|
||
msgid "Log &successful operations"
|
||
msgstr "Informacje o zakończonej operacji"
|
||
|
||
#: tfrmoptionslog.cblogvfs.caption
|
||
msgid "&File system plugins"
|
||
msgstr "Wtyczki systemu plików"
|
||
|
||
#: tfrmoptionslog.gblogfile.caption
|
||
msgid "File operation log file"
|
||
msgstr "Plik dziennika dla operacji na plikach"
|
||
|
||
#: tfrmoptionslog.gblogfileop.caption
|
||
msgid "Log operations"
|
||
msgstr "Zapisz operacje"
|
||
|
||
#: tfrmoptionslog.gblogfilestatus.caption
|
||
msgid "Operation status"
|
||
msgstr "Stan operacji"
|
||
|
||
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
||
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
|
||
|
||
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
||
msgid "&Remove thumbnails for no longer existing files"
|
||
msgstr "Usuń miniatury dla nie istniejących plików"
|
||
|
||
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Podgląd zawartości pliku dziennika"
|
||
|
||
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
||
msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION"
|
||
msgid "Create new with the encoding:"
|
||
msgstr "Utwórz nowy z kodowaniem:"
|
||
|
||
#: tfrmoptionsmisc.chkgotoroot.caption
|
||
msgid "Always &go to the root of a drive when changing drives"
|
||
msgstr "Zawsze idź do katalogu głównego dysku podczas zmiany dysków"
|
||
|
||
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
||
msgid "Show &warning messages (\"OK\" button only)"
|
||
msgstr "Pokaż tylko komunikaty o błędach (z przyciskiem \"Ok\")"
|
||
|
||
#: tfrmoptionsmisc.chkthumbsave.caption
|
||
msgid "&Save thumbnails in cache"
|
||
msgstr "Zapisz miniatury w pamięci cache"
|
||
|
||
#: tfrmoptionsmisc.dblthumbnails.caption
|
||
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
|
||
msgid "Thumbnails"
|
||
msgstr "Miniatury"
|
||
|
||
#: tfrmoptionsmisc.gbfilecomments.caption
|
||
msgid "File comments (descript.ion)"
|
||
msgstr "Plik komentarza (descript.on)"
|
||
|
||
#: tfrmoptionsmisc.gbtcexportimport.caption
|
||
msgid "Regarding TC export/import:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
||
msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION"
|
||
msgid "Default encoding:"
|
||
msgstr "Domyślne kodowanie:"
|
||
|
||
#: tfrmoptionsmisc.lbltcconfig.caption
|
||
msgid "Configuration file:"
|
||
msgstr "Plik konfiguracji:"
|
||
|
||
#: tfrmoptionsmisc.lbltcexecutable.caption
|
||
msgid "TC executable:"
|
||
msgstr "Plik wykonywalny TC"
|
||
|
||
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
||
msgid "Toolbar output path:"
|
||
msgstr "Ścieżka wyjściowa paska narzędzi:"
|
||
|
||
#: tfrmoptionsmisc.lblthumbpixels.caption
|
||
msgid "pixels"
|
||
msgstr "piksele"
|
||
|
||
#: tfrmoptionsmisc.lblthumbseparator.caption
|
||
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmoptionsmisc.lblthumbsize.caption
|
||
msgid "&Thumbnail size:"
|
||
msgstr "Rozmiar miniatur"
|
||
|
||
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
||
msgid "&Selection by mouse"
|
||
msgstr "Zaznaczanie myszką"
|
||
|
||
#: tfrmoptionsmouse.gbscrolling.caption
|
||
msgid "Scrolling"
|
||
msgstr "Przewijanie"
|
||
|
||
#: tfrmoptionsmouse.gbselection.caption
|
||
msgid "Selection"
|
||
msgstr "Wybór"
|
||
|
||
#: tfrmoptionsmouse.lblmousemode.caption
|
||
msgid "&Mode:"
|
||
msgstr "Tryb:"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
||
msgid "&Line by line"
|
||
msgstr "Wiersz po wierszu"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
||
msgid "Line by line &with cursor movement"
|
||
msgstr "Wiersz po wierszu z przesuwaniem kursora"
|
||
|
||
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
||
msgid "&Page by page"
|
||
msgstr "Strona po stronie"
|
||
|
||
#: tfrmoptionsplugins.btnaddplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Dodaj"
|
||
|
||
#: tfrmoptionsplugins.btnconfigplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "Konfiguruj"
|
||
|
||
#: tfrmoptionsplugins.btnenableplugin.caption
|
||
msgid "E&nable"
|
||
msgstr "Włącz"
|
||
|
||
#: tfrmoptionsplugins.btnremoveplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionsplugins.btntweakplugin.caption
|
||
msgid "&Tweak"
|
||
msgstr "Dostosuj"
|
||
|
||
#: tfrmoptionsplugins.lbldsxdescription.caption
|
||
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
||
msgstr "Zezwalaj na szukanie wtyczek wg alternatywnych algorytmów i narzędzi zewnętrznych (np. \"locate\")"
|
||
|
||
#: tfrmoptionsplugins.lblwcxdescription.caption
|
||
msgid "Pack&er plugins are used to work with archives"
|
||
msgstr "Obsługa archiwów z użyciem wtyczek."
|
||
|
||
#: tfrmoptionsplugins.lblwdxdescription.caption
|
||
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
||
msgstr "Wtyczki pozwalające wyświetlać dodatkowe informacje o plikach (np. tagi mp3, atrybuty grafiki) w panelach oraz przy szukaniu i zamianie."
|
||
|
||
#: tfrmoptionsplugins.lblwfxdescription.caption
|
||
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
||
msgstr "Wtyczki obsługujące niedostępne dla systemu dyski i urządzenia zewnętrzne (np. Palm/PocketPC)"
|
||
|
||
#: tfrmoptionsplugins.lblwlxdescription.caption
|
||
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
||
msgstr "Wtyczki pozwalające wyświetlić za pomocą przeglądarki (listera, komendą F3) pliki takie jak np. grafika, bazy danych akusze kalkulacyjne"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
|
||
msgid "Active"
|
||
msgstr "Aktywne"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "Wtyczka"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
|
||
msgid "Registered for"
|
||
msgstr "Zarejestrowany dla"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Nazwa pliku"
|
||
|
||
#: tfrmoptionsplugins.tsdsx.caption
|
||
msgid "&Search plugins (.DSX)"
|
||
msgstr "Wtyczki wyszukiwania (.DSX)"
|
||
|
||
#: tfrmoptionsplugins.tswcx.caption
|
||
msgid "Pac&ker plugins (.WCX)"
|
||
msgstr "Wtyczki pakera (.WCX)"
|
||
|
||
#: tfrmoptionsplugins.tswdx.caption
|
||
msgid "Content pl&ugins (.WDX)"
|
||
msgstr "Wtyczki zawartości (.WDX)"
|
||
|
||
#: tfrmoptionsplugins.tswfx.caption
|
||
msgid "F&ile system plugins (.WFX)"
|
||
msgstr "Wtyczki systemu plików (.WFX)"
|
||
|
||
#: tfrmoptionsplugins.tswlx.caption
|
||
msgid "&Viewer plugins (.WLX)"
|
||
msgstr "Wtyczki przeglądarki (listera) (.WLX)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
||
msgid "&Beginning (name must start with first typed character)"
|
||
msgstr "Początek (nazwa musi zaczynać się pierwszego wpisanego znaku)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
||
msgid "En&ding (last character before a typed dot . must match)"
|
||
msgstr "Zakończenie (ostatni znak przed kropką . musi być dopasowany)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Opcje"
|
||
|
||
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
||
msgid "Exact name match"
|
||
msgstr "Dokładna nazwa dopasowania"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
||
msgid "Search case"
|
||
msgstr "Wielkość liter"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
||
msgid "Search for these items"
|
||
msgstr "Szukaj tych pozycji"
|
||
|
||
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
||
msgid "Keep renamed name when unlocking a tab"
|
||
msgstr "Zachowaj zmienioną nazwę po odblokowaniu zakładki"
|
||
|
||
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
||
msgid "Activate target &panel when clicking on one of its Tabs"
|
||
msgstr "Aktywuj panel docelowy po kliknięciu na jednej z jego zakładek"
|
||
|
||
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
||
msgid "&Show tab header also when there is only one tab"
|
||
msgstr "Nagłówek zakładki widoczny nawet przy jednej zakładce"
|
||
|
||
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
||
msgid "Close duplicate tabs when closing application"
|
||
msgstr "Zamknij zduplikowane zakładki przy zamykaniu aplikacji"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
||
msgid "Con&firm close all tabs"
|
||
msgstr "Potwierdź zamknięcie wszystkich zakładek"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
||
msgid "Confirm close locked tabs"
|
||
msgstr "Potwierdź zamknięcie zablokowanych zakładek"
|
||
|
||
#: tfrmoptionstabs.cbtabslimitoption.caption
|
||
msgid "&Limit tab title length to"
|
||
msgstr "Ogranicz &długość tytułu zakładki do"
|
||
|
||
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
||
msgid "Show locked tabs &with an asterisk *"
|
||
msgstr "Zablokowane zakładki oznacz &gwiazdką"
|
||
|
||
#: tfrmoptionstabs.cbtabsmultilines.caption
|
||
msgid "&Tabs on multiple lines"
|
||
msgstr "Zakładki w kilku rzędach"
|
||
|
||
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
||
msgid "Ctrl+&Up opens new tab in foreground"
|
||
msgstr "Ctrl+&Up otwiera nową zakładkę na pierwszym planie"
|
||
|
||
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
||
msgid "Open &new tabs near current tab"
|
||
msgstr "Otwieraj &nowe zakładki obok bieżącej"
|
||
|
||
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
||
msgid "Reuse existing tab when possible"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
||
msgid "Show ta&b close button"
|
||
msgstr "Pokaż przycisk zamykania zakładki"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
||
msgid "Always show drive letter in tab title"
|
||
msgstr "Zawsze pokazuj literę dysku w tytule zakładki"
|
||
|
||
#: tfrmoptionstabs.gbtabs.caption
|
||
msgid "Folder tabs headers"
|
||
msgstr "Nagłówki zakładek folderów"
|
||
|
||
#: tfrmoptionstabs.lblchar.caption
|
||
msgid "characters"
|
||
msgstr "znaków"
|
||
|
||
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
||
msgid "Action to do when double click on a tab:"
|
||
msgstr "Czynność do wykonania po dwukrotnym kliknięciu na zakładce:"
|
||
|
||
#: tfrmoptionstabs.lbltabsposition.caption
|
||
msgid "Ta&bs position"
|
||
msgstr "Pozycja zakładek"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "Brak"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Nie"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
||
msgid "Left"
|
||
msgstr "Lewy"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
||
msgid "Right"
|
||
msgstr "Prawy"
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after resaving"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
||
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
||
msgid "Default extra settings when saving new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.gbtabs.caption
|
||
msgid "Folder tabs headers extra"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
||
msgid "When restoring tab, existing tabs to keep:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
||
msgid "Tabs saved on left will be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
||
msgid "Tabs saved on right will be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
||
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
||
msgid "Default position in menu when saving a new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
||
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
||
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edruntermparams.hint
|
||
msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
||
msgid "Command for just running terminal:"
|
||
msgstr "Polecenie tylko do uruchomienia w terminalu:"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
||
msgid "Command for running a command in terminal and close after:"
|
||
msgstr "Polecenie do uruchomienia polecenia w terminalu i zamknięciu po:"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
||
msgid "Command for running a command in terminal and stay open:"
|
||
msgstr "Polecenie do uruchomienia polecenia w terminalu i pozostawieniu otwartym:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION"
|
||
msgid "Command:"
|
||
msgstr "Polecenie:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION"
|
||
msgid "Parameters:"
|
||
msgstr "Parametry:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION"
|
||
msgid "Command:"
|
||
msgstr "Polecenie:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION"
|
||
msgid "Parameters:"
|
||
msgstr "Parametry:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermcmd.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION"
|
||
msgid "Command:"
|
||
msgstr "Polecenie:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermparams.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION"
|
||
msgid "Parameters:"
|
||
msgstr "Parametry:"
|
||
|
||
#: tfrmoptionstoolbar.btnclonebutton.caption
|
||
msgid "C&lone button"
|
||
msgstr "Klonuj przycisk"
|
||
|
||
#: tfrmoptionstoolbar.btndeletebutton.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionstoolbar.btnedithotkey.caption
|
||
msgid "Edit hot&key"
|
||
msgstr "Edytuj"
|
||
|
||
#: tfrmoptionstoolbar.btninsertbutton.caption
|
||
msgid "&Insert new button"
|
||
msgstr "Dodaj nowy przycisk"
|
||
|
||
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
||
msgid "Select"
|
||
msgstr "Wybierz"
|
||
|
||
#: tfrmoptionstoolbar.btnopenfile.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnother.caption
|
||
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
||
msgid "Other..."
|
||
msgstr "Inne..."
|
||
|
||
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
||
msgid "Remove hotke&y"
|
||
msgstr "Usuń skrót klawiaturowy"
|
||
|
||
#: tfrmoptionstoolbar.btnstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
||
msgid "Suggest"
|
||
msgstr "Sugeruj"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
||
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
||
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
||
msgid "&Flat buttons"
|
||
msgstr "Płaskie przyciski"
|
||
|
||
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
||
msgid "Report errors with commands"
|
||
msgstr "Raportuj błędy z poleceń"
|
||
|
||
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
||
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.gbgroupbox.caption
|
||
msgid "Appearance"
|
||
msgstr "Wygląd"
|
||
|
||
#: tfrmoptionstoolbar.lblbarsize.caption
|
||
msgid "&Bar size:"
|
||
msgstr "Rozmiar paska:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
||
msgid "Comman&d:"
|
||
msgstr "Polecenie:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
|
||
msgid "Parameter&s:"
|
||
msgstr "Parametry:"
|
||
|
||
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
|
||
msgid "Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmoptionstoolbar.lblhotkey.caption
|
||
msgid "Hot key:"
|
||
msgstr "Skrót klawiaturowy"
|
||
|
||
#: tfrmoptionstoolbar.lbliconfile.caption
|
||
msgid "Ico&n:"
|
||
msgstr "Plik ikony:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconsize.caption
|
||
msgid "Icon si&ze:"
|
||
msgstr "Rozmiar ikon:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
||
msgid "Co&mmand:"
|
||
msgstr "Polecenie:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
||
msgid "&Parameters:"
|
||
msgstr "Parametry:"
|
||
|
||
#: tfrmoptionstoolbar.lblstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "Katalog startowy:"
|
||
|
||
#: tfrmoptionstoolbar.lbltooltip.caption
|
||
msgid "&Tooltip:"
|
||
msgstr "Podpowiedź:"
|
||
|
||
#: tfrmoptionstoolbar.miaddallcmds.caption
|
||
msgid "Add toolbar with ALL DC commands"
|
||
msgstr "Dodaj pasek narzędzi z WSZYSTKIMI poleceniami DC"
|
||
|
||
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
||
msgid "for an external command"
|
||
msgstr "dla zewnętrznego polecenia"
|
||
|
||
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
||
msgid "for an internal command"
|
||
msgstr "dla wewnętrznego polecenia"
|
||
|
||
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
||
msgid "for a separator"
|
||
msgstr "dla separatora"
|
||
|
||
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
||
msgid "for a sub-tool bar"
|
||
msgstr "dla paska pod-narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.mibackup.caption
|
||
msgctxt "tfrmoptionstoolbar.mibackup.caption"
|
||
msgid "Backup..."
|
||
msgstr "Kopia zapasowa..."
|
||
|
||
#: tfrmoptionstoolbar.miexport.caption
|
||
msgctxt "tfrmoptionstoolbar.miexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Eksport..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrent.caption
|
||
msgid "Current toolbar..."
|
||
msgstr "Bieżący pasek narzędzi..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "do pliku paska narzędzi (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "do \"wincmd.ini\" z TC (zachowaj istniejące)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "do \"wincmd.ini\" z TC (usuń istniejące)"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator3.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator4.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexporttop.caption
|
||
msgid "Top toolbar..."
|
||
msgstr "Górny pasek narzędzi..."
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
||
msgid "Save a backup of Toolbar"
|
||
msgstr "Zapisz kopię paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "do pliku paska narzędzi (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "do \"wincmd.ini\" z TC (zachowaj istniejące)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "do \"wincmd.ini\" z TC (usuń istniejące)"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "bezpośrednio po bieżącym zaznaczeniu"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "jako pierwszy element"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "jako ostatni element"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "bezpośrednio przed bieżącym zaznaczeniem"
|
||
|
||
#: tfrmoptionstoolbar.miimport.caption
|
||
msgctxt "tfrmoptionstoolbar.miimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Importuj..."
|
||
|
||
#: tfrmoptionstoolbar.miimportbackup.caption
|
||
msgid "Restore a backup of Toolbar"
|
||
msgstr "Przywróć kopię Paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "aby dodać do bieżącego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "aby dodać nowy pasek narzędzi do bieżącego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "aby dodać nowy pasek narzędzi do górnego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "aby dodać do górnego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "aby zastąpić górny pasek narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbar.caption
|
||
msgid "from a Toolbar File (.toolbar)"
|
||
msgstr "z pliku paska narzędzi (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "aby dodać do bieżącego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "aby dodać nowy pasek narzędzi do bieżącego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "aby dodać nowy pasek narzędzi do górnego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "aby dodać do górnego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "aby zastąpić górny pasek narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimportseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbar.caption
|
||
msgid "from a single TC .BAR file"
|
||
msgstr "z pojedynczego pliku TC .BAR"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "aby dodać do bieżącego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "aby dodać nowy pasek narzędzi do bieżącego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "aby dodać nowy pasek narzędzi do górnego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "aby dodać do górnego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "aby zastąpić górny pasek narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcini.caption
|
||
msgid "from \"wincmd.ini\" of TC..."
|
||
msgstr "z \"wincmd.ini\" TC..."
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "aby dodać do bieżącego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "aby dodać nowy pasek narzędzi do bieżącego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "aby dodać nowy pasek narzędzi do górnego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "aby dodać do górnego paska narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "aby zastąpić górny pasek narzędzi"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "bezpośrednio po bieżącym zaznaczeniu"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "jako pierwszy element"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "jako ostatni element"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "bezpośrednio przed bieżącym zaznaczeniem"
|
||
|
||
#: tfrmoptionstoolbar.misearchandreplace.caption
|
||
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
|
||
msgid "Search and replace..."
|
||
msgstr "Znajdź i zamień..."
|
||
|
||
#: tfrmoptionstoolbar.miseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator10.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator11.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator13.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator14.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator6.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator7.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator8.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator9.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "bezpośredni po bieżącym zaznaczeniu"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
||
msgid "as first element"
|
||
msgstr "jako pierwszy element"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "jako ostatni element"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "bezpośrednio przed bieżącym zaznaczeniem"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
||
msgid "in all of all the above..."
|
||
msgstr "we wszystkich powyższych"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
||
msgid "in all commands..."
|
||
msgstr "we wszystkich poleceniach..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
||
msgid "in all icon names..."
|
||
msgstr "we wszystkich nazwach ikon..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
||
msgid "in all parameters..."
|
||
msgstr "we wszystkich parametrach..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
||
msgid "in all start path..."
|
||
msgstr "we wszystkich ścieżkach startowych..."
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "bezpośrednio po bieżącym zaznaczeniu"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "jako pierwszy element"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "jako ostatni element"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "bezpośrednio przed bieżącym zaznaczeniem"
|
||
|
||
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
||
msgid "Button type"
|
||
msgstr "Typ przycisku"
|
||
|
||
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
||
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Niektóre funkcje, aby wybrać odpowiednią ścieżkę"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
||
msgid "&Keep terminal window open after executing program"
|
||
msgstr "Zachowaj otwarty terminal po wykonaniu programu"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
||
msgid "&Execute in terminal"
|
||
msgstr "Wykonaj w terminalu"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
||
msgid "&Use external program"
|
||
msgstr "Użyj zewnętrznego programu"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
||
msgid "A&dditional parameters"
|
||
msgstr "Dodatkowe parametry"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolspath.caption
|
||
msgid "&Path to program to execute"
|
||
msgstr "Ścieżka do programu"
|
||
|
||
#: tfrmoptionstooltips.btnaddfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Dodaj"
|
||
|
||
#: tfrmoptionstooltips.btnapplyfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Zastosuj"
|
||
|
||
#: tfrmoptionstooltips.btndeletefields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmoptionstooltips.btnfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Szablon..."
|
||
|
||
#: tfrmoptionstooltips.chkshowtooltip.caption
|
||
msgid "&Show tooltip for files in the file panel"
|
||
msgstr "Pokaż podpowiedzi dla plików w panelu plików"
|
||
|
||
#: tfrmoptionstooltips.gbcustomfields.caption
|
||
msgid "Custom fields by file type"
|
||
msgstr "Pola użytkownika wg typu pliku"
|
||
|
||
#: tfrmoptionstooltips.lblfieldslist.caption
|
||
msgid "Category &hint:"
|
||
msgstr "Wskazówka kategorii:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsmask.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "Maska kategorii:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsname.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "Nazwa kategorii:"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
||
msgid "With double-click on the bar on top of a file panel"
|
||
msgstr "Z dwukrotnym kliknięciem na pasku w górnej części panelu plików"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr "Z menu i poleceniem wewnętrznym"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
||
msgid "Double click in tree select and exit"
|
||
msgstr "Podwójne kliknięcie myszy w drzewie - wybór i wyjście"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION"
|
||
msgid "With the menu and internal command"
|
||
msgstr "Z menu i poleceniem wewnętrznym"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
||
msgid "With double-click on a tab (if configured for it)"
|
||
msgstr "Z podwójnym kliknięciem na karcie (jeśli skonfigurowany dla niego)"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
||
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
||
msgid "Single mouse click in tree select and exit"
|
||
msgstr "Pojedyncze kliknięcie myszy w drzewie - wybór i wyjście"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
||
msgid "Use it for Command Line History"
|
||
msgstr "Użyj dla historii Linii Poleceń"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
||
msgid "Use it for the Dir History"
|
||
msgstr "Użyj dla Historii Katalogów"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
||
msgid "Use it for the View History (Visited paths for active view)"
|
||
msgstr "Użyj dla Widoku Historii (Odwiedzane ścieżki dla aktywnego widoku)"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
||
msgid "Behavior regarding selection:"
|
||
msgstr "Zachowanie dotyczące wyboru:"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
||
msgid "Tree View Menus related options:"
|
||
msgstr "Powiązane opcej Widoku Drzewa:"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
||
msgid "Where to use Tree View Menus:"
|
||
msgstr "Gdzie można używać Widoku Drzewa:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblnote.caption
|
||
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
||
msgid "With Directory Hotlist:"
|
||
msgstr "Z Ulubionymi Katalogami:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
||
msgid "With Favorite Tabs:"
|
||
msgstr "Z Ulubionymi Zakładkami:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
||
msgid "With History:"
|
||
msgstr "Z historią:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
||
msgid "Use and display keyboard shortcut for choosing items"
|
||
msgstr "Użyj i wyświetl skrót klawiaturowy dla wybranych elementów"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
||
msgid "Layout and colors options:"
|
||
msgstr "Opcje układu i kolorów:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
||
msgid "Background color:"
|
||
msgstr "Kolor tła:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
||
msgid "Cursor color:"
|
||
msgstr "Kolor kursora:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
||
msgid "Found text color:"
|
||
msgstr "Kolor znalezionego tekstu:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
||
msgid "Found text under cursor:"
|
||
msgstr "Znaleziony tekst pod kursorem:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
||
msgid "Normal text color:"
|
||
msgstr "Kolor normalnego tekstu:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
||
msgid "Normal text under cursor:"
|
||
msgstr "Normalny tekst pod kursorem:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
||
msgid "Tree View Menu Preview:"
|
||
msgstr "Podgląd Widoku Drzewa:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
||
msgid "Secondary text color:"
|
||
msgstr "Kolor drugiego tekstu"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
||
msgid "Secondary text under cursor:"
|
||
msgstr "Kolor drugiego tekstu pod kursorem:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
||
msgid "Shortcut color:"
|
||
msgstr "Kolor skrótu:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
||
msgid "Shortcut under cursor:"
|
||
msgstr "Skrót pod kursorem:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
||
msgid "Unselectable text color:"
|
||
msgstr "Kolor niewybranego tekstu:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
||
msgid "Unselectable under cursor:"
|
||
msgstr "Niewybrane pod kursorem:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
||
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
||
msgstr "Zmień kolor po lewej i zobaczysz tutaj podgląd jak Twój Widok Drzewa będzie wyglądał z tym przykładem."
|
||
|
||
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
||
msgid "Viewer Book Mode"
|
||
msgstr "Przeglądarka w trybie książki"
|
||
|
||
#: tfrmoptionsviewer.gbviewerexample.caption
|
||
msgid "Example"
|
||
msgstr "Przykład"
|
||
|
||
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
||
msgid "&Background color in book viewer"
|
||
msgstr "Kolor tła w trybie książki"
|
||
|
||
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
||
msgid "&Font color in book viewer"
|
||
msgstr "Kolor czcionki w tr. książki"
|
||
|
||
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
||
msgid "&Number of columns in book viewer"
|
||
msgstr "Ilość kolumn w tr. książki"
|
||
|
||
#: tfrmpackdlg.btnconfig.caption
|
||
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "&Konfiguruj"
|
||
|
||
#: tfrmpackdlg.caption
|
||
msgid "Pack files"
|
||
msgstr "Pakowanie plików"
|
||
|
||
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
||
msgid "C&reate separate archives, one per selected file/dir"
|
||
msgstr "Utwórz oddzielne archiwa dla każdego z katalogów/plików"
|
||
|
||
#: tfrmpackdlg.cbcreatesfx.caption
|
||
msgid "Create self e&xtracting archive"
|
||
msgstr "Utwórz samorozpakowujące się archiwum"
|
||
|
||
#: tfrmpackdlg.cbencrypt.caption
|
||
msgid "Encr&ypt"
|
||
msgstr "Za&szyfrowane"
|
||
|
||
#: tfrmpackdlg.cbmovetoarchive.caption
|
||
msgid "Mo&ve to archive"
|
||
msgstr "&Usuń pliki po ich zarchwizowaniu"
|
||
|
||
#: tfrmpackdlg.cbmultivolume.caption
|
||
msgid "&Multiple disk archive"
|
||
msgstr "&Wieloczęściowe archiwum dyskowe"
|
||
|
||
#: tfrmpackdlg.cbotherplugins.caption
|
||
msgid "=>"
|
||
msgstr "=>"
|
||
|
||
#: tfrmpackdlg.cbputintarfirst.caption
|
||
msgid "P&ut in the TAR archive first"
|
||
msgstr "Spakuj najpierw do archiwum TAR"
|
||
|
||
#: tfrmpackdlg.cbstoredir.caption
|
||
msgid "Also &pack path names (only recursed)"
|
||
msgstr "Przy archwizowaniu z podkatalogami zachowaj ścieżki"
|
||
|
||
#: tfrmpackdlg.lblprompt.caption
|
||
msgid "Pack file(s) to the file:"
|
||
msgstr "Nazwa pliku archiwum:"
|
||
|
||
#: tfrmpackdlg.rgpacker.caption
|
||
msgid "Packer"
|
||
msgstr "Paker"
|
||
|
||
#: tfrmpackinfodlg.btnclose.caption
|
||
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Zamknij"
|
||
|
||
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
||
msgid "Unpack &all and execute"
|
||
msgstr "Wypakuj &wszystko i uruchom"
|
||
|
||
#: tfrmpackinfodlg.btnunpackandexec.caption
|
||
msgid "&Unpack and execute"
|
||
msgstr "Wypakuj i &uruchom"
|
||
|
||
#: tfrmpackinfodlg.caption
|
||
msgid "Properties of packed file"
|
||
msgstr "Właściwości spakowanego pliku"
|
||
|
||
#: tfrmpackinfodlg.lblattributes.caption
|
||
msgid "Attributes:"
|
||
msgstr "Atrybuty:"
|
||
|
||
#: tfrmpackinfodlg.lblcompressionratio.caption
|
||
msgid "Compression ratio:"
|
||
msgstr "Stopień kompresji:"
|
||
|
||
#: tfrmpackinfodlg.lbldate.caption
|
||
msgid "Date:"
|
||
msgstr "Data:"
|
||
|
||
#: tfrmpackinfodlg.lblmethod.caption
|
||
msgid "Method:"
|
||
msgstr "Metoda:"
|
||
|
||
#: tfrmpackinfodlg.lbloriginalsize.caption
|
||
msgid "Original size:"
|
||
msgstr "Wielkość oryginalna:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedfile.caption
|
||
msgid "File:"
|
||
msgstr "Plik:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedsize.caption
|
||
msgid "Packed size:"
|
||
msgstr "Wielkość po skompresowaniu:"
|
||
|
||
#: tfrmpackinfodlg.lblpacker.caption
|
||
msgid "Packer:"
|
||
msgstr "Paker:"
|
||
|
||
#: tfrmpackinfodlg.lbltime.caption
|
||
msgid "Time:"
|
||
msgstr "Czas:"
|
||
|
||
#: tfrmquicksearch.btncancel.caption
|
||
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmquicksearch.btncancel.hint
|
||
msgid "Close filter panel"
|
||
msgstr "Zamknij panel filtra"
|
||
|
||
#: tfrmquicksearch.edtsearch.hint
|
||
msgid "Enter text to search for or filter by"
|
||
msgstr "Wpisz tekst do wyszukiwania lub filtrowania"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.caption
|
||
msgid "Aa"
|
||
msgstr "Aa"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.hint
|
||
msgid "Case Sensitive"
|
||
msgstr "Uwzględnia pisownię wielkich liter"
|
||
|
||
#: tfrmquicksearch.sbdirectories.caption
|
||
msgid "D"
|
||
msgstr "D"
|
||
|
||
#: tfrmquicksearch.sbdirectories.hint
|
||
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
||
msgid "Directories"
|
||
msgstr "Katalog"
|
||
|
||
#: tfrmquicksearch.sbfiles.caption
|
||
msgid "F"
|
||
msgstr "F"
|
||
|
||
#: tfrmquicksearch.sbfiles.hint
|
||
msgctxt "tfrmquicksearch.sbfiles.hint"
|
||
msgid "Files"
|
||
msgstr "Pliki"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.caption
|
||
msgid "{"
|
||
msgstr "{"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.hint
|
||
msgid "Match Beginning"
|
||
msgstr "Początek odnalezionego wzorca"
|
||
|
||
#: tfrmquicksearch.sbmatchending.caption
|
||
msgid "}"
|
||
msgstr "}"
|
||
|
||
#: tfrmquicksearch.sbmatchending.hint
|
||
msgid "Match Ending"
|
||
msgstr "Koniec odnalezionego wzorca"
|
||
|
||
#: tfrmquicksearch.tglfilter.caption
|
||
msgid "Filter"
|
||
msgstr "Filtr"
|
||
|
||
#: tfrmquicksearch.tglfilter.hint
|
||
msgid "Toggle between search or filter"
|
||
msgstr "Przełączanie między wyszukiwaniem lub filtrowaniem"
|
||
|
||
#: tfrmsearchplugin.btnadd.caption
|
||
msgid "&More rules"
|
||
msgstr "Więcej reguł"
|
||
|
||
#: tfrmsearchplugin.btndelete.caption
|
||
msgid "L&ess rules"
|
||
msgstr "Mniej reguł"
|
||
|
||
#: tfrmsearchplugin.chkuseplugins.caption
|
||
msgid "Use &content plugins, combine with:"
|
||
msgstr "Użyj wtyczek zawartości, w połączeniu z:"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[0].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
|
||
msgid "Plugin"
|
||
msgstr "Wtyczka"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[1].text
|
||
msgid "Field"
|
||
msgstr "Pole"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[2].text
|
||
msgid "Operator"
|
||
msgstr "Operator"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[3].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
||
msgid "Value"
|
||
msgstr "Wartość"
|
||
|
||
#: tfrmsearchplugin.rband.caption
|
||
msgid "&AND (all match)"
|
||
msgstr "&AND (wszystkie dopasowane)"
|
||
|
||
#: tfrmsearchplugin.rbor.caption
|
||
msgid "&OR (any match)"
|
||
msgstr "&OR (dowolne dopasowanie)"
|
||
|
||
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmselecttextrange.btppanel.closebutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Zamknij"
|
||
|
||
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomoc"
|
||
|
||
#: tfrmselecttextrange.btppanel.okbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmselecttextrange.lblselecttext.caption
|
||
msgid "&Select the characters to insert:"
|
||
msgstr "Wybierz znaki do wstawienia:"
|
||
|
||
#: tfrmsetfileproperties.btncancel.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmsetfileproperties.btnok.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmsetfileproperties.caption
|
||
msgid "Change attributes"
|
||
msgstr "Zmień atrybuty"
|
||
|
||
#: tfrmsetfileproperties.cbsgid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmsetfileproperties.cbsticky.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Przyklejony"
|
||
|
||
#: tfrmsetfileproperties.cbsuid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmsetfileproperties.chkarchive.caption
|
||
msgid "Archive"
|
||
msgstr "Archiwum"
|
||
|
||
#: tfrmsetfileproperties.chkcreationtime.caption
|
||
msgid "Created:"
|
||
msgstr "Utworzony:"
|
||
|
||
#: tfrmsetfileproperties.chkhidden.caption
|
||
msgid "Hidden"
|
||
msgstr "Ukryty"
|
||
|
||
#: tfrmsetfileproperties.chklastaccesstime.caption
|
||
msgid "Accessed:"
|
||
msgstr "Dostęp:"
|
||
|
||
#: tfrmsetfileproperties.chklastwritetime.caption
|
||
msgid "Modified:"
|
||
msgstr "Modyfikacja:"
|
||
|
||
#: tfrmsetfileproperties.chkreadonly.caption
|
||
msgid "Read only"
|
||
msgstr "Tylko do odczytu"
|
||
|
||
#: tfrmsetfileproperties.chkrecursive.caption
|
||
msgid "Including subfolders"
|
||
msgstr "Dołącz podfoldery"
|
||
|
||
#: tfrmsetfileproperties.chksystem.caption
|
||
msgid "System"
|
||
msgstr "System"
|
||
|
||
#: tfrmsetfileproperties.gbtimesamp.caption
|
||
msgid "Timestamp properties"
|
||
msgstr "Właściwości znacznika czasu"
|
||
|
||
#: tfrmsetfileproperties.gbunixattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Atrybuty"
|
||
|
||
#: tfrmsetfileproperties.gbwinattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Atrybuty"
|
||
|
||
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Bity:"
|
||
|
||
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Grupa"
|
||
|
||
#: tfrmsetfileproperties.lblattrinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(szare pole oznacza niezmienioną wartość)"
|
||
|
||
#: tfrmsetfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Inne"
|
||
|
||
#: tfrmsetfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Właściciel"
|
||
|
||
#: tfrmsetfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmsetfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Jako tekst:"
|
||
|
||
#: tfrmsetfileproperties.lblexec.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Wykonywalny"
|
||
|
||
#: tfrmsetfileproperties.lblmodeinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(szare pole oznacza niezmienioną wartość)"
|
||
|
||
#: tfrmsetfileproperties.lbloctal.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Ósemkowo:"
|
||
|
||
#: tfrmsetfileproperties.lblread.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Odczyt"
|
||
|
||
#: tfrmsetfileproperties.lblwrite.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Zapis"
|
||
|
||
#: tfrmsplitter.btncancel.caption
|
||
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmsplitter.btnftchoice.caption
|
||
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmsplitter.btnok.caption
|
||
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmsplitter.btnrelativeftchoice.hint
|
||
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Niektóre funkcje, aby wybrać odpowiednią ścieżkę"
|
||
|
||
#: tfrmsplitter.caption
|
||
msgid "Splitter"
|
||
msgstr "Dzielenie"
|
||
|
||
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
||
msgid "Require a CRC32 verification file"
|
||
msgstr "Wymaga pliku weryfikacyjnego CRC32"
|
||
|
||
#: tfrmsplitter.cmbxsize.text
|
||
msgid "1457664B - 3.5\""
|
||
msgstr "1457664B - 3.5\""
|
||
|
||
#: tfrmsplitter.grbxfile.caption
|
||
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Nazwa pliku"
|
||
|
||
#: tfrmsplitter.grbxsize.caption
|
||
msgid "Size and number of parts"
|
||
msgstr "Wielkość i liczba części"
|
||
|
||
#: tfrmsplitter.lbdirtarget.caption
|
||
msgid "Directory &target"
|
||
msgstr "Katalog docelowy"
|
||
|
||
#: tfrmsplitter.lbfilesource.caption
|
||
msgid "File &source"
|
||
msgstr "Plik źródłowy"
|
||
|
||
#: tfrmsplitter.lblnumberparts.caption
|
||
msgid "&Number of parts"
|
||
msgstr "Liczba części"
|
||
|
||
#: tfrmsplitter.rbtnbyte.caption
|
||
msgid "&Bytes"
|
||
msgstr "&Bajty"
|
||
|
||
#: tfrmsplitter.rbtngigab.caption
|
||
msgid "&Gigabytes"
|
||
msgstr "Gigabajty"
|
||
|
||
#: tfrmsplitter.rbtnkilob.caption
|
||
msgid "&Kilobytes"
|
||
msgstr "Kilobajty"
|
||
|
||
#: tfrmsplitter.rbtnmegab.caption
|
||
msgid "&Megabytes"
|
||
msgstr "Megabajty"
|
||
|
||
#: tfrmstartingsplash.caption
|
||
msgctxt "tfrmstartingsplash.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblbuild.caption
|
||
msgctxt "tfrmstartingsplash.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Kompilacja"
|
||
|
||
#: tfrmstartingsplash.lblfreepascalver.caption
|
||
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmstartingsplash.lbllazarusver.caption
|
||
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmstartingsplash.lbloperatingsystem.caption
|
||
msgid "Operating System"
|
||
msgstr "Stystem operacyjny"
|
||
|
||
#: tfrmstartingsplash.lblplatform.caption
|
||
msgid "Platform"
|
||
msgstr "Platforma"
|
||
|
||
#: tfrmstartingsplash.lblrevision.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
|
||
msgid "Revision"
|
||
msgstr "Wydanie"
|
||
|
||
#: tfrmstartingsplash.lbltitle.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblversion.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
|
||
msgid "Version"
|
||
msgstr "Wersja"
|
||
|
||
#: tfrmstartingsplash.lblwidgetsetver.caption
|
||
msgid "WidgetsetVer"
|
||
msgstr "Wersja zastawu widżetów"
|
||
|
||
#: tfrmsymlink.btncancel.caption
|
||
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Anuluj"
|
||
|
||
#: tfrmsymlink.btnok.caption
|
||
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Ok"
|
||
|
||
#: tfrmsymlink.caption
|
||
msgid "Create symbolic link"
|
||
msgstr "Utwórz link symboliczny"
|
||
|
||
#: tfrmsymlink.lblexistingfile.caption
|
||
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "Obiekt docelowy, który będzie wskazywał link"
|
||
|
||
#: tfrmsymlink.lbllinktocreate.caption
|
||
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "Nazwa linku"
|
||
|
||
#: tfrmsyncdirsdlg.btnclose.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
|
||
msgid "Close"
|
||
msgstr "Zamknij"
|
||
|
||
#: tfrmsyncdirsdlg.btncompare.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Porównaj"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir1.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir2.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Synchronizuj"
|
||
|
||
#: tfrmsyncdirsdlg.caption
|
||
msgid "Synchronize directories"
|
||
msgstr "Synchronizuj katalogi"
|
||
|
||
#: tfrmsyncdirsdlg.cbextfilter.text
|
||
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
||
msgid "asymmetric"
|
||
msgstr "asymetrycznie"
|
||
|
||
#: tfrmsyncdirsdlg.chkbycontent.caption
|
||
msgid "by content"
|
||
msgstr "wg zawartości"
|
||
|
||
#: tfrmsyncdirsdlg.chkignoredate.caption
|
||
msgid "ignore date"
|
||
msgstr "ignoruj datę"
|
||
|
||
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
||
msgid "only selected"
|
||
msgstr "tylko zaznaczone"
|
||
|
||
#: tfrmsyncdirsdlg.chksubdirs.caption
|
||
msgid "Subdirs"
|
||
msgstr "Podkatalogi"
|
||
|
||
#: tfrmsyncdirsdlg.groupbox1.caption
|
||
msgid "Show:"
|
||
msgstr "Pokaż:"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
|
||
msgid "Name"
|
||
msgstr "Nazwa"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
|
||
msgid "Size"
|
||
msgstr "Rozmiar"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
|
||
msgid "Date"
|
||
msgstr "Data"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
||
msgid "<=>"
|
||
msgstr "<=>"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
|
||
msgid "Date"
|
||
msgstr "Data"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
|
||
msgid "Size"
|
||
msgstr "Rozmiar"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
|
||
msgid "Name"
|
||
msgstr "Nazwa"
|
||
|
||
#: tfrmsyncdirsdlg.label1.caption
|
||
msgid "(in main window)"
|
||
msgstr "(w oknie głównym)"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
||
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Porównaj"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
||
msgid "View left"
|
||
msgstr "Lewy widok"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
||
msgid "View right"
|
||
msgstr "Prawy widok"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyright.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmsyncdirsdlg.sbduplicates.caption
|
||
msgid "duplicates"
|
||
msgstr "duplikaty"
|
||
|
||
#: tfrmsyncdirsdlg.sbequal.caption
|
||
msgid "="
|
||
msgstr "="
|
||
|
||
#: tfrmsyncdirsdlg.sbnotequal.caption
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: tfrmsyncdirsdlg.sbsingles.caption
|
||
msgid "singles"
|
||
msgstr "pojedyncze"
|
||
|
||
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
||
msgid "Please press \"Compare\" to start"
|
||
msgstr "Proszę nacisnąć przycisk \"Porównaj\", aby rozpocząć"
|
||
|
||
#: tfrmsyncdirsperformdlg.caption
|
||
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
|
||
msgid "Synchronize"
|
||
msgstr "Synchronizuj"
|
||
|
||
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
||
msgid "Confirm overwrites"
|
||
msgstr "Potwierdź nadpisanie"
|
||
|
||
#: tfrmtreeviewmenu.caption
|
||
msgctxt "tfrmtreeviewmenu.caption"
|
||
msgid "Tree View Menu"
|
||
msgstr "Widok Drzewa"
|
||
|
||
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
||
msgid "Select your hot directory:"
|
||
msgstr "Wybierz swój ulubiony katalog:"
|
||
|
||
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
||
msgid "Search is case sensitive"
|
||
msgstr "Wyszukiwanie uwzględnia wielkość liter"
|
||
|
||
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
||
msgid "Full collapse"
|
||
msgstr "Zwiń wszystko"
|
||
|
||
#: tfrmtreeviewmenu.pmifullexpand.caption
|
||
msgid "Full expand"
|
||
msgstr "Rozwiń wszystko"
|
||
|
||
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
||
msgid "Search ignore accents and ligatures"
|
||
msgstr "Wyszukiwanie ignoruje akcenty i ligatury"
|
||
|
||
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
||
msgid "Search is not case sensitive"
|
||
msgstr "Wyszukiwanie nie uwzględnia wielkości liter"
|
||
|
||
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
||
msgid "Search is strict regarding accents and ligatures"
|
||
msgstr "Wyszukiwanie ściśle dotyczy akcentów i ligatur"
|
||
|
||
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
||
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
||
msgstr "Nie pokazuj zawartości gałęzi, \"tylko dlatego\", że wyszukiwany ciąg znajduje się w nazwie gałęzi"
|
||
|
||
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
||
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
||
msgstr "Jeżeli poszukiwany ciąg znajduje się w nazwie gałęzi, pokaż całą gałąź, nawet jeśli elementy nie pasują do siebie"
|
||
|
||
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
||
msgid "Close Tree View Menu"
|
||
msgstr "Zamknij Widok Drzewa"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
||
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Konfiguracja Widoku Drzewa"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
||
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Konfiguracja kolorów Widoku Drzewa"
|
||
|
||
#: tfrmtweakplugin.btnadd.caption
|
||
msgid "A&dd new"
|
||
msgstr "Dodaj nowy"
|
||
|
||
#: tfrmtweakplugin.btncancel.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Porzuć"
|
||
|
||
#: tfrmtweakplugin.btnchange.caption
|
||
msgid "C&hange"
|
||
msgstr "Zmień"
|
||
|
||
#: tfrmtweakplugin.btndefault.caption
|
||
msgid "De&fault"
|
||
msgstr "Domyślny"
|
||
|
||
#: tfrmtweakplugin.btnok.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmtweakplugin.btnremove.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmtweakplugin.caption
|
||
msgid "Tweak plugin"
|
||
msgstr "Ustawienia wtyczki"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
||
msgid "De&tect archive type by content"
|
||
msgstr "Wykryj typ archiwum wg zawartości"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
||
msgid "Can de&lete files"
|
||
msgstr "Możliwość usunięcia pliku z archiwum"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
||
msgid "Supports e&ncryption"
|
||
msgstr "Wsparcie szyfrowania"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
||
msgid "Sho&w as normal files (hide packer icon)"
|
||
msgstr "Pokazuj jako zwykły plik (nie pokazuj ikony archiwum)"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
||
msgid "Supports pac&king in memory"
|
||
msgstr "Wsparcie pakowania w pamięci"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
||
msgid "Can &modify existing archives"
|
||
msgstr "Pozwól na modyfikację archiwum"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
||
msgid "&Archive can contain multiple files"
|
||
msgstr "Archiwum może zawierać kilka plików"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_new.caption
|
||
msgid "Can create new archi&ves"
|
||
msgstr "Może tworzyć nowe archiwum"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_options.caption
|
||
msgid "S&upports the options dialogbox"
|
||
msgstr "Z oknem dialogowym"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
||
msgid "Allow searchin&g for text in archives"
|
||
msgstr "Pozwala przeszukiwać archiwa"
|
||
|
||
#: tfrmtweakplugin.lbldescription.caption
|
||
msgid "&Description:"
|
||
msgstr "Opis:"
|
||
|
||
#: tfrmtweakplugin.lbldetectstr.caption
|
||
msgid "D&etect string:"
|
||
msgstr "Wykryj łańcuch (string):"
|
||
|
||
#: tfrmtweakplugin.lblextension.caption
|
||
msgid "&Extension:"
|
||
msgstr "Rozszerzenie:"
|
||
|
||
#: tfrmtweakplugin.lblflags.caption
|
||
msgid "Flags:"
|
||
msgstr "Flagi:"
|
||
|
||
#: tfrmtweakplugin.lblname.caption
|
||
msgid "&Name:"
|
||
msgstr "Nazwa:"
|
||
|
||
#: tfrmtweakplugin.lblplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "Wtyczka:"
|
||
|
||
#: tfrmtweakplugin.lblplugin1.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "Wtyczka:"
|
||
|
||
#: tfrmviewer.actabout.caption
|
||
msgid "About Viewer..."
|
||
msgstr "O listerze..."
|
||
|
||
#: tfrmviewer.actabout.hint
|
||
msgid "Displays the About message"
|
||
msgstr "Wyświetla komunikat \"O...\""
|
||
|
||
#: tfrmviewer.actcopyfile.caption
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
||
msgid "Copy File"
|
||
msgstr "Skopiuj plik"
|
||
|
||
#: tfrmviewer.actcopyfile.hint
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
||
msgid "Copy File"
|
||
msgstr "Skopiuj plik"
|
||
|
||
#: tfrmviewer.actcopytoclipboard.caption
|
||
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
||
msgid "Copy To Clipboard"
|
||
msgstr "Kopiuj do schowka"
|
||
|
||
#: tfrmviewer.actcopytoclipboardformatted.caption
|
||
msgid "Copy To Clipboard Formatted"
|
||
msgstr "Kopiuj do Schowka sformatowane"
|
||
|
||
#: tfrmviewer.actdeletefile.caption
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
||
msgid "Delete File"
|
||
msgstr "Skasuj plik"
|
||
|
||
#: tfrmviewer.actdeletefile.hint
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
||
msgid "Delete File"
|
||
msgstr "Skasuj plik"
|
||
|
||
#: tfrmviewer.actexitviewer.caption
|
||
msgctxt "tfrmviewer.actexitviewer.caption"
|
||
msgid "E&xit"
|
||
msgstr "Koniec"
|
||
|
||
#: tfrmviewer.actfind.caption
|
||
msgctxt "tfrmviewer.actfind.caption"
|
||
msgid "Find"
|
||
msgstr "Znajdź"
|
||
|
||
#: tfrmviewer.actfindnext.caption
|
||
msgctxt "tfrmviewer.actfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Znajdź następny"
|
||
|
||
#: tfrmviewer.actfindprev.caption
|
||
msgctxt "tfrmviewer.actfindprev.caption"
|
||
msgid "Find previous"
|
||
msgstr "Znajdź poprzedni"
|
||
|
||
#: tfrmviewer.actfullscreen.caption
|
||
msgctxt "tfrmviewer.actfullscreen.caption"
|
||
msgid "Full Screen"
|
||
msgstr "Pełny ekran"
|
||
|
||
#: tfrmviewer.actimagecenter.caption
|
||
msgid "Center"
|
||
msgstr "Wyśrodkuj"
|
||
|
||
#: tfrmviewer.actloadnextfile.caption
|
||
msgid "&Next"
|
||
msgstr "&Następny"
|
||
|
||
#: tfrmviewer.actloadnextfile.hint
|
||
msgid "Load Next File"
|
||
msgstr "Wczytaj następny plik"
|
||
|
||
#: tfrmviewer.actloadprevfile.caption
|
||
msgid "&Previous"
|
||
msgstr "&Poprzedni"
|
||
|
||
#: tfrmviewer.actloadprevfile.hint
|
||
msgid "Load Previous File"
|
||
msgstr "Wczytaj poprzedni plik"
|
||
|
||
#: tfrmviewer.actmirrorhorz.caption
|
||
msgid "Mirror Horizontally"
|
||
msgstr "Odbicie poziome"
|
||
|
||
#: tfrmviewer.actmirrorhorz.hint
|
||
msgid "Mirror"
|
||
msgstr "Odbicie lustrzane"
|
||
|
||
#: tfrmviewer.actmirrorvert.caption
|
||
msgid "Mirror Vertically"
|
||
msgstr "Odbicie pionowe"
|
||
|
||
#: tfrmviewer.actmovefile.caption
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
||
msgid "Move File"
|
||
msgstr "Przenieś plik"
|
||
|
||
#: tfrmviewer.actmovefile.hint
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
||
msgid "Move File"
|
||
msgstr "Przenieś plik"
|
||
|
||
#: tfrmviewer.actpreview.caption
|
||
msgctxt "tfrmviewer.actpreview.caption"
|
||
msgid "Preview"
|
||
msgstr "Podgląd"
|
||
|
||
#: tfrmviewer.actreload.caption
|
||
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
||
msgid "Reload"
|
||
msgstr "Wczytaj ponownie"
|
||
|
||
#: tfrmviewer.actreload.hint
|
||
msgid "Reload current file"
|
||
msgstr "Wczytaj ponownie bieżący plik"
|
||
|
||
#: tfrmviewer.actrotate180.caption
|
||
msgid "+ 180"
|
||
msgstr "Obróć o 180°"
|
||
|
||
#: tfrmviewer.actrotate180.hint
|
||
msgid "Rotate 180 degrees"
|
||
msgstr "Obróć o 180°"
|
||
|
||
#: tfrmviewer.actrotate270.caption
|
||
msgid "- 90"
|
||
msgstr "Obróć o 270°"
|
||
|
||
#: tfrmviewer.actrotate270.hint
|
||
msgid "Rotate -90 degrees"
|
||
msgstr "Obróć o 270°"
|
||
|
||
#: tfrmviewer.actrotate90.caption
|
||
msgid "+ 90"
|
||
msgstr "Obróć o 90°"
|
||
|
||
#: tfrmviewer.actrotate90.hint
|
||
msgid "Rotate +90 degrees"
|
||
msgstr "Obróć o 90°"
|
||
|
||
#: tfrmviewer.actsave.caption
|
||
msgctxt "tfrmviewer.actsave.caption"
|
||
msgid "Save"
|
||
msgstr "Zapisz"
|
||
|
||
#: tfrmviewer.actsaveas.caption
|
||
msgid "Save As..."
|
||
msgstr "Zapisz jako..."
|
||
|
||
#: tfrmviewer.actsaveas.hint
|
||
msgid "Save File As..."
|
||
msgstr "Zapisz plik jako..."
|
||
|
||
#: tfrmviewer.actscreenshot.caption
|
||
msgctxt "tfrmviewer.actscreenshot.caption"
|
||
msgid "Screenshot"
|
||
msgstr "Zrzut ekranu"
|
||
|
||
#: tfrmviewer.actscreenshotdelay3sec.caption
|
||
msgid "Delay 3 sec"
|
||
msgstr "Opóźnienie 3 sek"
|
||
|
||
#: tfrmviewer.actscreenshotdelay5sec.caption
|
||
msgid "Delay 5 sec"
|
||
msgstr "Opóźnienie 5 sek"
|
||
|
||
#: tfrmviewer.actselectall.caption
|
||
msgctxt "tfrmviewer.actselectall.caption"
|
||
msgid "Select All"
|
||
msgstr "Zaznacz wszystko"
|
||
|
||
#: tfrmviewer.actshowasbin.caption
|
||
msgid "Show as &Bin"
|
||
msgstr "Tryb binarny"
|
||
|
||
#: tfrmviewer.actshowasbook.caption
|
||
msgid "Show as B&ook"
|
||
msgstr "Pokaż jak&o Książkę"
|
||
|
||
#: tfrmviewer.actshowasdec.caption
|
||
msgid "Show as &Dec"
|
||
msgstr "Tryb &Dec"
|
||
|
||
#: tfrmviewer.actshowashex.caption
|
||
msgid "Show as &Hex"
|
||
msgstr "Tryb szesnastkowy (hex)"
|
||
|
||
#: tfrmviewer.actshowastext.caption
|
||
msgid "Show as &Text"
|
||
msgstr "Jako tekst"
|
||
|
||
#: tfrmviewer.actshowaswraptext.caption
|
||
msgid "Show as &Wrap text"
|
||
msgstr "Tekst z zawijaniem wierszy"
|
||
|
||
#: tfrmviewer.actshowgraphics.caption
|
||
msgid "Graphics"
|
||
msgstr "Grafika"
|
||
|
||
#: tfrmviewer.actshowplugins.caption
|
||
msgctxt "tfrmviewer.actshowplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Wtyczki"
|
||
|
||
#: tfrmviewer.actstretchimage.caption
|
||
msgid "Stretch"
|
||
msgstr "Rozciągnij"
|
||
|
||
#: tfrmviewer.actstretchimage.hint
|
||
msgid "Stretch Image"
|
||
msgstr "Rozciągnij obrazek"
|
||
|
||
#: tfrmviewer.actstretchonlylarge.caption
|
||
msgid "Stretch only large"
|
||
msgstr "Rozciągnij tylko duże"
|
||
|
||
#: tfrmviewer.actzoom.caption
|
||
msgid "Zoom"
|
||
msgstr "Powiększenia"
|
||
|
||
#: tfrmviewer.actzoomin.caption
|
||
msgid "Zoom In"
|
||
msgstr "Powiększ"
|
||
|
||
#: tfrmviewer.actzoomout.caption
|
||
msgid "Zoom Out"
|
||
msgstr "Zmniejsz"
|
||
|
||
#: tfrmviewer.btncopyfile.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmviewer.btncopyfile1.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
|
||
msgid "Copy"
|
||
msgstr "Kopiuj"
|
||
|
||
#: tfrmviewer.btncuttuimage.hint
|
||
msgid "Crop"
|
||
msgstr "Przytnij"
|
||
|
||
#: tfrmviewer.btndeletefile.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmviewer.btndeletefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: tfrmviewer.btnfullscreen.hint
|
||
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
||
msgid "Full Screen"
|
||
msgstr "Pełny ekran"
|
||
|
||
#: tfrmviewer.btngifmove.caption
|
||
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmviewer.btngiftobmp.caption
|
||
msgid "S"
|
||
msgstr "S"
|
||
|
||
#: tfrmviewer.btnhightlight.hint
|
||
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
||
msgid "Highlight"
|
||
msgstr "Wyróżnij"
|
||
|
||
#: tfrmviewer.btnmovefile.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
|
||
msgid "Move"
|
||
msgstr "Przenieś"
|
||
|
||
#: tfrmviewer.btnmovefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
|
||
msgid "Move"
|
||
msgstr "Przenieś"
|
||
|
||
#: tfrmviewer.btnnextgifframe.caption
|
||
msgid "||>"
|
||
msgstr "||>"
|
||
|
||
#: tfrmviewer.btnpaint.hint
|
||
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
||
msgid "Paint"
|
||
msgstr "Maluj"
|
||
|
||
#: tfrmviewer.btnprevgifframe.caption
|
||
msgid "<||"
|
||
msgstr "<||"
|
||
|
||
#: tfrmviewer.btnredeye.hint
|
||
msgid "Red Eyes"
|
||
msgstr "Czerwone oczy"
|
||
|
||
#: tfrmviewer.btnresize.hint
|
||
msgid "Resize"
|
||
msgstr "Zmień rozmiar"
|
||
|
||
#: tfrmviewer.btnundo.hint
|
||
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Cofnij"
|
||
|
||
#: tfrmviewer.caption
|
||
msgctxt "TFRMVIEWER.CAPTION"
|
||
msgid "Viewer"
|
||
msgstr "Lister"
|
||
|
||
#: tfrmviewer.cbslideshow.caption
|
||
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Pokaz slajdów"
|
||
|
||
#: tfrmviewer.comboboxpaint.text
|
||
msgid "Pen"
|
||
msgstr "Ołówek"
|
||
|
||
#: tfrmviewer.comboboxwidth.text
|
||
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmviewer.gboxhightlight.caption
|
||
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
||
msgid "Highlight"
|
||
msgstr "Zaznacz"
|
||
|
||
#: tfrmviewer.gboxpaint.caption
|
||
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
||
msgid "Paint"
|
||
msgstr "Maluj"
|
||
|
||
#: tfrmviewer.gboxslideshow.caption
|
||
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Pokaz slajdów"
|
||
|
||
#: tfrmviewer.gboxview.caption
|
||
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Podgląd"
|
||
|
||
#: tfrmviewer.lblhightlight.caption
|
||
msgid "0x0"
|
||
msgstr "0x0"
|
||
|
||
#: tfrmviewer.miabout.caption
|
||
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "O programie"
|
||
|
||
#: tfrmviewer.midiv1.caption
|
||
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv2.caption
|
||
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv3.caption
|
||
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv4.caption
|
||
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv5.caption
|
||
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miedit.caption
|
||
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Edytuj"
|
||
|
||
#: tfrmviewer.miencoding.caption
|
||
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Kodowanie"
|
||
|
||
#: tfrmviewer.mifile.caption
|
||
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "Plik"
|
||
|
||
#: tfrmviewer.miimage.caption
|
||
msgid "&Image"
|
||
msgstr "Rysunek"
|
||
|
||
#: tfrmviewer.miprint.caption
|
||
msgid "Print..."
|
||
msgstr "Drukuj..."
|
||
|
||
#: tfrmviewer.mirotate.caption
|
||
msgid "Rotate"
|
||
msgstr "Obróć"
|
||
|
||
#: tfrmviewer.miscreenshot.caption
|
||
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
||
msgid "Screenshot"
|
||
msgstr "Zrzut ekranu"
|
||
|
||
#: tfrmviewer.miseparator.caption
|
||
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miview.caption
|
||
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
||
msgid "&View"
|
||
msgstr "&Podgląd"
|
||
|
||
#: tfrmviewer.pmiselectall.caption
|
||
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Zaznacz wszystko"
|
||
|
||
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Gdy plik istnieje"
|
||
|
||
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Gdy plik istnieje"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Kopiuj datę/czas"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
||
msgid "Work in background (separate connection)"
|
||
msgstr "Praca w tle (oddzielne połączenie)"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Gdy plik istnieje"
|
||
|
||
#: uexifreader.rsdatetimeoriginal
|
||
msgid "Date taken"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsimageheight
|
||
#, fuzzy
|
||
msgctxt "uexifreader.rsimageheight"
|
||
msgid "Height"
|
||
msgstr "Wysokość"
|
||
|
||
#: uexifreader.rsimagewidth
|
||
#, fuzzy
|
||
msgctxt "uexifreader.rsimagewidth"
|
||
msgid "Width"
|
||
msgstr "Szerokość"
|
||
|
||
#: uexifreader.rsmake
|
||
msgid "Manufacturer"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsmodel
|
||
msgid "Camera model"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsorientation
|
||
msgid "Orientation"
|
||
msgstr ""
|
||
|
||
#: ulng.msgtrytolocatecrcfile
|
||
msgid ""
|
||
"This file cannot be found and could help to validate final combination of files:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Could you make it available and press \"OK\" when ready,\n"
|
||
"or press \"CANCEL\" to continue without it?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rscancelfilter
|
||
msgid "Cancel Quick Filter"
|
||
msgstr "Anuluj szybki filtr"
|
||
|
||
#: ulng.rscanceloperation
|
||
msgid "Cancel Current Operation"
|
||
msgstr "Anuluj bieżącą operację"
|
||
|
||
#: ulng.rscaptionforaskingfilename
|
||
msgid "Enter filename, with extension, for dropped text"
|
||
msgstr "Wprowadź nazwę pliku z rozszerzeniem, dla upuszczonego tekstu"
|
||
|
||
#: ulng.rscaptionfortextformattoimport
|
||
msgid "Text format to import"
|
||
msgstr "Format tekstu do importu"
|
||
|
||
#: ulng.rschecksumverifybroken
|
||
msgid "Broken:"
|
||
msgstr "Uszkodzone:"
|
||
|
||
#: ulng.rschecksumverifygeneral
|
||
msgid "General:"
|
||
msgstr "Ogólne:"
|
||
|
||
#: ulng.rschecksumverifymissing
|
||
msgid "Missing:"
|
||
msgstr "Brakujące:"
|
||
|
||
#: ulng.rschecksumverifyreaderror
|
||
msgid "Read error:"
|
||
msgstr "Błąd odczytu:"
|
||
|
||
#: ulng.rschecksumverifysuccess
|
||
msgid "Success:"
|
||
msgstr "Pomyślne:"
|
||
|
||
#: ulng.rschecksumverifytext
|
||
msgid "Enter checksum and select algorithm:"
|
||
msgstr "Wprowadź sumę kontrolną i wybierz algorytm:"
|
||
|
||
#: ulng.rschecksumverifytitle
|
||
msgid "Verify checksum"
|
||
msgstr "Sprawdź sumę kontrolną"
|
||
|
||
#: ulng.rschecksumverifytotal
|
||
msgid "Total:"
|
||
msgstr "Ogółem:"
|
||
|
||
#: ulng.rsclearfiltersornot
|
||
msgid "Do you want to clear filters for this new search?"
|
||
msgstr "Czy chcesz wyczyścić filtry dla tego nowego wyszukiwania?"
|
||
|
||
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
||
msgid "Clipboard doesn't contain any valid toolbar data."
|
||
msgstr "Schowek nie zawiera żadnych ważnych danych paska narzędzi"
|
||
|
||
#: ulng.rscmdcategorylistinorder
|
||
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
||
msgstr "Wszystko;Aktywny Panel;Lewy Panel;Prawy Panel;Opercje na pliku;Konfiguracja;Sieć;Różne;Port równoległy;Drukuj;Zaznacz;Bezpieczeństwo;Schowek;FTP;Nawigacja;Pomoc;Okno;Linia poleceń;Narzędzia;Widok;Użytkownik;Zakładki;Sortowanie;Dziennik"
|
||
|
||
#: ulng.rscmdkindofsort
|
||
msgid "Legacy sorted;A-Z sorted"
|
||
msgstr ""
|
||
|
||
#: ulng.rscolattr
|
||
msgid "Attr"
|
||
msgstr "Atr."
|
||
|
||
#: ulng.rscoldate
|
||
msgctxt "ulng.rscoldate"
|
||
msgid "Date"
|
||
msgstr "Data"
|
||
|
||
#: ulng.rscolext
|
||
msgid "Ext"
|
||
msgstr "Rozsz."
|
||
|
||
#: ulng.rscolname
|
||
msgctxt "ulng.rscolname"
|
||
msgid "Name"
|
||
msgstr "Nazwa"
|
||
|
||
#: ulng.rscolsize
|
||
msgctxt "ulng.rscolsize"
|
||
msgid "Size"
|
||
msgstr "Rozmiar"
|
||
|
||
#: ulng.rsconfcolalign
|
||
msgid "Align"
|
||
msgstr "Wyrównywanie"
|
||
|
||
#: ulng.rsconfcolcaption
|
||
msgid "Caption"
|
||
msgstr "Nagłówek"
|
||
|
||
#: ulng.rsconfcoldelete
|
||
msgctxt "ulng.rsconfcoldelete"
|
||
msgid "Delete"
|
||
msgstr "Usuń"
|
||
|
||
#: ulng.rsconfcolfieldcont
|
||
msgid "Field contents"
|
||
msgstr "Pola danych"
|
||
|
||
#: ulng.rsconfcolmove
|
||
msgctxt "ulng.rsconfcolmove"
|
||
msgid "Move"
|
||
msgstr "Przenieś"
|
||
|
||
#: ulng.rsconfcolwidth
|
||
msgctxt "ulng.rsconfcolwidth"
|
||
msgid "Width"
|
||
msgstr "Szerokość"
|
||
|
||
#: ulng.rsconfcustheader
|
||
msgid "Customize column"
|
||
msgstr "Dostosuj kolumny"
|
||
|
||
#: ulng.rsconfigurationfileassociation
|
||
msgid "Configure file association"
|
||
msgstr "Konfiguruj skojarzenia plików"
|
||
|
||
#: ulng.rsconfirmexecution
|
||
msgid "Confirming command line and parameters"
|
||
msgstr "Potwierdzenie wiersza polecenia i parametrów"
|
||
|
||
#: ulng.rscopynametemplate
|
||
msgid "Copy (%d) %s"
|
||
msgstr "Kopiuj (%d) %s"
|
||
|
||
#: ulng.rsdefaultimporteddctoolbarhint
|
||
msgid "Imported DC toolbar"
|
||
msgstr "Zaimportowany pasek narzędzi DC"
|
||
|
||
#: ulng.rsdefaultimportedtctoolbarhint
|
||
msgid "Imported TC toolbar"
|
||
msgstr "Zaimportowany pasek narzędi TC"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtext
|
||
msgid "_DroppedText"
|
||
msgstr "_UpuszczonyTekst"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
||
msgid "_DroppedHTMLtext"
|
||
msgstr "_UpuszczonytekstHTML"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
||
msgid "_DroppedRichtext"
|
||
msgstr "_UpuszczonyRTF"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
||
msgid "_DroppedSimpleText"
|
||
msgstr "_Upuszczonyprostytekst"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
||
msgid "_DroppedUnicodeUTF16text"
|
||
msgstr "_UpuszczonytekstUnicodeUTF16"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
||
msgid "_DroppedUnicodeUTF8text"
|
||
msgstr "_UpuszczonytekstUnicodeUTF8"
|
||
|
||
#: ulng.rsdiffadds
|
||
msgid " Adds: "
|
||
msgstr "Dodanych:"
|
||
|
||
#: ulng.rsdiffdeletes
|
||
msgid " Deletes: "
|
||
msgstr "Usuniętych:"
|
||
|
||
#: ulng.rsdifffilesidentical
|
||
msgid "The two files are identical!"
|
||
msgstr "Dwa pliki są identyczne!"
|
||
|
||
#: ulng.rsdiffmatches
|
||
msgid " Matches: "
|
||
msgstr "Pasujące:"
|
||
|
||
#: ulng.rsdiffmodifies
|
||
msgid " Modifies: "
|
||
msgstr "Zmodyfikowane:"
|
||
|
||
#: ulng.rsdlgbuttonabort
|
||
msgid "Ab&ort"
|
||
msgstr "Przerwij"
|
||
|
||
#: ulng.rsdlgbuttonall
|
||
msgctxt "ulng.rsdlgbuttonall"
|
||
msgid "A&ll"
|
||
msgstr "Wszystko"
|
||
|
||
#: ulng.rsdlgbuttonappend
|
||
msgid "A&ppend"
|
||
msgstr "Dodaj"
|
||
|
||
#: ulng.rsdlgbuttonautorenamesource
|
||
msgid "A&uto-rename source files"
|
||
msgstr "A&utomatyczna zmiana nazwy plików źródłowych"
|
||
|
||
#: ulng.rsdlgbuttoncancel
|
||
msgctxt "ulng.rsdlgbuttoncancel"
|
||
msgid "&Cancel"
|
||
msgstr "&Anuluj"
|
||
|
||
#: ulng.rsdlgbuttoncontinue
|
||
msgid "&Continue"
|
||
msgstr "Kontynuuj"
|
||
|
||
#: ulng.rsdlgbuttoncopyinto
|
||
msgid "&Merge"
|
||
msgstr "Połącz"
|
||
|
||
#: ulng.rsdlgbuttoncopyintoall
|
||
msgid "Mer&ge All"
|
||
msgstr "Połącz &wszystkieh"
|
||
|
||
#: ulng.rsdlgbuttonexitprogram
|
||
msgid "E&xit program"
|
||
msgstr "Wyjdź z programu"
|
||
|
||
#: ulng.rsdlgbuttonignore
|
||
msgid "Ig&nore"
|
||
msgstr "Ig&noruj"
|
||
|
||
#: ulng.rsdlgbuttonignoreall
|
||
msgid "I&gnore All"
|
||
msgstr "Ignoruj wszystko"
|
||
|
||
#: ulng.rsdlgbuttonno
|
||
msgid "&No"
|
||
msgstr "&Nie"
|
||
|
||
#: ulng.rsdlgbuttonnone
|
||
msgid "Non&e"
|
||
msgstr "Żaden"
|
||
|
||
#: ulng.rsdlgbuttonok
|
||
msgctxt "ulng.rsdlgbuttonok"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: ulng.rsdlgbuttonother
|
||
msgid "Ot&her"
|
||
msgstr "Inne"
|
||
|
||
#: ulng.rsdlgbuttonoverwrite
|
||
msgid "&Overwrite"
|
||
msgstr "&Zastąp"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteall
|
||
msgid "Overwrite &All"
|
||
msgstr "Z&astąp wszystko"
|
||
|
||
#: ulng.rsdlgbuttonoverwritelarger
|
||
msgid "Overwrite All &Larger"
|
||
msgstr "Nadpisz wszystkie &większe"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteolder
|
||
msgid "Overwrite All Ol&der"
|
||
msgstr "Nadpisz wszystkie &starsze"
|
||
|
||
#: ulng.rsdlgbuttonoverwritesmaller
|
||
msgid "Overwrite All S&maller"
|
||
msgstr "Nadpisz wszystkie &mniejsze"
|
||
|
||
#: ulng.rsdlgbuttonrename
|
||
msgctxt "ulng.rsdlgbuttonrename"
|
||
msgid "R&ename"
|
||
msgstr "Zmień nazwę"
|
||
|
||
#: ulng.rsdlgbuttonresume
|
||
msgid "&Resume"
|
||
msgstr "&Wznów"
|
||
|
||
#: ulng.rsdlgbuttonretry
|
||
msgid "Re&try"
|
||
msgstr "Ponów"
|
||
|
||
#: ulng.rsdlgbuttonskip
|
||
msgid "&Skip"
|
||
msgstr "&Pomiń"
|
||
|
||
#: ulng.rsdlgbuttonskipall
|
||
msgid "S&kip All"
|
||
msgstr "Pomiń &wszystko"
|
||
|
||
#: ulng.rsdlgbuttonyes
|
||
msgid "&Yes"
|
||
msgstr "&Tak"
|
||
|
||
#: ulng.rsdlgcp
|
||
msgctxt "ulng.rsdlgcp"
|
||
msgid "Copy file(s)"
|
||
msgstr "Kopiuj plik(i)"
|
||
|
||
#: ulng.rsdlgmv
|
||
msgid "Move file(s)"
|
||
msgstr "Przenieś plik(i)"
|
||
|
||
#: ulng.rsdlgoppause
|
||
msgid "Pau&se"
|
||
msgstr "Pauza"
|
||
|
||
#: ulng.rsdlgopstart
|
||
msgctxt "ulng.rsdlgopstart"
|
||
msgid "&Start"
|
||
msgstr "Start"
|
||
|
||
#: ulng.rsdlgqueue
|
||
msgid "Queue"
|
||
msgstr "Kolejka"
|
||
|
||
#: ulng.rsdlgspeed
|
||
msgid "Speed %s/s"
|
||
msgstr "Prędkość %s/s"
|
||
|
||
#: ulng.rsdlgspeedtime
|
||
msgid "Speed %s/s, time remaining %s"
|
||
msgstr "Prędkość %s/s, pozostały czas %s"
|
||
|
||
#: ulng.rsdraganddroptextformat
|
||
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
||
msgstr "Format RTF;Format HTML;Format Unicode;Format tekstowy"
|
||
|
||
#: ulng.rsdrivenolabel
|
||
msgid "<no label>"
|
||
msgstr "<brak etykiety>"
|
||
|
||
#: ulng.rsdrivenomedia
|
||
msgid "<no media>"
|
||
msgstr "<brak nośnika>"
|
||
|
||
#: ulng.rseditabouttext
|
||
msgid "Internal Editor of Double Commander."
|
||
msgstr "Wewnętrzny edytor Double Commandera"
|
||
|
||
#: ulng.rseditgotolinequery
|
||
msgid "Goto line:"
|
||
msgstr "Idź do linii:"
|
||
|
||
#: ulng.rseditgotolinetitle
|
||
msgid "Goto Line"
|
||
msgstr "Idź do linii"
|
||
|
||
#: ulng.rseditnewfile
|
||
msgid "new.txt"
|
||
msgstr "nowy.txt"
|
||
|
||
#: ulng.rseditnewfilename
|
||
msgid "Filename:"
|
||
msgstr "Nazwa pliku:"
|
||
|
||
#: ulng.rseditnewopen
|
||
msgid "Open file"
|
||
msgstr "Otwórz plik"
|
||
|
||
#: ulng.rseditsearchback
|
||
msgid "&Backward"
|
||
msgstr "Cofnij"
|
||
|
||
#: ulng.rseditsearchcaption
|
||
msgid "Search"
|
||
msgstr "Szukaj"
|
||
|
||
#: ulng.rseditsearchfrw
|
||
msgid "&Forward"
|
||
msgstr "Naprzód"
|
||
|
||
#: ulng.rseditsearchreplace
|
||
msgctxt "ulng.rseditsearchreplace"
|
||
msgid "Replace"
|
||
msgstr "Zamień"
|
||
|
||
#: ulng.rseditwithexternaleditor
|
||
msgid "with external editor"
|
||
msgstr "w zewnętrznym edytorze"
|
||
|
||
#: ulng.rseditwithinternaleditor
|
||
msgid "with internal editor"
|
||
msgstr "w wewnętrznym edytorze"
|
||
|
||
#: ulng.rsexecuteviashell
|
||
msgctxt "ulng.rsexecuteviashell"
|
||
msgid "Execute via shell"
|
||
msgstr "Uruchom przez shell"
|
||
|
||
#: ulng.rsexecuteviaterminalclose
|
||
msgctxt "ulng.rsexecuteviaterminalclose"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Uruchom przez terminal i zamknij"
|
||
|
||
#: ulng.rsexecuteviaterminalstayopen
|
||
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Uruchom przez terminal i pozostaw otwarty"
|
||
|
||
#: ulng.rsfavtabspanelsideselection
|
||
msgid "Left;Right;Active;Inactive;Both;None"
|
||
msgstr "Lewy;Prawy;Aktywny;Nieaktywny;Oba,Żaden"
|
||
|
||
#: ulng.rsfavtabssavedirhistory
|
||
msgid "No;Yes"
|
||
msgstr "Nie;Tak"
|
||
|
||
#: ulng.rsfilenameexportedtcbarprefix
|
||
msgid "Exported_from_DC"
|
||
msgstr "Wyeksportowane_z_DC"
|
||
|
||
#: ulng.rsfileopdirectoryexistsoptions
|
||
msgid "Ask;Merge;Skip"
|
||
msgstr "Pytaj;Połącz;Pomiń"
|
||
|
||
#: ulng.rsfileopfileexistsoptions
|
||
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
||
msgstr "Pytaj;Zastąp;Zastąp starsze;Pomiń"
|
||
|
||
#: ulng.rsfileopsetpropertyerroroptions
|
||
msgid "Ask;Don't set anymore;Ignore errors"
|
||
msgstr "Pytaj;Nie ustawiaj więcej;Ignoruj błędy"
|
||
|
||
#: ulng.rsfilterstatus
|
||
msgid "FILTER"
|
||
msgstr "FILTR"
|
||
|
||
#: ulng.rsfinddefinetemplate
|
||
msgid "Define template"
|
||
msgstr "Zdefiniuj wzorzec"
|
||
|
||
#: ulng.rsfinddepth
|
||
msgid "%s level(s)"
|
||
msgstr "%s poziom(y)"
|
||
|
||
#: ulng.rsfinddepthall
|
||
msgid "all (unlimited depth)"
|
||
msgstr "Wszystko (bez ograniczeń)"
|
||
|
||
#: ulng.rsfinddepthcurdir
|
||
msgid "current dir only"
|
||
msgstr "Tylko bieżący katalog"
|
||
|
||
#: ulng.rsfinddirnoex
|
||
msgid "Directory %s does not exist!"
|
||
msgstr "Katalog %s nie istnieje!"
|
||
|
||
#: ulng.rsfindfound
|
||
msgid "Found: %d"
|
||
msgstr "Szukaj: %d"
|
||
|
||
#: ulng.rsfindsavetemplatecaption
|
||
msgid "Save search template"
|
||
msgstr "Zapisz szablon wyszukiwania"
|
||
|
||
#: ulng.rsfindsavetemplatetitle
|
||
msgid "Template name:"
|
||
msgstr "Nazwa szablonu:"
|
||
|
||
#: ulng.rsfindscanned
|
||
msgid "Scanned: %d"
|
||
msgstr "Przeskanowano: %d"
|
||
|
||
#: ulng.rsfindscanning
|
||
msgid "Scanning"
|
||
msgstr "Skanowanie"
|
||
|
||
#: ulng.rsfindsearchfiles
|
||
msgctxt "ulng.rsfindsearchfiles"
|
||
msgid "Find files"
|
||
msgstr "Znajdź plik"
|
||
|
||
#: ulng.rsfindtimeofscan
|
||
msgid "Time of scan: "
|
||
msgstr "Czas skanowania:"
|
||
|
||
#: ulng.rsfindwherebeg
|
||
msgid "Begin at"
|
||
msgstr "Zacznij w"
|
||
|
||
#: ulng.rsfreemsg
|
||
msgid "Free %s from %s bytes"
|
||
msgstr "Wolne %s z %s"
|
||
|
||
#: ulng.rsfreemsgshort
|
||
msgid "%s bytes free"
|
||
msgstr "%s bajtów wolnych"
|
||
|
||
#: ulng.rsfuncatime
|
||
msgid "Access date/time"
|
||
msgstr "Data/czas dostępu"
|
||
|
||
#: ulng.rsfuncattr
|
||
msgctxt "ulng.rsfuncattr"
|
||
msgid "Attributes"
|
||
msgstr "Atrybuty"
|
||
|
||
#: ulng.rsfunccomment
|
||
msgid "Comment"
|
||
msgstr "Komentarz"
|
||
|
||
#: ulng.rsfunccompressedsize
|
||
msgid "Compressed size"
|
||
msgstr "Rozmiar skompresowany"
|
||
|
||
#: ulng.rsfuncctime
|
||
msgid "Creation date/time"
|
||
msgstr "Data/czas utworzenia"
|
||
|
||
#: ulng.rsfuncext
|
||
msgid "Extension"
|
||
msgstr "Rozszerzenie"
|
||
|
||
#: ulng.rsfuncgroup
|
||
msgctxt "ulng.rsfuncgroup"
|
||
msgid "Group"
|
||
msgstr "Grupa"
|
||
|
||
#: ulng.rsfunchtime
|
||
msgid "Change date/time"
|
||
msgstr "Zmień datę/czas"
|
||
|
||
#: ulng.rsfunclinkto
|
||
msgid "Link to"
|
||
msgstr "Link do"
|
||
|
||
#: ulng.rsfuncmtime
|
||
msgid "Modification date/time"
|
||
msgstr "Data/czas modyfikacji"
|
||
|
||
#: ulng.rsfuncname
|
||
msgctxt "ulng.rsfuncname"
|
||
msgid "Name"
|
||
msgstr "Nazwa"
|
||
|
||
#: ulng.rsfuncnamenoext
|
||
msgid "Name without extension"
|
||
msgstr "Nazwa bez rozszerzenia"
|
||
|
||
#: ulng.rsfuncowner
|
||
msgctxt "ulng.rsfuncowner"
|
||
msgid "Owner"
|
||
msgstr "Właściciel"
|
||
|
||
#: ulng.rsfuncpath
|
||
msgctxt "ulng.rsfuncpath"
|
||
msgid "Path"
|
||
msgstr "Ścieżka"
|
||
|
||
#: ulng.rsfuncsize
|
||
msgctxt "ulng.rsfuncsize"
|
||
msgid "Size"
|
||
msgstr "Rozmiar"
|
||
|
||
#: ulng.rsfunctype
|
||
msgid "Type"
|
||
msgstr "Typ"
|
||
|
||
#: ulng.rsharderrcreate
|
||
msgid "Error creating hardlink."
|
||
msgstr "Błąd podczas tworzenia twardego linku."
|
||
|
||
#: ulng.rshotdirforcesortingorderchoices
|
||
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
||
msgstr "brak;Nazwa, a-z;Nazwa, z-a;Rozsz., a-z;Rozsz., z-a;Rozm. 9-0;Rozm. 0-9;Data 9-0;Data 0-9"
|
||
|
||
#: ulng.rshotdirwarningabortrestorebackup
|
||
msgid ""
|
||
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
||
"\n"
|
||
"Are you sure you want to proceed?\n"
|
||
msgstr ""
|
||
"Ostrzeżenie! Przywrócenie pliku kopii zapasowej .hotlist, spowoduje usunięcie istniejącej listy i zastąpienie jej przez zaimportowaną.\n"
|
||
"\n"
|
||
"Czy na pewno chcesz kontynuować?\n"
|
||
|
||
#: ulng.rshotkeycategorycopymovedialog
|
||
msgid "Copy/Move Dialog"
|
||
msgstr "Okno dialogowe kopiuj/przenieś"
|
||
|
||
#: ulng.rshotkeycategorydiffer
|
||
msgctxt "ulng.rshotkeycategorydiffer"
|
||
msgid "Differ"
|
||
msgstr "Różnice"
|
||
|
||
#: ulng.rshotkeycategoryeditcommentdialog
|
||
msgid "Edit Comment Dialog"
|
||
msgstr "Okno dialogowe edycji komentarza"
|
||
|
||
#: ulng.rshotkeycategoryeditor
|
||
msgctxt "ulng.rshotkeycategoryeditor"
|
||
msgid "Editor"
|
||
msgstr "Edytor"
|
||
|
||
#: ulng.rshotkeycategoryfindfiles
|
||
msgctxt "ulng.rshotkeycategoryfindfiles"
|
||
msgid "Find files"
|
||
msgstr "Znajdź pliki"
|
||
|
||
#: ulng.rshotkeycategorymain
|
||
msgid "Main"
|
||
msgstr "Główny"
|
||
|
||
#: ulng.rshotkeycategoryviewer
|
||
msgctxt "ulng.rshotkeycategoryviewer"
|
||
msgid "Viewer"
|
||
msgstr "Lister"
|
||
|
||
#: ulng.rshotkeyfilealreadyexists
|
||
msgid ""
|
||
"A setup with that name already exists.\n"
|
||
"Do you want to overwrite it?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfileconfirmdefault
|
||
msgid "Are you sure you want to restore default?"
|
||
msgstr "Czy na pewno chcesz przywrócić domyślny?"
|
||
|
||
#: ulng.rshotkeyfileconfirmerasure
|
||
msgid "Are you sure you want to erase setup \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilecopyof
|
||
msgid "Copy of %s"
|
||
msgstr "Kopia z %s"
|
||
|
||
#: ulng.rshotkeyfileinputnewname
|
||
msgid "Input your new name"
|
||
msgstr "Wprowadź nową nazwę"
|
||
|
||
#: ulng.rshotkeyfilemustkeepone
|
||
msgid "You must keep at least one shortcut file."
|
||
msgstr "Należy zachować co najmniej jeden plik skrótu."
|
||
|
||
#: ulng.rshotkeyfilenewname
|
||
msgid "New name"
|
||
msgstr "Nowa nazwa"
|
||
|
||
#: ulng.rshotkeyfilesavemodified
|
||
msgid ""
|
||
"\"%s\" setup has been modified.\n"
|
||
"Do you want to save it now?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeynoscenter
|
||
msgid "No shortcut with \"ENTER\""
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeysortorder
|
||
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
||
msgstr "Wg nazwy polecenia;Wg klawisza skrótu (pogrupowane);Wg klawisza skrótu (po jednym w linii)"
|
||
|
||
#: ulng.rsimporttoolbarproblem
|
||
msgid "Cannot find reference to default bar file"
|
||
msgstr "Nie można znaleźć odniesienia do domyślnego pliku bar"
|
||
|
||
#: ulng.rslistoffindfileswindows
|
||
msgid "List of \"Find files\" windows"
|
||
msgstr "Lista okien \"Znajdź pliki\""
|
||
|
||
#: ulng.rsmarkminus
|
||
msgid "Unselect mask"
|
||
msgstr "Maska odznaczania"
|
||
|
||
#: ulng.rsmarkplus
|
||
msgid "Select mask"
|
||
msgstr "Maska zaznaczania"
|
||
|
||
#: ulng.rsmaskinput
|
||
msgid "Input mask:"
|
||
msgstr "Maska wejściowa:"
|
||
|
||
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
||
msgid "A columns view with that name already exists."
|
||
msgstr "Widok kolumn o tej nazwie już istnieje."
|
||
|
||
#: ulng.rsmenuconfigurecolumnssavetochange
|
||
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
||
msgstr "Aby zmienić bieżącą edycję widoku kolmun, albo ZAPISAĆ, SKOPIOWAĆ lub USUNĄĆ obecną edycję"
|
||
|
||
#: ulng.rsmenuconfigurecustomcolumns
|
||
msgid "Configure custom columns"
|
||
msgstr "Konfiguruj niestandardowe kolumny"
|
||
|
||
#: ulng.rsmenuconfigureentercustomcolumnname
|
||
msgid "Enter new custom columns name"
|
||
msgstr "Wpisz nową nazwę kolumny niestandardowej"
|
||
|
||
#: ulng.rsmnuactions
|
||
msgctxt "ulng.rsmnuactions"
|
||
msgid "Actions"
|
||
msgstr "Polecenia"
|
||
|
||
#: ulng.rsmnucopynetnamestoclip
|
||
msgid "Copy names with UNC path"
|
||
msgstr "Kopiuj nazwy ze ścieżką UNC"
|
||
|
||
#: ulng.rsmnudisconnectnetworkdrive
|
||
msgid "Disconnect Network Drive..."
|
||
msgstr "Odłącz dysk sieciowy"
|
||
|
||
#: ulng.rsmnuedit
|
||
msgctxt "ulng.rsmnuedit"
|
||
msgid "Edit"
|
||
msgstr "Edytuj"
|
||
|
||
#: ulng.rsmnueject
|
||
msgid "Eject"
|
||
msgstr "Wysuń"
|
||
|
||
#: ulng.rsmnuextracthere
|
||
msgid "Extract here..."
|
||
msgstr "Wypakuj tutaj"
|
||
|
||
#: ulng.rsmnumapnetworkdrive
|
||
msgid "Map Network Drive..."
|
||
msgstr "Mapuj dysk sieciowy"
|
||
|
||
#: ulng.rsmnumount
|
||
msgid "Mount"
|
||
msgstr "Zamontuj"
|
||
|
||
#: ulng.rsmnunew
|
||
msgctxt "ulng.rsmnunew"
|
||
msgid "New"
|
||
msgstr "Nowy"
|
||
|
||
#: ulng.rsmnunomedia
|
||
msgid "No media available"
|
||
msgstr "Brak dostępnego nośnika"
|
||
|
||
#: ulng.rsmnuopen
|
||
msgctxt "ulng.rsmnuopen"
|
||
msgid "Open"
|
||
msgstr "Otwórz"
|
||
|
||
#: ulng.rsmnuopenwith
|
||
msgid "Open with"
|
||
msgstr "Otwórz z ..."
|
||
|
||
#: ulng.rsmnuopenwithother
|
||
msgctxt "ulng.rsmnuopenwithother"
|
||
msgid "Other..."
|
||
msgstr "Inne..."
|
||
|
||
#: ulng.rsmnupackhere
|
||
msgid "Pack here..."
|
||
msgstr "Spakuj tutaj..."
|
||
|
||
#: ulng.rsmnusortby
|
||
msgid "Sort by"
|
||
msgstr "Sortuj wg"
|
||
|
||
#: ulng.rsmnuumount
|
||
msgid "Unmount"
|
||
msgstr "Odmontuj"
|
||
|
||
#: ulng.rsmnuview
|
||
msgctxt "ulng.rsmnuview"
|
||
msgid "View"
|
||
msgstr "Podgląd"
|
||
|
||
#: ulng.rsmsgaccount
|
||
msgid "Account:"
|
||
msgstr "Konto:"
|
||
|
||
#: ulng.rsmsgarchivercustomparams
|
||
msgid "Additional parameters for archiver command-line:"
|
||
msgstr "Dodatkowe parametry linii poleceń archiwizera:"
|
||
|
||
#: ulng.rsmsgaskquoteornot
|
||
msgid "Do you want to enclose between quotes?"
|
||
msgstr "Chcesz dołączyć cudzysłowie?"
|
||
|
||
#: ulng.rsmsgbadcrc32
|
||
msgid ""
|
||
"Bad CRC32 for resulting file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Do you want to keep the resulting corrupted file anyway?\n"
|
||
msgstr ""
|
||
"Nieprawidłowy CRC32 dla pliku wynikowego:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Czy chcesz mimo to zachować uszkodzony plik wynikowy?\n"
|
||
|
||
#: ulng.rsmsgcannotcopymoveitself
|
||
msgid "You can not copy/move a file \"%s\" to itself!"
|
||
msgstr "Nie można skopiować/przenieść pliku \"%s\" do niego samego!"
|
||
|
||
#: ulng.rsmsgcannotdeletedirectory
|
||
msgid "Cannot delete directory %s"
|
||
msgstr "Nie mogę usunąć katalogu %s"
|
||
|
||
#: ulng.rsmsgcannotoverwritedirectory
|
||
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
||
msgstr "Nie można nadpisać katalogu \"%s\" nie-katalogiem \"%s\""
|
||
|
||
#: ulng.rsmsgchdirfailed
|
||
msgid "ChDir to [%s] failed!"
|
||
msgstr "Nieudane przejście do katalogu [%s] !"
|
||
|
||
#: ulng.rsmsgcloseallinactivetabs
|
||
msgid "Remove all inactive tabs?"
|
||
msgstr "Usunąć nieaktywne zakładki?"
|
||
|
||
#: ulng.rsmsgcloselockedtab
|
||
msgid "This tab (%s) is locked! Close anyway?"
|
||
msgstr "Zakładka (%s) jest zablokowana! Zamknąć mimo to?"
|
||
|
||
#: ulng.rsmsgconfirmquit
|
||
msgid "Are you sure you want to quit?"
|
||
msgstr "Na pewno zakończyć?"
|
||
|
||
#: ulng.rsmsgcopybackward
|
||
msgid "The file %s has changed. Do you want to copy it backward?"
|
||
msgstr "Plik %s został zmieniony. Czy chcesz skopiować go wstecz?"
|
||
|
||
#: ulng.rsmsgcouldnotcopybackward
|
||
msgid "Could not copy backward - do you want to keep the changed file?"
|
||
msgstr "Nie można skopiować wstecz - czy chcesz zachować zmieniony plik?"
|
||
|
||
#: ulng.rsmsgcpfldr
|
||
msgid "Copy %d selected files/directories?"
|
||
msgstr "Skopiować %d wybranych plików/katalogów?"
|
||
|
||
#: ulng.rsmsgcpsel
|
||
msgid "Copy selected \"%s\"?"
|
||
msgstr "Skopiować wybrane \"%s\"?"
|
||
|
||
#: ulng.rsmsgcreateanewfiletype
|
||
msgid "< Create a new file type \"%s files\" >"
|
||
msgstr "< Utwórz nowy typ pliku \"%s plików\" >"
|
||
|
||
#: ulng.rsmsgdctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a DC Toolbar file"
|
||
msgstr "Podaj położenie i nazwę pliku do zapisania plików Paska Narzędzi DC"
|
||
|
||
#: ulng.rsmsgdefaultcustomactionname
|
||
msgid "Custom action"
|
||
msgstr "Niestandardowa akcja"
|
||
|
||
#: ulng.rsmsgdeletepartiallycopied
|
||
msgid "Delete the partially copied file ?"
|
||
msgstr "Skasować ten częściowo skopiowany plik?"
|
||
|
||
#: ulng.rsmsgdelfldr
|
||
msgid "Delete %d selected files/directories?"
|
||
msgstr "Usunąć %d wybranych plików/katalogów?"
|
||
|
||
#: ulng.rsmsgdelfldrt
|
||
msgid "Delete %d selected files/directories into trash can?"
|
||
msgstr "Wyrzucić do kosza %d wybranych plików/katalogów?"
|
||
|
||
#: ulng.rsmsgdelsel
|
||
msgid "Delete selected \"%s\"?"
|
||
msgstr "Usunąć wybrane \"%s\"?"
|
||
|
||
#: ulng.rsmsgdelselt
|
||
msgid "Delete selected \"%s\" into trash can?"
|
||
msgstr "Usunąć wybrane \"%s\" do kosza?"
|
||
|
||
#: ulng.rsmsgdeltotrashforce
|
||
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
||
msgstr "Nie można usunąć \"%s\" do kosza! Usunąć bezpośrednio?"
|
||
|
||
#: ulng.rsmsgdisknotavail
|
||
msgid "Disk is not available"
|
||
msgstr "Dysk jest niedostępny"
|
||
|
||
#: ulng.rsmsgentercustomaction
|
||
msgid "Enter custom action name:"
|
||
msgstr "Podaj nazwę niestandardowej akcji:"
|
||
|
||
#: ulng.rsmsgenterfileext
|
||
msgid "Enter file extension:"
|
||
msgstr "Podaj rozszerzenie:"
|
||
|
||
#: ulng.rsmsgentername
|
||
msgid "Enter name:"
|
||
msgstr "Podaj nazwę:"
|
||
|
||
#: ulng.rsmsgenternewfiletypename
|
||
msgid "Enter name of new file type to create for extension \"%s\""
|
||
msgstr "Wprowadź nazwę nowego typu pliku, aby utworzyć rozszerzenie \"%s\""
|
||
|
||
#: ulng.rsmsgerrbadarchive
|
||
msgid "CRC error in archive data"
|
||
msgstr "Błąd CRC w archiwum danych"
|
||
|
||
#: ulng.rsmsgerrbaddata
|
||
msgid "Data is bad"
|
||
msgstr "Błąd w danych"
|
||
|
||
#: ulng.rsmsgerrcannotconnect
|
||
msgid "Can not connect to server: \"%s\""
|
||
msgstr "Nie można połączyć z serwerem: \"%s\""
|
||
|
||
#: ulng.rsmsgerrcannotcopyfile
|
||
msgid "Cannot copy file %s to %s"
|
||
msgstr "Nie można skopiować pliku %s do %s"
|
||
|
||
#: ulng.rsmsgerrcreatefiledirectoryexists
|
||
msgid "There already exists a directory named \"%s\"."
|
||
msgstr "Katalog o nazwie \"%s\" już istnieje."
|
||
|
||
#: ulng.rsmsgerrdatenotsupported
|
||
msgid "Date %s is not supported"
|
||
msgstr "Data %s nie jest obsługiwana"
|
||
|
||
#: ulng.rsmsgerrdirexists
|
||
msgid "Directory %s exists!"
|
||
msgstr "Katalog %s już istnieje!"
|
||
|
||
#: ulng.rsmsgerreaborted
|
||
msgid "Function aborted by user"
|
||
msgstr "Przerwane przez użytkownika."
|
||
|
||
#: ulng.rsmsgerreclose
|
||
msgid "Error closing file"
|
||
msgstr "Błąd zamknięcia pliku"
|
||
|
||
#: ulng.rsmsgerrecreate
|
||
msgid "Cannot create file"
|
||
msgstr "Nie można utworzyć pliku"
|
||
|
||
#: ulng.rsmsgerrendarchive
|
||
msgid "No more files in archive"
|
||
msgstr "Nie ma więcej plików w archiwum"
|
||
|
||
#: ulng.rsmsgerreopen
|
||
msgid "Cannot open existing file"
|
||
msgstr "Nie można otworzyć pliku"
|
||
|
||
#: ulng.rsmsgerreread
|
||
msgid "Error reading from file"
|
||
msgstr "Błąd odczytu z pliku"
|
||
|
||
#: ulng.rsmsgerrewrite
|
||
msgid "Error writing to file"
|
||
msgstr "Błąd zapisu do pliku"
|
||
|
||
#: ulng.rsmsgerrforcedir
|
||
msgid "Can not create directory %s!"
|
||
msgstr "Nie można utworzyć katalogu %s!"
|
||
|
||
#: ulng.rsmsgerrinvalidlink
|
||
msgid "Invalid link"
|
||
msgstr "Błędny link"
|
||
|
||
#: ulng.rsmsgerrnofiles
|
||
msgid "No files found"
|
||
msgstr "Nie znaleziono plików"
|
||
|
||
#: ulng.rsmsgerrnomemory
|
||
msgid "Not enough memory"
|
||
msgstr "Za mało pamięci"
|
||
|
||
#: ulng.rsmsgerrnotsupported
|
||
msgid "Function not supported!"
|
||
msgstr "Funkcja nie jest obsługiwana!"
|
||
|
||
#: ulng.rsmsgerrorincontextmenucommand
|
||
msgid "Error in context menu command"
|
||
msgstr "Błąd w poleceniu menu kontekstowego"
|
||
|
||
#: ulng.rsmsgerrorloadingconfiguration
|
||
msgid "Error when loading configuration"
|
||
msgstr "Błąd podczas ładowania konfiguracji"
|
||
|
||
#: ulng.rsmsgerrregexpsyntax
|
||
msgid "Syntax error in regular expression!"
|
||
msgstr "Błąd składni w wyrażeniu regularnym!"
|
||
|
||
#: ulng.rsmsgerrrename
|
||
msgid "Cannot rename file %s to %s"
|
||
msgstr "Nie można zmienić nazwy pliku %s na %s"
|
||
|
||
#: ulng.rsmsgerrsaveassociation
|
||
msgid "Can not save association!"
|
||
msgstr "Nie można zapisać powiązania!"
|
||
|
||
#: ulng.rsmsgerrsavefile
|
||
msgid "Cannot save file"
|
||
msgstr "Nie można zapisać pliku"
|
||
|
||
#: ulng.rsmsgerrsetattribute
|
||
msgid "Can not set attributes for \"%s\""
|
||
msgstr "Nie można ustawić atrybutów dla \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetdatetime
|
||
msgid "Can not set date/time for \"%s\""
|
||
msgstr "Nie można ustawić daty/czasu dla \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetownership
|
||
msgid "Can not set owner/group for \"%s\""
|
||
msgstr "Nie można ustawić właściciela/grupy dla \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetpermissions
|
||
msgid "Can not set permissions for \"%s\""
|
||
msgstr "Nie można ustawić uprawnień dla \"%s\""
|
||
|
||
#: ulng.rsmsgerrsmallbuf
|
||
msgid "Buffer too small"
|
||
msgstr "Za mały bufor"
|
||
|
||
#: ulng.rsmsgerrtoomanyfiles
|
||
msgid "Too many files to pack"
|
||
msgstr "Zbyt wiele plików do spakowania"
|
||
|
||
#: ulng.rsmsgerrunknownformat
|
||
msgid "Archive format unknown"
|
||
msgstr "Nieznany format archiwum"
|
||
|
||
#: ulng.rsmsgfavoritetabsdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
||
msgstr "Czy na pewno chcesz usunąć wszystkie wpisy z Twoich Ulubionych Zakładek? (Nie jest możliwe \"cofnięcie\" operacji do tej akcji!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsdraghereentry
|
||
msgid "Drag here other entries"
|
||
msgstr "Przeciągnij tutaj inne wpisy"
|
||
|
||
#: ulng.rsmsgfavoritetabsentername
|
||
msgid "Enter a name this Favorite Tabs entry"
|
||
msgstr "Podaj nazwę dla tego wpisu Ulubionych Zakładek"
|
||
|
||
#: ulng.rsmsgfavoritetabsenternametitle
|
||
msgid "Saving a new Favorite Tabs entry"
|
||
msgstr "Zapisywanie nowych wpisów Ulubionych Zakładek"
|
||
|
||
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
||
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
||
msgstr "Liczba Ulubionych Zakładek wyeksportowanych pomyślnie: %d z %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsextramode
|
||
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
||
msgid "Number of file(s) imported successfully: %d on %d"
|
||
msgstr "Liczba plików zaimportowanych pomyślnie: %d z %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
||
msgid "Legacy tabs imported"
|
||
msgstr "Starsze zakładki zaimportowane"
|
||
|
||
#: ulng.rsmsgfavoritetabsimporttitle
|
||
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
||
msgstr "Wybierz plik(i) .tab do zaimportowania (może być więcej niż jeden!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
||
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabssimplemode
|
||
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "Zachowaj zapisaną historię katalogów w ulubionych zakładkach"
|
||
|
||
#: ulng.rsmsgfavoritetabssubmenuname
|
||
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Nazwa podmenu"
|
||
|
||
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
||
msgid "This will load the Favorite Tabs: \"%s\""
|
||
msgstr "Spowoduje to załadowanie Ulubionych Zakładek: \"%s\""
|
||
|
||
#: ulng.rsmsgfavortietabssaveoverexisting
|
||
msgid "Save current tabs over existing Favorite Tabs entry"
|
||
msgstr "Zapisz bieżące zakładki na istniejącym wpisie Ulubionych Zakładek"
|
||
|
||
#: ulng.rsmsgfilechangedsave
|
||
msgid "File %s changed, save?"
|
||
msgstr "Plik %s zmieniono, zapisać?"
|
||
|
||
#: ulng.rsmsgfileexistsfileinfo
|
||
msgid "%s bytes, %s"
|
||
msgstr "%s bajtów, %s"
|
||
|
||
#: ulng.rsmsgfileexistsoverwrite
|
||
msgid "Overwrite:"
|
||
msgstr "Nadpisz:"
|
||
|
||
#: ulng.rsmsgfileexistsrwrt
|
||
msgid "File %s exists, overwrite?"
|
||
msgstr "Plik o nazwie %s istnieje, zastąpić?"
|
||
|
||
#: ulng.rsmsgfileexistswithfile
|
||
msgid "With file:"
|
||
msgstr "Plikiem:"
|
||
|
||
#: ulng.rsmsgfilenotfound
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Plik \"%s\" nie został znaleziony."
|
||
|
||
#: ulng.rsmsgfileoperationsactive
|
||
msgid "File operations active"
|
||
msgstr "Aktywne operacje na plikach"
|
||
|
||
#: ulng.rsmsgfileoperationsactivelong
|
||
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
||
msgstr "Niektóre operacje na plikach nie zostały zakończone. Zamknięcie Double Commandera może spowodować utratę danych."
|
||
|
||
#: ulng.rsmsgfilepathovermaxpath
|
||
msgid ""
|
||
"The target name length (%d) is more than %d characters!\n"
|
||
"%s\n"
|
||
"Most programs will not be able to access a file/directory with such a long name!\n"
|
||
msgstr ""
|
||
"Długość nazwy docelowej (%d) jest większa niż %d znaków!\n"
|
||
"%s\n"
|
||
"Większość programów nie będzie mogła uzyskać dostępu do pliku/katalogu z długą nazwą!\n"
|
||
|
||
#: ulng.rsmsgfilereadonly
|
||
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
||
msgstr "Plik %s jest oznaczony jako tylko do odczytu/ukryty/systemowy. Usunąć mimo to?"
|
||
|
||
#: ulng.rsmsgfilesizetoobig
|
||
msgid "The file size of \"%s\" is too big for destination file system!"
|
||
msgstr "Rozmiar pliku \"%s\" jest zbyt duży dla docelowego systemu plików!"
|
||
|
||
#: ulng.rsmsgfolderexistsrwrt
|
||
#, fuzzy
|
||
#| msgid "Folder %s exists, overwrite?"
|
||
msgid "Folder %s exists, merge?"
|
||
msgstr "Katalog o nazwie %s istnieje, zastąpić?"
|
||
|
||
#: ulng.rsmsgfollowsymlink
|
||
msgid "Follow symlink \"%s\"?"
|
||
msgstr "Iść za linkiem \"%s\"?"
|
||
|
||
#: ulng.rsmsgfortextformattoimport
|
||
msgid "Select the text format to import"
|
||
msgstr "Wybierz format tekstu do zaimportowania"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectories
|
||
msgid "Add %d selected dirs"
|
||
msgstr "Dodaj %d wybranych katalogów"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectory
|
||
msgid "Add selected dir: "
|
||
msgstr "Dodaj wybrany katalog:"
|
||
|
||
#: ulng.rsmsghotdiraddthisdirectory
|
||
msgid "Add current dir: "
|
||
msgstr "Dodaj bieżący katalog:"
|
||
|
||
#: ulng.rsmsghotdircommandname
|
||
msgid "Do command"
|
||
msgstr "Wykonaj polecenie"
|
||
|
||
#: ulng.rsmsghotdircommandsample
|
||
msgid "cm_somthing"
|
||
msgstr "cm_somthing"
|
||
|
||
#: ulng.rsmsghotdirconfighotlist
|
||
msgctxt "ulng.rsmsghotdirconfighotlist"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Konfiguracja ulubionych katalogów"
|
||
|
||
#: ulng.rsmsghotdirdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
||
msgstr "Czy na pewno chcesz usunąć wszystkie wpisy z listy ulubionych katalogów? (Tej operacji nie można \"cofnąć\"!"
|
||
|
||
#: ulng.rsmsghotdirdemocommand
|
||
msgid "This will execute the following command:"
|
||
msgstr "Spowoduje to wykonanie następujacego polecenia:"
|
||
|
||
#: ulng.rsmsghotdirdemoname
|
||
msgid "This is hot dir named "
|
||
msgstr "To jest ulubiony folder o nazwie "
|
||
|
||
#: ulng.rsmsghotdirdemopath
|
||
msgid "This will change active frame to the following path:"
|
||
msgstr "Spowoduje to zmianę aktywnej ramki do następującej ścieżki"
|
||
|
||
#: ulng.rsmsghotdirdemotarget
|
||
msgid "And inactive frame would change to the following path:"
|
||
msgstr "I zmień nieaktywne ramki dla następującej ścieżki:"
|
||
|
||
#: ulng.rsmsghotdirerrorbackuping
|
||
msgid "Error backuping entries..."
|
||
msgstr "Błąd tworzenia kopii zapasowej wpisów..."
|
||
|
||
#: ulng.rsmsghotdirerrorexporting
|
||
msgid "Error exporting entries..."
|
||
msgstr "Błąd eksportowania wpisów..."
|
||
|
||
#: ulng.rsmsghotdirexportall
|
||
msgid "Export all!"
|
||
msgstr "Eksportuj wszystko!"
|
||
|
||
#: ulng.rsmsghotdirexporthotlist
|
||
msgid "Export Directory Hotlist - Select the entries you want to export"
|
||
msgstr "Eksportuj ulubione katalogi - wybierz pozycje które chcesz eksportować"
|
||
|
||
#: ulng.rsmsghotdirexportsel
|
||
msgid "Export selected"
|
||
msgstr "Eksportuj wybrane"
|
||
|
||
#: ulng.rsmsghotdirimportall
|
||
msgctxt "ulng.rsmsghotdirimportall"
|
||
msgid "Import all!"
|
||
msgstr "Importuj wszystko!"
|
||
|
||
#: ulng.rsmsghotdirimporthotlist
|
||
msgid "Import Directory Hotlist - Select the entries you want to import"
|
||
msgstr "Importuj ulubione katalogi - Wybierz pozycje, które chcesz importować"
|
||
|
||
#: ulng.rsmsghotdirimportsel
|
||
msgctxt "ulng.rsmsghotdirimportsel"
|
||
msgid "Import selected"
|
||
msgstr "Importuj wybrane"
|
||
|
||
#: ulng.rsmsghotdirjustpath
|
||
msgctxt "ulng.rsmsghotdirjustpath"
|
||
msgid "Path"
|
||
msgstr "Ścieżka"
|
||
|
||
#: ulng.rsmsghotdirlocatehotlistfile
|
||
msgid "Locate \".hotlist\" file to import"
|
||
msgstr "Znajdź plik \".hotlist\" do zaimportowania"
|
||
|
||
#: ulng.rsmsghotdirname
|
||
msgid "Hotdir name"
|
||
msgstr "Nazwa ulubionego katalogu"
|
||
|
||
#: ulng.rsmsghotdirnbnewentries
|
||
msgid "Number of new entries: %d"
|
||
msgstr "Liczba nowych wpisów: %d"
|
||
|
||
#: ulng.rsmsghotdirnothingtoexport
|
||
msgid "Nothing selected to export!"
|
||
msgstr "Nie wybrano nic do eksportu!"
|
||
|
||
#: ulng.rsmsghotdirpath
|
||
msgid "Hotdir path"
|
||
msgstr "Ścieżka ulubionego katalogu"
|
||
|
||
#: ulng.rsmsghotdirreaddselecteddirectory
|
||
msgid "Re-Add selected dir: "
|
||
msgstr "Dodaj ponownie wybrany katalog: "
|
||
|
||
#: ulng.rsmsghotdirreaddthisdirectory
|
||
msgid "Re-Add current dir: "
|
||
msgstr "Dodaj ponownie bieżący katalog: "
|
||
|
||
#: ulng.rsmsghotdirrestorewhat
|
||
msgid "Enter location and filename of Directory Hotlist to restore"
|
||
msgstr "Wprowadź lokalizację i nazwę pliku ulubionych katalogów do przywrócenia"
|
||
|
||
#: ulng.rsmsghotdirsimplecommand
|
||
msgctxt "ulng.rsmsghotdirsimplecommand"
|
||
msgid "Command:"
|
||
msgstr "Polecenie:"
|
||
|
||
#: ulng.rsmsghotdirsimpleendofmenu
|
||
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
||
msgid "(end of sub menu)"
|
||
msgstr "(koniec podmenu)"
|
||
|
||
#: ulng.rsmsghotdirsimplemenu
|
||
msgctxt "ulng.rsmsghotdirsimplemenu"
|
||
msgid "Menu name:"
|
||
msgstr "Nazwa menu:"
|
||
|
||
#: ulng.rsmsghotdirsimplename
|
||
msgctxt "ulng.rsmsghotdirsimplename"
|
||
msgid "Name:"
|
||
msgstr "Nazwa:"
|
||
|
||
#: ulng.rsmsghotdirsimpleseparator
|
||
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
||
msgid "(separator)"
|
||
msgstr "(separator)"
|
||
|
||
#: ulng.rsmsghotdirsubmenuname
|
||
msgctxt "ulng.rsmsghotdirsubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Nazwa podmenu"
|
||
|
||
#: ulng.rsmsghotdirtarget
|
||
msgid "Hotdir target"
|
||
msgstr "Docelowy ulubiony katalog"
|
||
|
||
#: ulng.rsmsghotdirtiporderpath
|
||
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Ustal jeśli chcesz, aby w aktywnej ramce były sortowane w określonej kolejności po zmianie katalogu"
|
||
|
||
#: ulng.rsmsghotdirtipordertarget
|
||
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Ustal jeśli chcesz, aby w nie aktywnej ramce były sortowane w określonej kolejności po zmianie katalogu"
|
||
|
||
#: ulng.rsmsghotdirtipspecialdirbut
|
||
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
||
msgstr "Różne funkcje, aby wybrać odpowiednią ścieżkę względną, bezwzględną, folderów specjalnych windows itd."
|
||
|
||
#: ulng.rsmsghotdirtotalbackuped
|
||
msgid ""
|
||
"Total entries saved: %d\n"
|
||
"\n"
|
||
"Backup filename: %s\n"
|
||
msgstr ""
|
||
"Liczba zapisanych wpisów: %d\n"
|
||
"\n"
|
||
"Nazwa pliku kopii zapasowej: %s\n"
|
||
|
||
#: ulng.rsmsghotdirtotalexported
|
||
msgid "Total entries exported: "
|
||
msgstr "Liczba wyeksportowanych wpisów: "
|
||
|
||
#: ulng.rsmsghotdirwhattodelete
|
||
msgid ""
|
||
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
||
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
||
msgstr ""
|
||
"Czy chcesz usunąć wszystkie elementy wewnątrz podmenu [%s]?\n"
|
||
"Odpowiedź NIE usunie tylko ograniczniki menu, ale pozostawi element wewnątrz podmenu.\n"
|
||
|
||
#: ulng.rsmsghotdirwheretosave
|
||
msgid "Enter location and filename where to save a Directory Hotlist file"
|
||
msgstr "Wprowadź lokalizację i nazwę pliku, w którym zapisać plik ulubionych katalogów"
|
||
|
||
#: ulng.rsmsgincorrectfilelength
|
||
msgid "Incorrect resulting filelength for file : \"%s\""
|
||
msgstr "Nieprawidłowa wynikowa długość pliku dla pliku : \"%s\"\""
|
||
|
||
#: ulng.rsmsginsertnextdisk
|
||
msgid ""
|
||
"Please insert next disk or something similar.\n"
|
||
"\n"
|
||
"It is to allow writing this file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Number of bytes still to write: %d\n"
|
||
msgstr ""
|
||
"Proszę włożyć następny dysk lub coś podobnego.\n"
|
||
"\n"
|
||
"Pozwoli to na zapisanie tego pliku:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Liczba bajtów pozostałych do zapisania: %d\n"
|
||
|
||
#: ulng.rsmsginvalidcommandline
|
||
msgid "Error in command line"
|
||
msgstr "Błąd w linii poleceń"
|
||
|
||
#: ulng.rsmsginvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Błędna nazwa pliku"
|
||
|
||
#: ulng.rsmsginvalidformatofconfigurationfile
|
||
msgid "Invalid format of configuration file"
|
||
msgstr "Nieprawidłowy format pliku konfiguracyjnego"
|
||
|
||
#: ulng.rsmsginvalidpath
|
||
msgid "Invalid path"
|
||
msgstr "Zła ścieżka"
|
||
|
||
#: ulng.rsmsginvalidpathlong
|
||
msgid "Path %s contains forbidden characters."
|
||
msgstr "Ścieżka %s zawiera niedozwolone znaki."
|
||
|
||
#: ulng.rsmsginvalidplugin
|
||
msgid "This is not a valid plugin!"
|
||
msgstr "To nie jest prawidłowa wtyczka!"
|
||
|
||
#: ulng.rsmsginvalidpluginarchitecture
|
||
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
||
msgstr "Ta wtyczka jest zbudowana dla Double Commander %s.%sNie będzie działać z Double Commander %s!"
|
||
|
||
#: ulng.rsmsginvalidquoting
|
||
msgid "Invalid quoting"
|
||
msgstr "Błędne cytowanie"
|
||
|
||
#: ulng.rsmsginvalidselection
|
||
msgid "Invalid selection."
|
||
msgstr "Błędny wybór."
|
||
|
||
#: ulng.rsmsgloadingfilelist
|
||
msgid "Loading file list..."
|
||
msgstr "Wczytywanie listy plików..."
|
||
|
||
#: ulng.rsmsglocatetcconfiguation
|
||
msgid "Locate TC configuration file (wincmd.ini)"
|
||
msgstr "Zlokalizuj plik konfiguracyjny TC (wincmd.ini)"
|
||
|
||
#: ulng.rsmsglocatetcexecutable
|
||
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
||
msgstr "Zlokalizuj plik wykonywalny TC (totalcmd.exe lub totalcmd64.exe)"
|
||
|
||
#: ulng.rsmsglogcopy
|
||
msgid "Copy file %s"
|
||
msgstr "Kopiowanie pliku %s"
|
||
|
||
#: ulng.rsmsglogdelete
|
||
msgid "Delete file %s"
|
||
msgstr "Kasowanie pliku %s"
|
||
|
||
#: ulng.rsmsglogerror
|
||
msgid "Error: "
|
||
msgstr "Błąd: "
|
||
|
||
#: ulng.rsmsglogextcmdlaunch
|
||
msgid "Launch external"
|
||
msgstr "Uruchom zewnętrzny"
|
||
|
||
#: ulng.rsmsglogextcmdresult
|
||
msgid "Result external"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsglogextract
|
||
msgid "Extract file %s"
|
||
msgstr "Rozpakowywanie pliku %s"
|
||
|
||
#: ulng.rsmsgloginfo
|
||
msgid "Info: "
|
||
msgstr "Informacja: "
|
||
|
||
#: ulng.rsmsgloglink
|
||
msgid "Create link %s"
|
||
msgstr "Tworzenie twardego linku %s"
|
||
|
||
#: ulng.rsmsglogmkdir
|
||
msgid "Create directory %s"
|
||
msgstr "Tworzenie katalogu %s"
|
||
|
||
#: ulng.rsmsglogmove
|
||
msgid "Move file %s"
|
||
msgstr "Przenoszenie pliku %s"
|
||
|
||
#: ulng.rsmsglogpack
|
||
msgid "Pack to file %s"
|
||
msgstr "Archiwizowanie do pliku %s"
|
||
|
||
#: ulng.rsmsglogrmdir
|
||
msgid "Remove directory %s"
|
||
msgstr "Usunięcie katalogu %s"
|
||
|
||
#: ulng.rsmsglogsuccess
|
||
msgid "Done: "
|
||
msgstr "Wykonano: "
|
||
|
||
#: ulng.rsmsglogsymlink
|
||
msgid "Create symlink %s"
|
||
msgstr "Tworzenie linku symbolicznego %s"
|
||
|
||
#: ulng.rsmsglogtest
|
||
msgid "Test file integrity %s"
|
||
msgstr "Testowanie integralności pliku %s"
|
||
|
||
#: ulng.rsmsglogwipe
|
||
msgid "Wipe file %s"
|
||
msgstr "Zatrzyj plik %s"
|
||
|
||
#: ulng.rsmsglogwipedir
|
||
msgid "Wipe directory %s"
|
||
msgstr "Zatrzyj katalog %s"
|
||
|
||
#: ulng.rsmsgmasterpassword
|
||
msgid "Master Password"
|
||
msgstr "Hasło główne"
|
||
|
||
#: ulng.rsmsgmasterpasswordenter
|
||
msgid "Please enter the master password:"
|
||
msgstr "Proszę wprowadzić hasło główne:"
|
||
|
||
#: ulng.rsmsgnewfile
|
||
msgid "New file"
|
||
msgstr "Nowy plik"
|
||
|
||
#: ulng.rsmsgnextvolunpack
|
||
msgid "Next volume will be unpacked"
|
||
msgstr "Kolejny wolumin zostanie rozpakowany"
|
||
|
||
#: ulng.rsmsgnofiles
|
||
msgid "No files"
|
||
msgstr "Brak plików"
|
||
|
||
#: ulng.rsmsgnofilesselected
|
||
msgid "No files selected."
|
||
msgstr "Brak wybranych plików."
|
||
|
||
#: ulng.rsmsgnofreespacecont
|
||
msgid "No enough free space on target drive, Continue?"
|
||
msgstr "Brak miejsca na dysku. Kontynuować?"
|
||
|
||
#: ulng.rsmsgnofreespaceretry
|
||
msgid "No enough free space on target drive, Retry?"
|
||
msgstr "Brak miejsca na dysku. Ponowić próbę?"
|
||
|
||
#: ulng.rsmsgnotdelete
|
||
msgid "Can not delete file %s"
|
||
msgstr "Pliku %s nie można skasować"
|
||
|
||
#: ulng.rsmsgnotimplemented
|
||
msgid "Not implemented."
|
||
msgstr "Nie zaimplementowano."
|
||
|
||
#: ulng.rsmsgpanelpreview
|
||
msgctxt "ulng.rsmsgpanelpreview"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Poniżej znajduje się podgląd. Można przesuwać kursor i wybierać pliki, aby natychmiast uzyskać rzeczywisty wygląd różnych ustawień."
|
||
|
||
#: ulng.rsmsgpassword
|
||
msgid "Password:"
|
||
msgstr "Hasło:"
|
||
|
||
#: ulng.rsmsgpassworddiff
|
||
msgid "Passwords are different!"
|
||
msgstr "Hasła są różne!"
|
||
|
||
#: ulng.rsmsgpasswordenter
|
||
msgid "Please enter the password:"
|
||
msgstr "Proszę wprowadzić hasło:"
|
||
|
||
#: ulng.rsmsgpasswordfirewall
|
||
msgid "Password (Firewall):"
|
||
msgstr "Hasło (Firewall):"
|
||
|
||
#: ulng.rsmsgpasswordverify
|
||
msgid "Please re-enter the password for verification:"
|
||
msgstr "Proszę ponownie wprowadzić hasło dla weryfikacji:"
|
||
|
||
#: ulng.rsmsgpopuphotdelete
|
||
msgid "&Delete %s"
|
||
msgstr "&Usuń %s"
|
||
|
||
#: ulng.rsmsgpresetalreadyexists
|
||
msgid "Preset \"%s\" already exists. Overwrite?"
|
||
msgstr "Wzorzec \"%s\" istnieje. Zastąpić?"
|
||
|
||
#: ulng.rsmsgproblemexecutingcommand
|
||
msgid "Problem executing command (%s)"
|
||
msgstr "Problem z wykonaniem polecenia (%s)"
|
||
|
||
#: ulng.rsmsgpromptaskingfilename
|
||
msgid "Filename for dropped text:"
|
||
msgstr "Nazwa pliku dla przeciągniętego tekstu:"
|
||
|
||
#: ulng.rsmsgprovidethisfile
|
||
msgid "Please, make this file available. Retry?"
|
||
msgstr "Proszę udostępnić ten plik. Ponowić próbę?"
|
||
|
||
#: ulng.rsmsgrenamefavtabs
|
||
msgid "Enter new friendly name for this Favorite Tabs"
|
||
msgstr "Podaj nową przyjazną nazwę dla tych Ulubionych Zakładek"
|
||
|
||
#: ulng.rsmsgrenamefavtabsmenu
|
||
msgid "Enter new name for this menu"
|
||
msgstr "Podaj nową nazwę dla tego menu"
|
||
|
||
#: ulng.rsmsgrenfldr
|
||
msgid "Rename/move %d selected files/directories?"
|
||
msgstr "Zmienić nazwę/przenieść %d wybranych plików/katalogów?"
|
||
|
||
#: ulng.rsmsgrensel
|
||
msgid "Rename/move selected \"%s\"?"
|
||
msgstr "Zmienić nazwę/przenieść wybrany \"%s\"?"
|
||
|
||
#: ulng.rsmsgrestartforapplychanges
|
||
msgid "Please, restart Double Commander in order to apply changes"
|
||
msgstr "Proszę ponownie uruchomić Double Commander aby zastosować zmiany"
|
||
|
||
#: ulng.rsmsgsekectfiletype
|
||
msgid "Select to which file type to add extension \"%s\""
|
||
msgstr "Wybierz, aby dodać rozszerzenie typu pliku \"%s\""
|
||
|
||
#: ulng.rsmsgselectedinfo
|
||
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
||
msgstr "Wybrane: %s z %s, plików: %d z %d, katalogów: %d z %d"
|
||
|
||
#: ulng.rsmsgselectexecutablefile
|
||
msgid "Select executable file for"
|
||
msgstr "Wybierz plik wykonywalny dla"
|
||
|
||
#: ulng.rsmsgselectonlychecksumfiles
|
||
msgid "Please select only checksum files!"
|
||
msgstr "Proszę wybrać tylko sumy kontrolne plików!"
|
||
|
||
#: ulng.rsmsgsellocnextvol
|
||
msgid "Please select location of next volume"
|
||
msgstr "Wybierz lokalizację kolejnego woluminu"
|
||
|
||
#: ulng.rsmsgsetvolumelabel
|
||
msgid "Set volume label"
|
||
msgstr "Zmień etykietę wolumniu"
|
||
|
||
#: ulng.rsmsgspecialdir
|
||
msgid "Special Dirs"
|
||
msgstr "Specjalny katalog"
|
||
|
||
#: ulng.rsmsgspecialdiraddacti
|
||
msgid "Add path from active frame"
|
||
msgstr "Dodaj ścieżkę z aktywnej ramki"
|
||
|
||
#: ulng.rsmsgspecialdiraddnonacti
|
||
msgid "Add path from inactive frame"
|
||
msgstr "Dodaj ścieżkę z nieaktywnej ramki"
|
||
|
||
#: ulng.rsmsgspecialdirbrowssel
|
||
msgid "Browse and use selected path"
|
||
msgstr "Przeglądaj i użyj wybranej ścieżki"
|
||
|
||
#: ulng.rsmsgspecialdirenvvar
|
||
msgid "Use environment variable..."
|
||
msgstr "Użyj zmiennej środowiskowej..."
|
||
|
||
#: ulng.rsmsgspecialdirgotodc
|
||
msgid "Go to Double Commander special path..."
|
||
msgstr "Idź do specjalnej ścieżki Double Commandera..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoenvvar
|
||
msgid "Go to environment variable..."
|
||
msgstr "Idź do zmiennej środowiskowej ..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoother
|
||
msgid "Go to other Windows special folder..."
|
||
msgstr "Idź do innego specjalnego folderu Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirgototc
|
||
msgid "Go to Windows special folder (TC)..."
|
||
msgstr "Idź do specjalnego folderu Windows (TC)..."
|
||
|
||
#: ulng.rsmsgspecialdirmakereltohotdir
|
||
msgid "Make relative to hotdir path"
|
||
msgstr "Utwórz względną do ścieżki ulubionego katalogu"
|
||
|
||
#: ulng.rsmsgspecialdirmkabso
|
||
msgid "Make path absolute"
|
||
msgstr "Utwórz ścieżkę bezwzględną"
|
||
|
||
#: ulng.rsmsgspecialdirmkdcrel
|
||
msgid "Make relative to Double Commander special path..."
|
||
msgstr "Utwórz względną do specjalnej ścieżki Double Commandera..."
|
||
|
||
#: ulng.rsmsgspecialdirmkenvrel
|
||
msgid "Make relative to environment variable..."
|
||
msgstr "Utwórz względną do zmiennej środowiskowej..."
|
||
|
||
#: ulng.rsmsgspecialdirmktctel
|
||
msgid "Make relative to Windows special folder (TC)..."
|
||
msgstr "Utwórz względną do specjalnego folderu Windows (TC)..."
|
||
|
||
#: ulng.rsmsgspecialdirmkwnrel
|
||
msgid "Make relative to other Windows special folder..."
|
||
msgstr "Utwórz względną do innego folderu specjalnego Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusedc
|
||
msgid "Use Double Commander special path..."
|
||
msgstr "Użyj specjalnej scieżki Double Commander..."
|
||
|
||
#: ulng.rsmsgspecialdirusehotdir
|
||
msgid "Use hotdir path"
|
||
msgstr "Użyj scieżki ulubionego katalogu"
|
||
|
||
#: ulng.rsmsgspecialdiruseother
|
||
msgid "Use other Windows special folder..."
|
||
msgstr "Użyj innego specjalnego folderu Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusetc
|
||
msgid "Use Windows special folder (TC)..."
|
||
msgstr "Użyj specjalnego folderu Windows (TC)..."
|
||
|
||
#: ulng.rsmsgtabforopeninginnewtab
|
||
msgid "This tab (%s) is locked! Open directory in another tab?"
|
||
msgstr "Ta zakładka (5s) jest zablokowana! Otworzyć katalog w innej zakładce?"
|
||
|
||
#: ulng.rsmsgtabrenamecaption
|
||
msgid "Rename tab"
|
||
msgstr "Zmień nazwę zakładki"
|
||
|
||
#: ulng.rsmsgtabrenameprompt
|
||
msgid "New tab name:"
|
||
msgstr "Nazwa nowej zakładki:"
|
||
|
||
#: ulng.rsmsgtargetdir
|
||
msgid "Target path:"
|
||
msgstr "Ścieżka docelowa:"
|
||
|
||
#: ulng.rsmsgtcconfignotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration file:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Błąd! Nie można znależć pliku konfiguracji TC:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcexecutablenotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration executable:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Błąd! Nie można znaleźć konfiguracji pliku wykonywalnego TC:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcisrunning
|
||
msgid ""
|
||
"Error! TC is still running but it should be closed for this operation.\n"
|
||
"Close it and press OK or press CANCEL to abort.\n"
|
||
msgstr ""
|
||
"Błąd! TC jest nadal uruchomiony, a powinien być zamknięty dla tej operacji.\n"
|
||
"Zamknij go i naciśnij przycisk OK lub naciśnij przycisk ANULUJ, aby przerwać.\n"
|
||
|
||
#: ulng.rsmsgtctoolbarnotfound
|
||
msgid ""
|
||
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Błąd! Nie można znaleźć żądanego folderu wyjściowego paska narzędzi TC:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a TC Toolbar file"
|
||
msgstr "Wprowadź lokalizację i nazwę pliku, w którym chcesz zapisać plik paska narzędzi TC"
|
||
|
||
#: ulng.rsmsgthisisnowinclipboard
|
||
msgid "\"%s\" is now in the clipboard"
|
||
msgstr "\"%s\" jest teraz w schowku"
|
||
|
||
#: ulng.rsmsgtitleextnotinfiletype
|
||
msgid "Extension of selected file is not in any recognized file types"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
||
msgid "Locate \".toolbar\" file to import"
|
||
msgstr "Zlokalizuj plik \".toolbar\" do zaimportowania"
|
||
|
||
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
||
msgid "Locate \".BAR\" file to import"
|
||
msgstr "Zlokalizuj plik \".BAR\" do zaimportowania"
|
||
|
||
#: ulng.rsmsgtoolbarrestorewhat
|
||
msgid "Enter location and filename of Toolbar to restore"
|
||
msgstr "Wprowadź położenie i nazwę paska narzędzi do przywrócenia"
|
||
|
||
#: ulng.rsmsgtoolbarsaved
|
||
msgid ""
|
||
"Saved!\n"
|
||
"Toolbar filename: %s\n"
|
||
msgstr ""
|
||
"Zapisano!\n"
|
||
"Nazwa paska narzędzi: %s\n"
|
||
|
||
#: ulng.rsmsgtoomanyfilesselected
|
||
msgid "Too many files selected."
|
||
msgstr "Wybrano zbyt dużo plików"
|
||
|
||
#: ulng.rsmsgundeterminednumberoffile
|
||
msgid "Undetermined"
|
||
msgstr "Nieokreślony"
|
||
|
||
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
||
msgid "ERROR: Unexpected Tree View Menu usage!"
|
||
msgstr "BŁĄD: Nieoczekiwane użycie Widoku Drzewa"
|
||
|
||
#: ulng.rsmsgurl
|
||
msgid "URL:"
|
||
msgstr "URL:"
|
||
|
||
#: ulng.rsmsguserdidnotsetextension
|
||
msgid "<NO EXT>"
|
||
msgstr "<BRAK ROZSZ.>"
|
||
|
||
#: ulng.rsmsguserdidnotsetname
|
||
msgid "<NO NAME>"
|
||
msgstr "<BRAK NAZWY>"
|
||
|
||
#: ulng.rsmsgusername
|
||
msgid "User name:"
|
||
msgstr "Nazwa użytkownika:"
|
||
|
||
#: ulng.rsmsgusernamefirewall
|
||
msgid "User name (Firewall):"
|
||
msgstr "Nazwa użytkownika (Firewall):"
|
||
|
||
#: ulng.rsmsgvolumelabel
|
||
msgid "Volume label:"
|
||
msgstr "Etykieta woluminu:"
|
||
|
||
#: ulng.rsmsgvolumesizeenter
|
||
msgid "Please enter the volume size:"
|
||
msgstr "Proszę wpisać rozmiar części:"
|
||
|
||
#: ulng.rsmsgwipefldr
|
||
msgid "Wipe %d selected files/directories?"
|
||
msgstr "Zamazać %d wybranych plików/katalogów?"
|
||
|
||
#: ulng.rsmsgwipesel
|
||
msgid "Wipe selected \"%s\"?"
|
||
msgstr "Zamazać \"%s\"?"
|
||
|
||
#: ulng.rsmsgwithactionwith
|
||
msgid "with"
|
||
msgstr "z"
|
||
|
||
#: ulng.rsmulrenfilenamestylelist
|
||
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
||
msgstr "Bez zmian;WIELKIMI ZNAKAMI;małymi znakami;Pierwsza wielka;Pierwszy Znak Każdego Słowa Wielki;"
|
||
|
||
#: ulng.rsmulrenwronglinesnumber
|
||
msgid "File contains wrong number of lines: %d, should be %d!"
|
||
msgstr "Plik zawiera błędną liczbę wierszy: %d, powinno być %d!"
|
||
|
||
#: ulng.rsnewsearchclearfilteroptions
|
||
msgid "Keep;Clear;Prompt"
|
||
msgstr "Zachowaj;Wyczyść;Pytaj"
|
||
|
||
#: ulng.rsnoequivalentinternalcommand
|
||
msgid "No internal equivalent command"
|
||
msgstr "Brak równoważnego wewnętrznego polecenia"
|
||
|
||
#: ulng.rsnofindfileswindowyet
|
||
msgid "Sorry, no \"Find files\" window yet..."
|
||
msgstr "Przepraszamy, brak okna \"Znajdź pliki\"..."
|
||
|
||
#: ulng.rsnootherfindfileswindowtoclose
|
||
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
||
msgstr "Przepraszamy, brak innych okien \"Znajdź pliki\" do zamknięcia i zwolnienia pamięci"
|
||
|
||
#: ulng.rsoperaborted
|
||
msgid "Aborted"
|
||
msgstr "Przerwane"
|
||
|
||
#: ulng.rsopercalculatingchecksum
|
||
msgid "Calculating checksum"
|
||
msgstr "Obliczanie sumy kontrolnej"
|
||
|
||
#: ulng.rsopercalculatingchecksumin
|
||
msgid "Calculating checksum in \"%s\""
|
||
msgstr "Obliczanie sumy kontrolnej dla \"%s\""
|
||
|
||
#: ulng.rsopercalculatingchecksumof
|
||
msgid "Calculating checksum of \"%s\""
|
||
msgstr "Obliczanie sumy kontrolnej z \"%s\""
|
||
|
||
#: ulng.rsopercalculatingstatictics
|
||
msgid "Calculating"
|
||
msgstr "Obliczanie"
|
||
|
||
#: ulng.rsopercalculatingstatisticsin
|
||
msgid "Calculating \"%s\""
|
||
msgstr "Obliczanie \"%s|\""
|
||
|
||
#: ulng.rsopercombining
|
||
msgid "Joining"
|
||
msgstr "Łączenie\""
|
||
|
||
#: ulng.rsopercombiningfromto
|
||
msgid "Joining files in \"%s\" to \"%s\""
|
||
msgstr "Łączenie plików w \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsopercopying
|
||
msgid "Copying"
|
||
msgstr "Kopiowanie"
|
||
|
||
#: ulng.rsopercopyingfromto
|
||
msgid "Copying from \"%s\" to \"%s\""
|
||
msgstr "Kopiowanie z \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsopercopyingsomethingto
|
||
msgid "Copying \"%s\" to \"%s\""
|
||
msgstr "Kopiowanie \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsopercreatingdirectory
|
||
msgid "Creating directory"
|
||
msgstr "Tworzenie katalogu"
|
||
|
||
#: ulng.rsopercreatingsomedirectory
|
||
msgid "Creating directory \"%s\""
|
||
msgstr "Tworzenie katalogu \"%s\""
|
||
|
||
#: ulng.rsoperdeleting
|
||
msgid "Deleting"
|
||
msgstr "Usuwanie"
|
||
|
||
#: ulng.rsoperdeletingin
|
||
msgid "Deleting in \"%s\""
|
||
msgstr "Usuwanie w \"%s|\""
|
||
|
||
#: ulng.rsoperdeletingsomething
|
||
msgid "Deleting \"%s\""
|
||
msgstr "Usuwanie \"%s\""
|
||
|
||
#: ulng.rsoperexecuting
|
||
msgid "Executing"
|
||
msgstr "Wykonywanie"
|
||
|
||
#: ulng.rsoperexecutingsomething
|
||
msgid "Executing \"%s\""
|
||
msgstr "Wykonywanie \"%s\""
|
||
|
||
#: ulng.rsoperextracting
|
||
msgid "Extracting"
|
||
msgstr "Wyodrębnianie"
|
||
|
||
#: ulng.rsoperextractingfromto
|
||
msgid "Extracting from \"%s\" to \"%s\""
|
||
msgstr "Wyodrębnianie z \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsoperfinished
|
||
msgid "Finished"
|
||
msgstr "Zakończony"
|
||
|
||
#: ulng.rsoperlisting
|
||
msgid "Listing"
|
||
msgstr "Lista"
|
||
|
||
#: ulng.rsoperlistingin
|
||
msgid "Listing \"%s\""
|
||
msgstr "Lista \"%s\""
|
||
|
||
#: ulng.rsopermoving
|
||
msgid "Moving"
|
||
msgstr "Przenoszenie"
|
||
|
||
#: ulng.rsopermovingfromto
|
||
msgid "Moving from \"%s\" to \"%s\""
|
||
msgstr "Przenoszenie z \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsopermovingsomethingto
|
||
msgid "Moving \"%s\" to \"%s\""
|
||
msgstr "Przenoszenie \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsopernotstarted
|
||
msgid "Not started"
|
||
msgstr "Nie uruchomiony"
|
||
|
||
#: ulng.rsoperpacking
|
||
msgid "Packing"
|
||
msgstr "Pakowanie"
|
||
|
||
#: ulng.rsoperpackingfromto
|
||
msgid "Packing from \"%s\" to \"%s\""
|
||
msgstr "Pakowanie z \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsoperpackingsomethingto
|
||
msgid "Packing \"%s\" to \"%s\""
|
||
msgstr "Pakowanie \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsoperpaused
|
||
msgid "Paused"
|
||
msgstr "Pauza"
|
||
|
||
#: ulng.rsoperpausing
|
||
msgid "Pausing"
|
||
msgstr "Wstrzymywanie"
|
||
|
||
#: ulng.rsoperrunning
|
||
msgid "Running"
|
||
msgstr "Działające"
|
||
|
||
#: ulng.rsopersettingproperty
|
||
msgid "Setting property"
|
||
msgstr "Ustawianie właściwości"
|
||
|
||
#: ulng.rsopersettingpropertyin
|
||
msgid "Setting property in \"%s\""
|
||
msgstr "Ustawianie właściwości w \"%s\""
|
||
|
||
#: ulng.rsopersettingpropertyof
|
||
msgid "Setting property of \"%s\""
|
||
msgstr "Ustawianie właściwości \"%s\""
|
||
|
||
#: ulng.rsopersplitting
|
||
msgid "Splitting"
|
||
msgstr "Dzielenie"
|
||
|
||
#: ulng.rsopersplittingfromto
|
||
msgid "Splitting \"%s\" to \"%s\""
|
||
msgstr "Dzielenie \"%s\" do \"%s\""
|
||
|
||
#: ulng.rsoperstarting
|
||
msgid "Starting"
|
||
msgstr "Uruchamianie"
|
||
|
||
#: ulng.rsoperstopped
|
||
msgid "Stopped"
|
||
msgstr "Zatrzymane"
|
||
|
||
#: ulng.rsoperstopping
|
||
msgid "Stopping"
|
||
msgstr "Zatrzymywanie"
|
||
|
||
#: ulng.rsopertesting
|
||
msgid "Testing"
|
||
msgstr "Testowanie"
|
||
|
||
#: ulng.rsopertestingin
|
||
msgid "Testing in \"%s\""
|
||
msgstr "Testowanie w \"%s\""
|
||
|
||
#: ulng.rsopertestingsomething
|
||
msgid "Testing \"%s\""
|
||
msgstr "Testowanie \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksum
|
||
msgid "Verifying checksum"
|
||
msgstr "Sprawdzanie sumy kontrolnej"
|
||
|
||
#: ulng.rsoperverifyingchecksumin
|
||
msgid "Verifying checksum in \"%s\""
|
||
msgstr "Sprawdzanie sumy kontrolnej w \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksumof
|
||
msgid "Verifying checksum of \"%s\""
|
||
msgstr "Sprawdzanie sumy kontrolnej z \"%s\""
|
||
|
||
#: ulng.rsoperwaitingforconnection
|
||
msgid "Waiting for access to file source"
|
||
msgstr "Oczekiwanie na dostęp do źródła pliku"
|
||
|
||
#: ulng.rsoperwaitingforfeedback
|
||
msgid "Waiting for user response"
|
||
msgstr "Oczekiwanie na odpowiedź użytkownika"
|
||
|
||
#: ulng.rsoperwiping
|
||
msgid "Wiping"
|
||
msgstr "Wycieranie"
|
||
|
||
#: ulng.rsoperwipingin
|
||
msgid "Wiping in \"%s\""
|
||
msgstr "Wycieranie w \"%s\""
|
||
|
||
#: ulng.rsoperwipingsomething
|
||
msgid "Wiping \"%s\""
|
||
msgstr "Wycieranie \"%s\""
|
||
|
||
#: ulng.rsoperworking
|
||
msgid "Working"
|
||
msgstr "Działanie"
|
||
|
||
#: ulng.rsoptaddfrommainpanel
|
||
msgid "Add at beginning;Add at the end;Smart add"
|
||
msgstr "Dodaj na początku;Dodaj na końcu;Po prostu dodaj"
|
||
|
||
#: ulng.rsoptarchivedelete
|
||
msgid "Delete:"
|
||
msgstr "Usuń:"
|
||
|
||
#: ulng.rsoptarchiveextractwithoutpath
|
||
msgid "Extract without path:"
|
||
msgstr "Rozpakuj bez ścieżki:"
|
||
|
||
#: ulng.rsoptarchiveformmode
|
||
msgid "Format parsing mode:"
|
||
msgstr "Tryb parsowania formatu:"
|
||
|
||
#: ulng.rsoptarchiveid
|
||
msgid "ID:"
|
||
msgstr "ID:"
|
||
|
||
#: ulng.rsoptarchiveidpos
|
||
msgid "ID Position:"
|
||
msgstr "ID pozycji:"
|
||
|
||
#: ulng.rsoptarchiveidseekrange
|
||
msgid "ID Seek Range:"
|
||
msgstr "Zakres wyszukiwania ID:"
|
||
|
||
#: ulng.rsoptarchiveparam
|
||
msgid "Parameter"
|
||
msgstr "Parametr"
|
||
|
||
#: ulng.rsoptarchivepasswordquery
|
||
msgid "Password query string:"
|
||
msgstr "Ciąg zapytania hasła:"
|
||
|
||
#: ulng.rsoptarchiveselfextract
|
||
msgid "Create self extracting archive:"
|
||
msgstr "Utwórz archiwum samorozpakowujące:"
|
||
|
||
#: ulng.rsoptarchivetest
|
||
msgid "Test:"
|
||
msgstr "Test:"
|
||
|
||
#: ulng.rsoptarchivetypename
|
||
msgid "Archive type name:"
|
||
msgstr "Nazwa rodzaju archiwum:"
|
||
|
||
#: ulng.rsoptarchivevalue
|
||
msgctxt "ulng.rsoptarchivevalue"
|
||
msgid "Value"
|
||
msgstr "Wartość"
|
||
|
||
#: ulng.rsoptassocpluginwith
|
||
msgid "Associate plugin \"%s\" with:"
|
||
msgstr "Skojarz wtyczkę \"%s\" z:"
|
||
|
||
#: ulng.rsoptautosizecolumn
|
||
msgid "First;Last;"
|
||
msgstr "Pierwszy;Ostatni;"
|
||
|
||
#: ulng.rsoptconfigsortorder
|
||
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
||
msgstr "Klasyczny, starszy porządek;Kolejność alfabetyczna (ale wciąż pierwszy język)"
|
||
|
||
#: ulng.rsoptdifferframeposition
|
||
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
||
msgstr "Ramka aktywnego panelu po lewej, nieaktywnego po prawej (starsze);Lewa ramka panelu po lewej, prawa po prawej"
|
||
|
||
#: ulng.rsoptdisable
|
||
msgid "Disable"
|
||
msgstr "Wyłącz"
|
||
|
||
#: ulng.rsoptenable
|
||
msgid "Enable"
|
||
msgstr "Włącz"
|
||
|
||
#: ulng.rsoptenterext
|
||
msgid "Enter extension"
|
||
msgstr "Wpisz rozszerzenie"
|
||
|
||
#: ulng.rsoptfavoritetabswheretoaddinlist
|
||
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
||
msgstr "Dodaj na początku;Dodaj na końcu;Alfabetyczne sortowanie"
|
||
|
||
#: ulng.rsoptfileoperationsprogresskind
|
||
msgid "separate window;minimized separate window;operations panel"
|
||
msgstr "oddzielnym oknie;zminimalizowanym oddzielnym oknie;panelu operacji"
|
||
|
||
#: ulng.rsoptfilesizeformat
|
||
msgid "float;B;K;M;G"
|
||
msgstr "dynamiczny;bajty;kbajty;Mbajty;Gbajty"
|
||
|
||
#: ulng.rsopthotkeysadddeleteshortcutlong
|
||
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
||
msgstr "Skrót %s do cm_Delete zostanie dodany, a więc może zostać używany do odwracania tego ustawienia."
|
||
|
||
#: ulng.rsopthotkeysaddhotkey
|
||
msgid "Add hotkey for %s"
|
||
msgstr "Dodaj klawisz skrótu dla %s"
|
||
|
||
#: ulng.rsopthotkeysaddshortcutbutton
|
||
msgid "Add shortcut"
|
||
msgstr "Dodaj skrót"
|
||
|
||
#: ulng.rsopthotkeyscannotsetshortcut
|
||
msgid "Cannot set shortcut"
|
||
msgstr "Nie można ustawić skrótu"
|
||
|
||
#: ulng.rsopthotkeyschangeshortcut
|
||
msgid "Change shortcut"
|
||
msgstr "Zmień skrót"
|
||
|
||
#: ulng.rsopthotkeyscommand
|
||
msgctxt "ulng.rsopthotkeyscommand"
|
||
msgid "Command"
|
||
msgstr "Polecenia"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
||
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
||
msgstr "Skrót %s do cm_Delete ma parametr, który zastępuje to ustawienie. Czy chcesz zmienić ten parametr, aby używać ustawienia globalnego?"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
||
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
||
msgstr "Skrót %s do cm_Delete musi mieć parametr zmieniajacy trafność skrótu % s. Czy chcesz zmienić?"
|
||
|
||
#: ulng.rsopthotkeysdescription
|
||
msgctxt "ulng.rsopthotkeysdescription"
|
||
msgid "Description"
|
||
msgstr "Opis"
|
||
|
||
#: ulng.rsopthotkeysedithotkey
|
||
msgid "Edit hotkey for %s"
|
||
msgstr "Edytuj skrót klawiszowy do %s"
|
||
|
||
#: ulng.rsopthotkeysfixparameter
|
||
msgid "Fix parameter"
|
||
msgstr "Popraw parametr"
|
||
|
||
#: ulng.rsopthotkeyshotkey
|
||
msgctxt "ulng.rsopthotkeyshotkey"
|
||
msgid "Hotkey"
|
||
msgstr "Skrót"
|
||
|
||
#: ulng.rsopthotkeyshotkeys
|
||
msgctxt "ulng.rsopthotkeyshotkeys"
|
||
msgid "Hotkeys"
|
||
msgstr "Skróty"
|
||
|
||
#: ulng.rsopthotkeysnohotkey
|
||
msgid "<none>"
|
||
msgstr "<brak>"
|
||
|
||
#: ulng.rsopthotkeysparameters
|
||
msgctxt "ulng.rsopthotkeysparameters"
|
||
msgid "Parameters"
|
||
msgstr "Parametry"
|
||
|
||
#: ulng.rsopthotkeyssetdeleteshortcut
|
||
msgid "Set shortcut to delete file"
|
||
msgstr "Ustaw skrót do usunięcia pliku"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
||
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
||
msgstr "Dla tego ustawienia do pracy ze skrótem %s, skrót %s musi być przypisany do cm_Delete ale jest już przypisany do %s. Czy chcesz to zmienić?"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
||
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
||
msgstr "Skrót %s dla cm_Delete to skrót sekwencji, dla którego nie można przypisać skrót klawiszowy z odwróconym Shift. To ustawienie może nie działać."
|
||
|
||
#: ulng.rsopthotkeysshortcutused
|
||
msgid "Shortcut in use"
|
||
msgstr "Skrót jest używany"
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext1
|
||
msgid "Shortcut %s is already used."
|
||
msgstr "Skrót %s jest już używany."
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext2
|
||
msgid "Change it to %s?"
|
||
msgstr "Zmienić na %s?"
|
||
|
||
#: ulng.rsopthotkeysusedby
|
||
msgid "used for %s in %s"
|
||
msgstr "używany przez %s w %s"
|
||
|
||
#: ulng.rsopthotkeysusedwithdifferentparams
|
||
msgid "used for this command but with different parameters"
|
||
msgstr "używany dla tego polecenia ale z różnymi parametrami"
|
||
|
||
#: ulng.rsoptionseditorarchivers
|
||
msgid "Archivers"
|
||
msgstr "Archiwizatory"
|
||
|
||
#: ulng.rsoptionseditorautorefresh
|
||
msgid "Auto refresh"
|
||
msgstr "Automatyczne odświeżanie"
|
||
|
||
#: ulng.rsoptionseditorbehavior
|
||
msgid "Behaviors"
|
||
msgstr "Zachowanie"
|
||
|
||
#: ulng.rsoptionseditorbriefview
|
||
msgid "Brief"
|
||
msgstr "Krótki"
|
||
|
||
#: ulng.rsoptionseditorcolors
|
||
msgid "Colors"
|
||
msgstr "Kolory"
|
||
|
||
#: ulng.rsoptionseditorcolumnsview
|
||
msgid "Columns"
|
||
msgstr "Kolumny"
|
||
|
||
#: ulng.rsoptionseditorconfiguration
|
||
msgctxt "ulng.rsoptionseditorconfiguration"
|
||
msgid "Configuration"
|
||
msgstr "Konfiguracja"
|
||
|
||
#: ulng.rsoptionseditorcustomcolumns
|
||
msgid "Custom columns"
|
||
msgstr "Niestandardowe kolumny"
|
||
|
||
#: ulng.rsoptionseditordirectoryhotlist
|
||
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Ulubione katalogi"
|
||
|
||
#: ulng.rsoptionseditordraganddrop
|
||
msgid "Drag & drop"
|
||
msgstr "Przeciągnij i upuść"
|
||
|
||
#: ulng.rsoptionseditordriveslistbutton
|
||
msgid "Drives list button"
|
||
msgstr "Przycisk listy dysków"
|
||
|
||
#: ulng.rsoptionseditorfavoritetabs
|
||
msgid "Favorite Tabs"
|
||
msgstr "Ulubione zakładki"
|
||
|
||
#: ulng.rsoptionseditorfileassicextra
|
||
msgid "File associations extra"
|
||
msgstr "Dodatkowe skojarzenia plików"
|
||
|
||
#: ulng.rsoptionseditorfileassoc
|
||
msgid "File associations"
|
||
msgstr "Skojarzenia plików"
|
||
|
||
#: ulng.rsoptionseditorfilenewfiletypes
|
||
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
||
msgid "New"
|
||
msgstr "Nowy"
|
||
|
||
#: ulng.rsoptionseditorfileoperations
|
||
msgid "File operations"
|
||
msgstr "Operacje na plikach"
|
||
|
||
#: ulng.rsoptionseditorfilepanels
|
||
msgid "File panels"
|
||
msgstr "Panele plików"
|
||
|
||
#: ulng.rsoptionseditorfilesearch
|
||
msgctxt "ulng.rsoptionseditorfilesearch"
|
||
msgid "File search"
|
||
msgstr "Wyszukiwanie pliku"
|
||
|
||
#: ulng.rsoptionseditorfilesviews
|
||
msgid "Files views"
|
||
msgstr "Widoki plików"
|
||
|
||
#: ulng.rsoptionseditorfiletypes
|
||
msgctxt "ulng.rsoptionseditorfiletypes"
|
||
msgid "File types"
|
||
msgstr "Typy plików"
|
||
|
||
#: ulng.rsoptionseditorfoldertabs
|
||
msgid "Folder tabs"
|
||
msgstr "Zakładki katalogów"
|
||
|
||
#: ulng.rsoptionseditorfoldertabsextra
|
||
msgid "Folder tabs extra"
|
||
msgstr "Dodatkowe zakładki folderów"
|
||
|
||
#: ulng.rsoptionseditorfonts
|
||
msgid "Fonts"
|
||
msgstr "Czcionki"
|
||
|
||
#: ulng.rsoptionseditorhighlighters
|
||
msgid "Highlighters"
|
||
msgstr "Podświetlanie"
|
||
|
||
#: ulng.rsoptionseditorhotkeys
|
||
msgid "Hot keys"
|
||
msgstr "Skróty klawiaturowe"
|
||
|
||
#: ulng.rsoptionseditoricons
|
||
msgid "Icons"
|
||
msgstr "Ikony"
|
||
|
||
#: ulng.rsoptionseditorignorelist
|
||
msgid "Ignore list"
|
||
msgstr "Lista ignorowanych plików/katalogów"
|
||
|
||
#: ulng.rsoptionseditorkeyboard
|
||
msgid "Keys"
|
||
msgstr "Klawisze"
|
||
|
||
#: ulng.rsoptionseditorlanguage
|
||
msgid "Language"
|
||
msgstr "Język"
|
||
|
||
#: ulng.rsoptionseditorlayout
|
||
msgid "Layout"
|
||
msgstr "Wygląd"
|
||
|
||
#: ulng.rsoptionseditorlog
|
||
msgid "Log"
|
||
msgstr "Plik dziennika"
|
||
|
||
#: ulng.rsoptionseditormiscellaneous
|
||
msgid "Miscellaneous"
|
||
msgstr "Różne"
|
||
|
||
#: ulng.rsoptionseditormouse
|
||
msgid "Mouse"
|
||
msgstr "Mysz"
|
||
|
||
#: ulng.rsoptionseditoroptionschanged
|
||
msgid ""
|
||
"Options have changed in \"%s\"\n"
|
||
"\n"
|
||
"Do you want to save modifications?\n"
|
||
msgstr ""
|
||
"Opcje zostały zmienione w \"%s\"\n"
|
||
"\n"
|
||
"Czy chcesz zapisać zmiany?\n"
|
||
|
||
#: ulng.rsoptionseditorplugins
|
||
msgctxt "ulng.rsoptionseditorplugins"
|
||
msgid "Plugins"
|
||
msgstr "Wtyczki"
|
||
|
||
#: ulng.rsoptionseditorquicksearch
|
||
msgid "Quick search/filter"
|
||
msgstr "Szybkie wyszukiwanie/filtr"
|
||
|
||
#: ulng.rsoptionseditorterminal
|
||
msgctxt "ulng.rsoptionseditorterminal"
|
||
msgid "Terminal"
|
||
msgstr "Terminal"
|
||
|
||
#: ulng.rsoptionseditortoolbar
|
||
msgid "Toolbar"
|
||
msgstr "Pasek narzędzi"
|
||
|
||
#: ulng.rsoptionseditortools
|
||
msgid "Tools"
|
||
msgstr "Narzędzia"
|
||
|
||
#: ulng.rsoptionseditortooltips
|
||
msgid "Tooltips"
|
||
msgstr "Podpowiedzi"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenu
|
||
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
||
msgid "Tree View Menu"
|
||
msgstr "Menu widoku drzewa"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenucolors
|
||
msgid "Tree View Menu Colors"
|
||
msgstr "Kolory menu widoku drzewa"
|
||
|
||
#: ulng.rsoptletters
|
||
msgid "None;Command Line;Quick Search;Quick Filter"
|
||
msgstr "Brak;Wiersz polecenia;Szybkie wyszukiwanie;Szybki filtr"
|
||
|
||
#: ulng.rsoptmouseselectionbutton
|
||
msgid "Left button;Right button;"
|
||
msgstr "Lewy klawisz;Prawy klawisz;"
|
||
|
||
#: ulng.rsoptnewfilesposition
|
||
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
||
msgstr "na początku listy plików;po katalogach(jeśli katalogi są sortowane przed plikami);od sortowanej pozycji;na końcu listy plików"
|
||
|
||
#: ulng.rsoptpluginalreadyassigned
|
||
msgid "Plugin %s is already assigned for the following extensions:"
|
||
msgstr "Wtyczka %s jest już przypisana do następujących rozszerzeń:"
|
||
|
||
#: ulng.rsoptpluginsactive
|
||
msgctxt "ulng.rsoptpluginsactive"
|
||
msgid "Active"
|
||
msgstr "Aktywna"
|
||
|
||
#: ulng.rsoptpluginsfilename
|
||
msgctxt "ulng.rsoptpluginsfilename"
|
||
msgid "File name"
|
||
msgstr "Nazwa pliku"
|
||
|
||
#: ulng.rsoptpluginsname
|
||
msgctxt "ulng.rsoptpluginsname"
|
||
msgid "Name"
|
||
msgstr "Nazwa"
|
||
|
||
#: ulng.rsoptpluginsregisteredfor
|
||
msgctxt "ulng.rsoptpluginsregisteredfor"
|
||
msgid "Registered for"
|
||
msgstr "Skojarzenia"
|
||
|
||
#: ulng.rsoptsearchcase
|
||
msgid "&Sensitive;&Insensitive"
|
||
msgstr "Uwzględnij;Ignoruj"
|
||
|
||
#: ulng.rsoptsearchitems
|
||
msgid "&Files;Di&rectories;Files a&nd Directories"
|
||
msgstr "Pliki;Katalogi;Pliki i katalogi"
|
||
|
||
#: ulng.rsoptsearchopt
|
||
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
||
msgstr "Ukryj panel filtru gdy brak pasujących;Zachowaj zapisane ustawienia zmian dla następnej sesji"
|
||
|
||
#: ulng.rsoptsortcasesens
|
||
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
||
msgstr "nie uwzględnia wielkości liter; według ustawień lokalnych (aAbBcC); napierw wielkie, potem małe litery (ABCabc)"
|
||
|
||
#: ulng.rsoptsortfoldermode
|
||
msgid "sort by name and show first;sort like files and show first;sort like files"
|
||
msgstr "według nazwy i pokaż pierwsze; sortuj jako pliki i pokaż pierwsze; sortuj jako pliki"
|
||
|
||
#: ulng.rsoptsortmethod
|
||
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
||
msgstr "Alfabetycznie, uwzględniając akcenty;Naturalne sortowanie: alfabetycznie i numery"
|
||
|
||
#: ulng.rsopttabsposition
|
||
msgid "Top;Bottom;"
|
||
msgstr "Góra;Dół;"
|
||
|
||
#: ulng.rsopttoolbarbuttontype
|
||
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
||
msgstr "Separator;Polecenie wewnętrzne;Polecenie zewnętrzne;Men&u"
|
||
|
||
#: ulng.rsopttypeofduplicatedrename
|
||
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
||
msgstr "DC legacy - Kopiuj (x) nazwapliku.roz;Windows - nazwapliku (x).roz;Pozostałe - nazwapliku(x).roz"
|
||
|
||
#: ulng.rsoptupdatedfilesposition
|
||
msgid "don't change position;use the same setting as for new files;to sorted position"
|
||
msgstr "nie zmieniaj pozycji;użyj takich samych ustawień dla nowych plików; do posortowanej pozycji"
|
||
|
||
#: ulng.rspropscontains
|
||
msgid "Files: %d, folders: %d"
|
||
msgstr "Pliki: %d, foldery: %d"
|
||
|
||
#: ulng.rspropserrchmod
|
||
msgid "Can not change access rights for \"%s\""
|
||
msgstr "Nie można zmienić praw dostępu dla \"%s\""
|
||
|
||
#: ulng.rspropserrchown
|
||
msgid "Can not change owner for \"%s\""
|
||
msgstr "Nie można zmienić właściciela dla \"%s\""
|
||
|
||
#: ulng.rspropsfile
|
||
msgid "File"
|
||
msgstr "Plik"
|
||
|
||
#: ulng.rspropsfolder
|
||
msgctxt "ulng.rspropsfolder"
|
||
msgid "Directory"
|
||
msgstr "Katalog"
|
||
|
||
#: ulng.rspropsnmdpipe
|
||
msgid "Named pipe"
|
||
msgstr "Nazwany strumień"
|
||
|
||
#: ulng.rspropssocket
|
||
msgid "Socket"
|
||
msgstr "Socket"
|
||
|
||
#: ulng.rspropsspblkdev
|
||
msgid "Special block device"
|
||
msgstr "Specjalne urządzenie blokowe"
|
||
|
||
#: ulng.rspropsspchrdev
|
||
msgid "Special character device"
|
||
msgstr "Specjalne urządzenie wirtualne"
|
||
|
||
#: ulng.rspropssymlink
|
||
msgid "Symbolic link"
|
||
msgstr "Link symboliczny"
|
||
|
||
#: ulng.rspropsunknowntype
|
||
msgid "Unknown type"
|
||
msgstr "Nieznany typ"
|
||
|
||
#: ulng.rssearchresult
|
||
msgid "Search result"
|
||
msgstr "Wynik wyszukiwania"
|
||
|
||
#: ulng.rssearchstatus
|
||
msgid "SEARCH"
|
||
msgstr "WYSZUKAJ"
|
||
|
||
#: ulng.rssearchtemplateunnamed
|
||
msgid "<unnamed template>"
|
||
msgstr "<szablon bez nazwy>"
|
||
|
||
#: ulng.rssearchwithdsxplugininprogress
|
||
msgid ""
|
||
"A file search using DSX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Przeszukanie pliku za pomocą wtyczki DSX jest już w toku.\n"
|
||
"Przed uruchomieniem nowego musisz zamknąć bieżące.\n"
|
||
|
||
#: ulng.rssearchwithwdxplugininprogress
|
||
msgid ""
|
||
"A file search using WDX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Przeszukanie pliku za pomocą wtyczki WDX jest już w toku.\n"
|
||
"Przed uruchomieniem nowego musisz zamknąć bieżące.\n"
|
||
|
||
#: ulng.rsselectdir
|
||
msgid "Select a directory"
|
||
msgstr "Wybierz katalog"
|
||
|
||
#: ulng.rsselectyoufindfileswindow
|
||
msgid "Select your window"
|
||
msgstr "Wybierz okno"
|
||
|
||
#: ulng.rsshowhelpfor
|
||
msgid "&Show help for %s"
|
||
msgstr "Pokaż pomoc dla %s"
|
||
|
||
#: ulng.rssimplewordall
|
||
msgctxt "ulng.rssimplewordall"
|
||
msgid "All"
|
||
msgstr "Wszystko"
|
||
|
||
#: ulng.rssimplewordcategory
|
||
msgctxt "ulng.rssimplewordcategory"
|
||
msgid "Category"
|
||
msgstr "Kategoria"
|
||
|
||
#: ulng.rssimplewordcolumnsingular
|
||
msgid "Column"
|
||
msgstr "Kolumna"
|
||
|
||
#: ulng.rssimplewordcommand
|
||
msgctxt "ulng.rssimplewordcommand"
|
||
msgid "Command"
|
||
msgstr "Polecenie"
|
||
|
||
#: ulng.rssimplewordfilename
|
||
msgid "Filename"
|
||
msgstr "Nazwa pliku"
|
||
|
||
#: ulng.rssimplewordfiles
|
||
msgid "files"
|
||
msgstr "pliki"
|
||
|
||
#: ulng.rssimplewordletter
|
||
msgid "Letter"
|
||
msgstr "Litera"
|
||
|
||
#: ulng.rssimplewordparameter
|
||
msgid "Param"
|
||
msgstr "Parametr"
|
||
|
||
#: ulng.rssimplewordresult
|
||
msgid "Result"
|
||
msgstr "Wynik"
|
||
|
||
#: ulng.rssimplewordworkdir
|
||
msgid "WorkDir"
|
||
msgstr "Folder roboczy"
|
||
|
||
#: ulng.rssizeunitbytes
|
||
msgid "Bytes"
|
||
msgstr "Bajty"
|
||
|
||
#: ulng.rssizeunitgbytes
|
||
msgid "Gigabytes"
|
||
msgstr "Gigabajty"
|
||
|
||
#: ulng.rssizeunitkbytes
|
||
msgid "Kilobytes"
|
||
msgstr "Kilobajty"
|
||
|
||
#: ulng.rssizeunitmbytes
|
||
msgid "Megabytes"
|
||
msgstr "Megabajty"
|
||
|
||
#: ulng.rssizeunittbytes
|
||
msgid "Terabytes"
|
||
msgstr "Terabajty"
|
||
|
||
#: ulng.rsspacemsg
|
||
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
||
msgstr "Plików: %d, Katalogów: %d, Rozmiar: %s (%s bajtów)"
|
||
|
||
#: ulng.rsspliterrdirectory
|
||
msgid "Unable to create target directory!"
|
||
msgstr "Nie można utworzyć katalogu docelowego!"
|
||
|
||
#: ulng.rsspliterrfilesize
|
||
msgid "Incorrect file size format!"
|
||
msgstr "Nieprawidłowy format wielkości pliku!"
|
||
|
||
#: ulng.rsspliterrsplitfile
|
||
msgid "Unable to split the file!"
|
||
msgstr "Pliku nie da się podzielić!"
|
||
|
||
#: ulng.rssplitmsgmanyparts
|
||
msgid "The number of parts is more than 100! Continue?"
|
||
msgstr "Liczba części jest większa niż 100! Kontynuować?"
|
||
|
||
#: ulng.rssplitpredefinedsizes
|
||
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
msgstr "Automatycznie;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
|
||
#: ulng.rssplitseldir
|
||
msgid "Select directory:"
|
||
msgstr "Wybierz katalog:"
|
||
|
||
#: ulng.rsstraccents
|
||
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;#195€;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
|
||
#: ulng.rsstraccentsstripped
|
||
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
|
||
#: ulng.rsstrpreviewjustpreview
|
||
msgid "Just preview"
|
||
msgstr "Tylko podgląd"
|
||
|
||
#: ulng.rsstrpreviewothers
|
||
msgid "Others"
|
||
msgstr "Pozostałe"
|
||
|
||
#: ulng.rsstrpreviewsearchingletters
|
||
msgid "OU"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewsidenote
|
||
msgid "Side note"
|
||
msgstr "Na marginesie"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched1
|
||
msgid "Flat"
|
||
msgstr "Płaski"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched2
|
||
msgid "Limited"
|
||
msgstr "Ograniczony"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched3
|
||
msgid "Simple"
|
||
msgstr "Prosty"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched1
|
||
msgid "Fabulous"
|
||
msgstr "Fantastyczny"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched2
|
||
msgid "Marvelous"
|
||
msgstr "Cudowny"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched3
|
||
msgid "Tremendous"
|
||
msgstr "Ogromny"
|
||
|
||
#: ulng.rsstrtvmchoosedirhistory
|
||
msgid "Choose your directory from Dir History"
|
||
msgstr "Wybierz katalog z historii katalogów"
|
||
|
||
#: ulng.rsstrtvmchoosefavoritetabs
|
||
msgid "Choose you Favorite Tabs:"
|
||
msgstr "Wybierz ulubione zakładki"
|
||
|
||
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
||
msgid "Choose your command from Command Line History"
|
||
msgstr "Wybierz polecenie z historii listy poleceń"
|
||
|
||
#: ulng.rsstrtvmchoosefrommainmenu
|
||
msgid "Choose your action from Main Menu"
|
||
msgstr "Wybierz czynność z głównego menu"
|
||
|
||
#: ulng.rsstrtvmchoosefromtoolbar
|
||
msgid "Choose your action from Maintool bar"
|
||
msgstr "Wybierz czynność z głównego paska narzędzi"
|
||
|
||
#: ulng.rsstrtvmchoosehotdirectory
|
||
msgid "Choose your directory from Hot Directory:"
|
||
msgstr "Wybierz katalog z Hot katalogu:"
|
||
|
||
#: ulng.rsstrtvmchooseviewhistory
|
||
msgid "Choose your directory from File View History"
|
||
msgstr "Wybierz katalog z pliku widoku historii"
|
||
|
||
#: ulng.rsstrtvmchooseyourfileordir
|
||
msgid "Choose your file or your directory"
|
||
msgstr "Wybierz plik lub katalog"
|
||
|
||
#: ulng.rssymerrcreate
|
||
msgid "Error creating symlink."
|
||
msgstr "Błąd przy tworzeniu linku symbolicznego."
|
||
|
||
#: ulng.rssyndefaulttext
|
||
msgid "Default text"
|
||
msgstr "Domyślny tekst"
|
||
|
||
#: ulng.rssynlangplaintext
|
||
msgid "Plain text"
|
||
msgstr "Zwykły tekst"
|
||
|
||
#: ulng.rstabsactionondoubleclickchoices
|
||
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
||
msgstr "Nie rób nic;Zamknij zakładkę;Dostęp do ulubionych zakładek;Menu kontekstowe zakładek"
|
||
|
||
#: ulng.rstimeunitday
|
||
msgid "Day(s)"
|
||
msgstr "Dzień (dni)"
|
||
|
||
#: ulng.rstimeunithour
|
||
msgid "Hour(s)"
|
||
msgstr "Godzin(y)"
|
||
|
||
#: ulng.rstimeunitminute
|
||
msgid "Minute(s)"
|
||
msgstr "Minut(y)"
|
||
|
||
#: ulng.rstimeunitmonth
|
||
msgid "Month(s)"
|
||
msgstr "Miesiąc(e)"
|
||
|
||
#: ulng.rstimeunitsecond
|
||
msgid "Second(s)"
|
||
msgstr "Sekund(y)"
|
||
|
||
#: ulng.rstimeunitweek
|
||
msgid "Week(s)"
|
||
msgstr "Tydzień (tygodnie)"
|
||
|
||
#: ulng.rstimeunityear
|
||
msgid "Year(s)"
|
||
msgstr "Rok (Lata)"
|
||
|
||
#: ulng.rstitlerenamefavtabs
|
||
msgid "Rename Favorite Tabs"
|
||
msgstr "Zmień nazwę ulubionych zakładek"
|
||
|
||
#: ulng.rstitlerenamefavtabsmenu
|
||
msgid "Rename Favorite Tabs sub-menu"
|
||
msgstr "Zmień nazwę podmenu ulubionych zakładek"
|
||
|
||
#: ulng.rstooldiffer
|
||
msgctxt "ulng.rstooldiffer"
|
||
msgid "Differ"
|
||
msgstr "Różnice"
|
||
|
||
#: ulng.rstooleditor
|
||
msgctxt "ulng.rstooleditor"
|
||
msgid "Editor"
|
||
msgstr "Edytor"
|
||
|
||
#: ulng.rstoolerroropeningdiffer
|
||
msgid "Error opening differ"
|
||
msgstr "Błąd przy otwieraniu porównywania"
|
||
|
||
#: ulng.rstoolerroropeningeditor
|
||
msgid "Error opening editor"
|
||
msgstr "Błąd przy otwieraniu edytora"
|
||
|
||
#: ulng.rstoolerroropeningterminal
|
||
msgid "Error opening terminal"
|
||
msgstr "Błąd przy otwieraniu terminalu"
|
||
|
||
#: ulng.rstoolerroropeningviewer
|
||
msgid "Error opening viewer"
|
||
msgstr "Błąd przy otwieraniu podglądu"
|
||
|
||
#: ulng.rstoolterminal
|
||
msgctxt "ulng.rstoolterminal"
|
||
msgid "Terminal"
|
||
msgstr "Terminal"
|
||
|
||
#: ulng.rstoolviewer
|
||
msgctxt "ulng.rstoolviewer"
|
||
msgid "Viewer"
|
||
msgstr "Lister"
|
||
|
||
#: ulng.rsunhandledexceptionmessage
|
||
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
||
msgstr "Proszę zgłosić ten błąd do systemu śledzenia błędów wraz z opisem wcześniejszych działań i następującym plikiem:%sWciśnij %s aby kontynuować lub %s aby zakończyć program."
|
||
|
||
#: ulng.rsvarbothpanelactivetoinactive
|
||
msgid "Both panels, from active to inactive"
|
||
msgstr "Oba panele, z aktywnego do nieaktywnego"
|
||
|
||
#: ulng.rsvarbothpanellefttoright
|
||
msgid "Both panels, from left to right"
|
||
msgstr "Oba panele, od lewej do prawej"
|
||
|
||
#: ulng.rsvarcurrentpath
|
||
msgid "Path of panel"
|
||
msgstr "Ścieżka panelu"
|
||
|
||
#: ulng.rsvarencloseelement
|
||
msgid "Enclose each name in brackets or what you want"
|
||
msgstr "Każdą nazwę należy ująć w nawiasach lub w czym chcesz"
|
||
|
||
#: ulng.rsvarfilenamenoext
|
||
msgid "Just filename, no extension"
|
||
msgstr "Tylko nazwa pliku, bez rozszerzenia"
|
||
|
||
#: ulng.rsvarfullpath
|
||
msgid "Complete filename (path+filename)"
|
||
msgstr "Pełna nazwa pliku (ścieżka+nazwa pliku)"
|
||
|
||
#: ulng.rsvarhelpwith
|
||
msgid "Help with \"%\" variables"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarinputparam
|
||
msgid "Will request request user to enter a parameter with a default suggested value"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarleftpanel
|
||
msgid "Left panel"
|
||
msgstr "Lewy panel"
|
||
|
||
#: ulng.rsvarlistfilename
|
||
msgid "Temporary filename of list of filenames"
|
||
msgstr "Tymczasowa nazwa pliku listy nazw plików"
|
||
|
||
#: ulng.rsvarlistfullfilename
|
||
msgid "Temporary filename of list of complete filenames (path+filename)"
|
||
msgstr "Tymczasowa nazwa pliku listy pełnych nazw plików (ścieżka+nazwa pliku)"
|
||
|
||
#: ulng.rsvarlistinutf16
|
||
msgid "Filenames in list in UTF-16 with BOM"
|
||
msgstr "Nazwy plików na liście w UTF-16 z BOM"
|
||
|
||
#: ulng.rsvarlistinutf16quoted
|
||
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
||
msgstr "Nazwy plików na liście w UTF-16 z BOM, wewnątrz cudzysłowów"
|
||
|
||
#: ulng.rsvarlistinutf8
|
||
msgid "Filenames in list in UTF-8"
|
||
msgstr "Nazwy plików na liście w UTF-8"
|
||
|
||
#: ulng.rsvarlistinutf8quoted
|
||
msgid "Filenames in list in UTF-8, inside double quotes"
|
||
msgstr "Nazwy plików na liście w UTF-8, wewnatrz cudzysłowów"
|
||
|
||
#: ulng.rsvarlistrelativefilename
|
||
msgid "Temporary filename of list of filenames with relative path"
|
||
msgstr "Tymczasowy nazwa pliku listy nazw plików z ścieżkąwzględną"
|
||
|
||
#: ulng.rsvaronlyextension
|
||
msgid "Only file extension"
|
||
msgstr "Tylko rozszerzenie pliku"
|
||
|
||
#: ulng.rsvaronlyfilename
|
||
msgid "Only filename"
|
||
msgstr "Tylko nazwa pliku"
|
||
|
||
#: ulng.rsvarotherexamples
|
||
msgid "Other example of what's possible"
|
||
msgstr "Inny przykład tego, co jest możliwe"
|
||
|
||
#: ulng.rsvarpath
|
||
msgid "Path, with ending delimiter"
|
||
msgstr "Ścieżka z końcowym separatorem"
|
||
|
||
#: ulng.rsvarpercentchangetopound
|
||
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarpercentsign
|
||
msgid "Return the percent sign"
|
||
msgstr "Zwraca znak procentu"
|
||
|
||
#: ulng.rsvarpoundchangetopercent
|
||
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarprependelement
|
||
msgid "Prepend each name with \"-a \" or what you want"
|
||
msgstr "Poprzedź każdą nazwę \"-a \" lub czym chcesz"
|
||
|
||
#: ulng.rsvarpromptuserforparam
|
||
msgid "%[Prompt user for param;Default value proposed]"
|
||
msgstr "%[Pytaj użytkownika o parametr;Proponuj wartość domyślną]"
|
||
|
||
#: ulng.rsvarrelativepathandfilename
|
||
msgid "Filename with relative path"
|
||
msgstr "Nazwa pliku ze ścieżką względną"
|
||
|
||
#: ulng.rsvarrightpanel
|
||
msgid "Right panel"
|
||
msgstr "Prawy panel"
|
||
|
||
#: ulng.rsvarsecondelementrightpanel
|
||
msgid "Full path of second selected file in right panel"
|
||
msgstr "Pełna ścieżka drugiego wybranego pliku w prawym panelu"
|
||
|
||
#: ulng.rsvarshowcommandprior
|
||
msgid "Show command prior execute"
|
||
msgstr "Pokaż poprzednio wykonane polecenie"
|
||
|
||
#: ulng.rsvarsimplemessage
|
||
msgid "%[Simple message]"
|
||
msgstr "%[Prosta wiadomość]"
|
||
|
||
#: ulng.rsvarsimpleshowmessage
|
||
msgid "Will show a simple message"
|
||
msgstr "Pokaże prostą wiadomość"
|
||
|
||
#: ulng.rsvarsourcepanel
|
||
msgid "Active panel (source)"
|
||
msgstr "Aktywny panel (źródło)"
|
||
|
||
#: ulng.rsvartargetpanel
|
||
msgid "Inactive panel (target)"
|
||
msgstr "Nieaktywny panel (cel)"
|
||
|
||
#: ulng.rsvarwillbequoted
|
||
msgid "Filenames will be quoted from here (default)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarwilldointerminal
|
||
msgid "Command will be done in terminal, remaining opened at the end"
|
||
msgstr "Polecenie zostanie wykonane w terminalu i pozostanie on otwarty po zakończeniu"
|
||
|
||
#: ulng.rsvarwillhaveendingdelimiter
|
||
msgid "Paths will have ending delimiter"
|
||
msgstr "Ścieżki nie mają końcowego ogranicznika"
|
||
|
||
#: ulng.rsvarwillnotbequoted
|
||
msgid "Filenames will not be quoted from here"
|
||
msgstr "Nazwy plików nie zostaną tutaj podane"
|
||
|
||
#: ulng.rsvarwillnotdointerminal
|
||
msgid "Command will be done in terminal, closed at the end"
|
||
msgstr "Polecenie zostanie wykonane w terminalu i zostanie on zamknięty po zakończeniu"
|
||
|
||
#: ulng.rsvarwillnothaveendingdelimiter
|
||
msgid "Paths will not have ending delimiter (default)"
|
||
msgstr "Ścieżki nie mają końcowego ogranicznika (domyślnie)"
|
||
|
||
#: ulng.rsvfsnetwork
|
||
msgctxt "ulng.rsvfsnetwork"
|
||
msgid "Network"
|
||
msgstr "Sieć"
|
||
|
||
#: ulng.rsviewabouttext
|
||
msgid "Internal Viewer of Double Commander."
|
||
msgstr "Program wewnętrzny Double Commandera do podglądu"
|
||
|
||
#: ulng.rsviewbadquality
|
||
msgid "Bad Quality"
|
||
msgstr "Zła jakość"
|
||
|
||
#: ulng.rsviewencoding
|
||
msgctxt "ulng.rsviewencoding"
|
||
msgid "Encoding"
|
||
msgstr "Kodowanie"
|
||
|
||
#: ulng.rsviewimagetype
|
||
msgid "Image Type"
|
||
msgstr "Typ obrazu"
|
||
|
||
#: ulng.rsviewnewsize
|
||
msgctxt "ulng.rsviewnewsize"
|
||
msgid "New Size"
|
||
msgstr "Nowy rozmiar"
|
||
|
||
#: ulng.rsviewnotfound
|
||
msgid "%s not found!"
|
||
msgstr "%s nie znaleziony!"
|
||
|
||
#: ulng.rsviewwithexternalviewer
|
||
msgid "with external viewer"
|
||
msgstr "w zewnętrznej przeglądarce"
|
||
|
||
#: ulng.rsviewwithinternalviewer
|
||
msgid "with internal viewer"
|
||
msgstr "w wewnętrznej przeglądarce"
|
||
|
||
#: ulng.rsxreplacements
|
||
msgid "Number of replacement: %d"
|
||
msgstr "Liczba zamienionych: %d"
|
||
|
||
#: ulng.rszeroreplacement
|
||
msgid "No replacement took place."
|
||
msgstr "Nie było zmienionych"
|
||
|