mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-28 10:02:14 +00:00
FIX: In windows, the TC internal commands "cm_ShrinkSelection" and "cm_ClearAll" are not imported to a better equivalence since we may now set parameter for internal command "cm_MarkMinus" and "cm_MarkUnmarkAll". ADD: In windows, we may now import correctly additional 22 TC internal commands. These TC internal commands are cm_SelectCurrentName, cm_UnselectCurrentName, cm_SelectCurrentNameExt, cm_UnselectCurrentNameExt, cm_SelectCurrentPath, cm_UnselectCurrentPath, cm_SelectBoth, cm_SelectFiles, cm_SelectFolders, cm_ClearFiles, cm_ClearFolders, cm_ClearSelCfg, cm_ClearAllFiles, cm_SelectAllFolders, cm_ClearAllCfg, cm_ExchangeSelBoth, cm_ExchangeSelFiles, cm_ExchangeSelFolders, cm_SelectAllBoth, cm_SelectAllFiles, cm_SelectAllFolders and cm_ConfigSaveSettings. FIX: In Windows, fix a little display problem when we import tool bar from TC to a new created toolbar. This toolbar was not created but not displayed. Now it is. DEL: Remove annoying "New Item1" from foptionshotkeysedithotkey's files and language files.
12582 lines
373 KiB
Text
12582 lines
373 KiB
Text
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
|
||
"Report-Msgid-Bugs-To: \n"
|
||
"POT-Creation-Date: \n"
|
||
"PO-Revision-Date: 2015-08-25 23:33+0200\n"
|
||
"Last-Translator: masterok <m_shein@ukr.net>\n"
|
||
"Language-Team: \n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=utf-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Native-Language: Український\n"
|
||
|
||
#: fsyncdirsdlg.rscomparingpercent
|
||
msgid "Comparing... %d%% (ESC to cancel)"
|
||
msgstr "Порівняння... %d%% (ESC щоб скасувати)"
|
||
|
||
#: fsyncdirsdlg.rsdeleteright
|
||
msgid "Right: Delete %d file(s)"
|
||
msgstr "Справа: Видалити %d файл(и) "
|
||
|
||
#: fsyncdirsdlg.rsfilesfound
|
||
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
||
msgstr "Знайдено файлів: %d (Однакових: %d, Різних: %d, Унікальних зліва: %d, Унікальних справа: %d)"
|
||
|
||
#: fsyncdirsdlg.rslefttorightcopy
|
||
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
||
msgstr "Справа на ліво: Копіювати %d файлів, загальним розміром: %d байт"
|
||
|
||
#: fsyncdirsdlg.rsrighttoleftcopy
|
||
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
||
msgstr "Зліва на право: Копіювати %d файлів, загальним розміром: %d байт"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
||
msgid "Choose template..."
|
||
msgstr "Вибрати шаблон..."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
||
msgid "C&heck free space"
|
||
msgstr "Перевірити вільне міс&це"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
||
msgid "Cop&y attributes"
|
||
msgstr "Копі&ювати атрибути"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
||
msgid "Copy o&wnership"
|
||
msgstr "Копіювати &власника"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
||
msgid "Copy &permissions"
|
||
msgstr "Копіювати &права"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Копіювати &дату/час"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
||
msgid "Correct lin&ks"
|
||
msgstr "Правил&ьні посилання"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "Drop readonly fla&g"
|
||
msgstr "Скинути позначку \"Л&ише читання\""
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
||
msgid "E&xclude empty directories"
|
||
msgstr "Викл&ючити порожні каталоги"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
||
msgid "Fo&llow links"
|
||
msgstr "Перейти за поси&ланнями"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
||
msgid "&Reserve space"
|
||
msgstr "Зарезервувати &місце"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
||
msgid "&Verify"
|
||
msgstr ""
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
||
msgid "What to do when cannot set file time, attributes, etc."
|
||
msgstr "Що робити, якщо неможливо встановити час файла, атрибути, тощо."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
||
msgid "Use file template"
|
||
msgstr "Використати файл шаблону"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
||
msgid "When dir&ectory exists"
|
||
msgstr "Якщо &каталог існує"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When &file exists"
|
||
msgstr "Якщо &файл існує"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
||
msgid "When ca&nnot set property"
|
||
msgstr "Коли не можливо встановити в&ластивості"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
||
msgid "<no template>"
|
||
msgstr "<no template>"
|
||
|
||
#: tfrmabout.btnclose.caption
|
||
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmabout.btncopytoclipboard.caption
|
||
msgid "Copy to clipboard"
|
||
msgstr "Копіювати в буфер"
|
||
|
||
#: tfrmabout.caption
|
||
msgctxt "TFRMABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "Про програму..."
|
||
|
||
#: tfrmabout.lblbuild.caption
|
||
msgctxt "tfrmabout.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Збірка"
|
||
|
||
#: tfrmabout.lblfreepascalver.caption
|
||
msgctxt "tfrmabout.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmabout.lblhomepage.caption
|
||
msgid "Home Page:"
|
||
msgstr "Домашня сторінка:"
|
||
|
||
#: tfrmabout.lblhomepageaddress.caption
|
||
msgid "http://doublecmd.sourceforge.net"
|
||
msgstr "http://doublecmd.sourceforge.net"
|
||
|
||
#: tfrmabout.lbllazarusver.caption
|
||
msgctxt "tfrmabout.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmabout.lblrevision.caption
|
||
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
|
||
msgid "Revision"
|
||
msgstr "Ревізія:"
|
||
|
||
#: tfrmabout.lbltitle.caption
|
||
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmabout.lblversion.caption
|
||
msgctxt "tfrmabout.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Версія"
|
||
|
||
#: tfrmattributesedit.btncancel.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmattributesedit.btnok.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmattributesedit.btnreset.caption
|
||
msgid "&Reset"
|
||
msgstr "&Скинути"
|
||
|
||
#: tfrmattributesedit.caption
|
||
msgid "Choose attributes"
|
||
msgstr "Вибрати атрибути"
|
||
|
||
#: tfrmattributesedit.cbarchive.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
|
||
msgid "&Archive"
|
||
msgstr "&Архівний"
|
||
|
||
#: tfrmattributesedit.cbcompressed.caption
|
||
msgid "Co&mpressed"
|
||
msgstr "Стиснути&й"
|
||
|
||
#: tfrmattributesedit.cbdirectory.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
|
||
msgid "&Directory"
|
||
msgstr "&Каталог"
|
||
|
||
#: tfrmattributesedit.cbencrypted.caption
|
||
msgid "&Encrypted"
|
||
msgstr "За&шифрований"
|
||
|
||
#: tfrmattributesedit.cbhidden.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
|
||
msgid "&Hidden"
|
||
msgstr "При&хований"
|
||
|
||
#: tfrmattributesedit.cbreadonly.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
|
||
msgid "Read o&nly"
|
||
msgstr "Лише &читання"
|
||
|
||
#: tfrmattributesedit.cbsgid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmattributesedit.cbsparse.caption
|
||
msgid "S&parse"
|
||
msgstr "Розрід&жений"
|
||
|
||
#: tfrmattributesedit.cbsticky.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Закріплювальний біт"
|
||
|
||
#: tfrmattributesedit.cbsuid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmattributesedit.cbsymlink.caption
|
||
msgid "&Symlink"
|
||
msgstr "&Симв. посилання"
|
||
|
||
#: tfrmattributesedit.cbsystem.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
|
||
msgid "S&ystem"
|
||
msgstr "&Системний"
|
||
|
||
#: tfrmattributesedit.cbtemporary.caption
|
||
msgid "&Temporary"
|
||
msgstr "&Тимчасовий"
|
||
|
||
#: tfrmattributesedit.gbntfsattributes.caption
|
||
msgid "NTFS attributes"
|
||
msgstr "Атрибути NTFS"
|
||
|
||
#: tfrmattributesedit.gbwingeneral.caption
|
||
msgid "General attributes"
|
||
msgstr "Основні атрибути"
|
||
|
||
#: tfrmattributesedit.lblattrbitsstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Біти:"
|
||
|
||
#: tfrmattributesedit.lblattrgroupstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: tfrmattributesedit.lblattrotherstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Інші"
|
||
|
||
#: tfrmattributesedit.lblattrownerstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Власник"
|
||
|
||
#: tfrmattributesedit.lblexec.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Виконання"
|
||
|
||
#: tfrmattributesedit.lblread.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Читання"
|
||
|
||
#: tfrmattributesedit.lbltextattrs.caption
|
||
msgid "As te&xt:"
|
||
msgstr "Як те&кст:"
|
||
|
||
#: tfrmattributesedit.lblwrite.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Запис"
|
||
|
||
#: tfrmchecksumcalc.caption
|
||
msgctxt "tfrmchecksumcalc.caption"
|
||
msgid "Calculate checksum..."
|
||
msgstr "Розрахувати контрольну суму..."
|
||
|
||
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
||
msgid "Open checksum file after job is completed"
|
||
msgstr "Відкрити файл контрольної суми після розрахунку"
|
||
|
||
#: tfrmchecksumcalc.cbseparatefile.caption
|
||
msgid "C&reate separate checksum file for each file"
|
||
msgstr "Для кожного файлу ство&рити свій контрольний файл"
|
||
|
||
#: tfrmchecksumcalc.lblsaveto.caption
|
||
msgid "&Save checksum file(s) to:"
|
||
msgstr "Зберегти файл(и) контрольних сум &як:"
|
||
|
||
#: tfrmchecksumverify.btnclose.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmchecksumverify.caption
|
||
#, fuzzy
|
||
#| msgid "Verify check sum..."
|
||
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
|
||
msgid "Verify checksum..."
|
||
msgstr "Перевірка контрольної суми..."
|
||
|
||
#: tfrmconnectionmanager.btnadd.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Додати"
|
||
|
||
#: tfrmconnectionmanager.btncancel.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmconnectionmanager.btnconnect.caption
|
||
msgid "C&onnect"
|
||
msgstr "З'&єднати"
|
||
|
||
#: tfrmconnectionmanager.btndelete.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Ви&далити"
|
||
|
||
#: tfrmconnectionmanager.btnedit.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Редагувати"
|
||
|
||
#: tfrmconnectionmanager.caption
|
||
msgid "Connection manager"
|
||
msgstr "Диспетчер з'єднань"
|
||
|
||
#: tfrmconnectionmanager.gbconnectto.caption
|
||
msgid "Connect to:"
|
||
msgstr "З'єднатися з:"
|
||
|
||
#: tfrmcopydlg.btnaddtoqueue.caption
|
||
msgid "A&dd To Queue"
|
||
msgstr "Додати в &чергу"
|
||
|
||
#: tfrmcopydlg.btncancel.caption
|
||
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmcopydlg.btnoptions.caption
|
||
msgid "O&ptions"
|
||
msgstr "Налашт&увати"
|
||
|
||
#: tfrmcopydlg.btnsaveoptions.caption
|
||
msgid "Sa&ve these options as default"
|
||
msgstr "Зберегти ці налаштування як &типові"
|
||
|
||
#: tfrmcopydlg.caption
|
||
msgctxt "TFRMCOPYDLG.CAPTION"
|
||
msgid "Copy file(s)"
|
||
msgstr "Копіювати файл(и)"
|
||
|
||
#: tfrmcopydlg.mnunewqueue.caption
|
||
msgctxt "tfrmcopydlg.mnunewqueue.caption"
|
||
msgid "New queue"
|
||
msgstr "Нова черга"
|
||
|
||
#: tfrmcopydlg.mnuqueue1.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue1.caption"
|
||
msgid "Queue 1"
|
||
msgstr "Черга 1"
|
||
|
||
#: tfrmcopydlg.mnuqueue2.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue2.caption"
|
||
msgid "Queue 2"
|
||
msgstr "Черга 2"
|
||
|
||
#: tfrmcopydlg.mnuqueue3.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue3.caption"
|
||
msgid "Queue 3"
|
||
msgstr "Черга 3"
|
||
|
||
#: tfrmcopydlg.mnuqueue4.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue4.caption"
|
||
msgid "Queue 4"
|
||
msgstr "Черга 4"
|
||
|
||
#: tfrmcopydlg.mnuqueue5.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue5.caption"
|
||
msgid "Queue 5"
|
||
msgstr "Черга 5"
|
||
|
||
#: tfrmdescredit.actsavedescription.caption
|
||
msgid "Save Description"
|
||
msgstr "Зберегти опис"
|
||
|
||
#: tfrmdescredit.btncancel.caption
|
||
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmdescredit.btnok.caption
|
||
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmdescredit.caption
|
||
msgid "File/folder comment"
|
||
msgstr "Коментар файлу/теки"
|
||
|
||
#: tfrmdescredit.lbleditcommentfor.caption
|
||
msgid "E&dit comment for:"
|
||
msgstr "Ре&дагувати коментар для:"
|
||
|
||
#: tfrmdescredit.lblencoding.caption
|
||
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
|
||
msgid "&Encoding:"
|
||
msgstr "&Кодування:"
|
||
|
||
#: tfrmdescredit.lblfilename.caption
|
||
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmdiffer.actabout.caption
|
||
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "Про програму..."
|
||
|
||
#: tfrmdiffer.actautocompare.caption
|
||
msgid "Auto Compare"
|
||
msgstr "Авто порівняння"
|
||
|
||
#: tfrmdiffer.actbinarycompare.caption
|
||
msgid "Binary Mode"
|
||
msgstr "Двійковий режим"
|
||
|
||
#: tfrmdiffer.actcancelcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: tfrmdiffer.actcancelcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
|
||
msgid "Copy Block Right"
|
||
msgstr "Копіювати блок вправо"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
||
msgid "Copy Block Right"
|
||
msgstr "Копіювати блок вправо"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
|
||
msgid "Copy Block Left"
|
||
msgstr "Копіювати блок вліво"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
||
msgid "Copy Block Left"
|
||
msgstr "Копіювати блок вліво"
|
||
|
||
#: tfrmdiffer.acteditcopy.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmdiffer.acteditcut.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: tfrmdiffer.acteditdelete.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmdiffer.acteditpaste.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: tfrmdiffer.acteditredo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Повторити"
|
||
|
||
#: tfrmdiffer.acteditselectall.caption
|
||
msgid "Select &All"
|
||
msgstr "Виділити в&се"
|
||
|
||
#: tfrmdiffer.acteditundo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Вернути"
|
||
|
||
#: tfrmdiffer.actexit.caption
|
||
msgctxt "tfrmdiffer.actexit.caption"
|
||
msgid "E&xit"
|
||
msgstr "Ви&хід"
|
||
|
||
#: tfrmdiffer.actfirstdifference.caption
|
||
msgctxt "tfrmdiffer.actfirstdifference.caption"
|
||
msgid "First Difference"
|
||
msgstr "Перша відмінність"
|
||
|
||
#: tfrmdiffer.actfirstdifference.hint
|
||
msgctxt "tfrmdiffer.actfirstdifference.hint"
|
||
msgid "First Difference"
|
||
msgstr "Перша відмінність"
|
||
|
||
#: tfrmdiffer.actignorecase.caption
|
||
msgid "Ignore Case"
|
||
msgstr "Ігнорувати регістр"
|
||
|
||
#: tfrmdiffer.actignorewhitespace.caption
|
||
msgid "Ignore Blanks"
|
||
msgstr "Ігнорувати пробіли"
|
||
|
||
#: tfrmdiffer.actkeepscrolling.caption
|
||
msgid "Keep Scrolling"
|
||
msgstr "Одночасне прокручування"
|
||
|
||
#: tfrmdiffer.actlastdifference.caption
|
||
msgctxt "tfrmdiffer.actlastdifference.caption"
|
||
msgid "Last Difference"
|
||
msgstr "Остання відмінність"
|
||
|
||
#: tfrmdiffer.actlastdifference.hint
|
||
msgctxt "tfrmdiffer.actlastdifference.hint"
|
||
msgid "Last Difference"
|
||
msgstr "Остання відмінність"
|
||
|
||
#: tfrmdiffer.actlinedifferences.caption
|
||
msgid "Line Differences"
|
||
msgstr "Відмінності в рядку"
|
||
|
||
#: tfrmdiffer.actnextdifference.caption
|
||
msgctxt "tfrmdiffer.actnextdifference.caption"
|
||
msgid "Next Difference"
|
||
msgstr "Наступна відмінність"
|
||
|
||
#: tfrmdiffer.actnextdifference.hint
|
||
msgctxt "tfrmdiffer.actnextdifference.hint"
|
||
msgid "Next Difference"
|
||
msgstr "Наступна відмінність"
|
||
|
||
#: tfrmdiffer.actopenleft.caption
|
||
msgid "Open Left..."
|
||
msgstr "Відкрити зліва..."
|
||
|
||
#: tfrmdiffer.actopenright.caption
|
||
msgid "Open Right..."
|
||
msgstr "Відкрити справа..."
|
||
|
||
#: tfrmdiffer.actpaintbackground.caption
|
||
msgid "Paint Background"
|
||
msgstr "Зафарбовувати фон"
|
||
|
||
#: tfrmdiffer.actprevdifference.caption
|
||
msgctxt "tfrmdiffer.actprevdifference.caption"
|
||
msgid "Previous Difference"
|
||
msgstr "Попередня відмінність"
|
||
|
||
#: tfrmdiffer.actprevdifference.hint
|
||
msgctxt "tfrmdiffer.actprevdifference.hint"
|
||
msgid "Previous Difference"
|
||
msgstr "Попередня відмінність"
|
||
|
||
#: tfrmdiffer.actreload.caption
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
|
||
msgid "&Reload"
|
||
msgstr "Пере&завантажити"
|
||
|
||
#: tfrmdiffer.actreload.hint
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
|
||
msgid "Reload"
|
||
msgstr "Перезавантажити"
|
||
|
||
#: tfrmdiffer.actsave.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: tfrmdiffer.actsave.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: tfrmdiffer.actsaveas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
|
||
msgid "Save as..."
|
||
msgstr "Зберегти як..."
|
||
|
||
#: tfrmdiffer.actsaveas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
||
msgid "Save as..."
|
||
msgstr "Зберегти як..."
|
||
|
||
#: tfrmdiffer.actsaveleft.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
|
||
msgid "Save Left"
|
||
msgstr "Зберегти лівий"
|
||
|
||
#: tfrmdiffer.actsaveleft.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
||
msgid "Save Left"
|
||
msgstr "Зберегти лівий"
|
||
|
||
#: tfrmdiffer.actsaveleftas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
|
||
msgid "Save Left As..."
|
||
msgstr "Зберегти лівий як..."
|
||
|
||
#: tfrmdiffer.actsaveleftas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
||
msgid "Save Left As..."
|
||
msgstr "Зберегти лівий як..."
|
||
|
||
#: tfrmdiffer.actsaveright.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
|
||
msgid "Save Right"
|
||
msgstr "Зберегти правий"
|
||
|
||
#: tfrmdiffer.actsaveright.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
||
msgid "Save Right"
|
||
msgstr "Зберегти правий"
|
||
|
||
#: tfrmdiffer.actsaverightas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
|
||
msgid "Save Right As..."
|
||
msgstr "Зберегти правий як..."
|
||
|
||
#: tfrmdiffer.actsaverightas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
||
msgid "Save Right As..."
|
||
msgstr "Зберегти правий як..."
|
||
|
||
#: tfrmdiffer.actstartcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Порівняти"
|
||
|
||
#: tfrmdiffer.actstartcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
||
msgid "Compare"
|
||
msgstr "Порівняти"
|
||
|
||
#: tfrmdiffer.btnleftencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Кодування"
|
||
|
||
#: tfrmdiffer.btnrightencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Кодування"
|
||
|
||
#: tfrmdiffer.caption
|
||
msgctxt "TFRMDIFFER.CAPTION"
|
||
msgid "Compare files"
|
||
msgstr "Порівняти файли"
|
||
|
||
#: tfrmdiffer.midivider1.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider10.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider2.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider3.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider4.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider5.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider6.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider7.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider8.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider9.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miencodingleft.caption
|
||
msgid "&Left"
|
||
msgstr "З&ліва"
|
||
|
||
#: tfrmdiffer.miencodingright.caption
|
||
msgid "&Right"
|
||
msgstr "Сп&рава"
|
||
|
||
#: tfrmdiffer.miseparator1.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miseparator2.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.mnuactions.caption
|
||
msgid "&Actions"
|
||
msgstr "&Дії"
|
||
|
||
#: tfrmdiffer.mnuedit.caption
|
||
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Р&едагувати"
|
||
|
||
#: tfrmdiffer.mnuencoding.caption
|
||
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "&Кодування"
|
||
|
||
#: tfrmdiffer.mnufile.caption
|
||
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmdiffer.mnuoptions.caption
|
||
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
|
||
msgid "&Options"
|
||
msgstr "&Налаштування"
|
||
|
||
#: tfrmedithotkey.btnaddshortcut.hint
|
||
msgid "Add new shortcut to sequence"
|
||
msgstr "Додати новий ярлик в послідовність"
|
||
|
||
#: tfrmedithotkey.btncancel.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmedithotkey.btnok.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmedithotkey.btnremoveshortcut.hint
|
||
msgid "Remove last shortcut from sequence"
|
||
msgstr "Видалити останній ярлик з послідовності"
|
||
|
||
#: tfrmedithotkey.btnselectfromlist.hint
|
||
msgid "Select shortcut from list of remaining free available keys"
|
||
msgstr ""
|
||
|
||
#: tfrmedithotkey.cghkcontrols.caption
|
||
msgctxt "tfrmedithotkey.cghkcontrols.caption"
|
||
msgid "Only for these controls"
|
||
msgstr "Тільки для цих елементів керування"
|
||
|
||
#: tfrmedithotkey.lblparameters.caption
|
||
msgid "&Parameters (each in a separate line):"
|
||
msgstr "&Параметри (кожен в окремому рядку):"
|
||
|
||
#: tfrmedithotkey.lblshortcuts.caption
|
||
msgid "Shortcuts:"
|
||
msgstr "Ярлики:"
|
||
|
||
#: tfrmeditor.actabout.caption
|
||
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "Про програму..."
|
||
|
||
#: tfrmeditor.actabout.hint
|
||
msgctxt "tfrmeditor.actabout.hint"
|
||
msgid "About"
|
||
msgstr "Про програму..."
|
||
|
||
#: tfrmeditor.actconfhigh.caption
|
||
msgid "&Configuration"
|
||
msgstr "&Налаштування"
|
||
|
||
#: tfrmeditor.actconfhigh.hint
|
||
msgctxt "tfrmeditor.actconfhigh.hint"
|
||
msgid "Configuration"
|
||
msgstr "Конфігурація"
|
||
|
||
#: tfrmeditor.acteditcopy.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmeditor.acteditcopy.hint
|
||
msgctxt "tfrmeditor.acteditcopy.hint"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmeditor.acteditcut.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: tfrmeditor.acteditcut.hint
|
||
msgctxt "tfrmeditor.acteditcut.hint"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: tfrmeditor.acteditdelete.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmeditor.acteditdelete.hint
|
||
msgctxt "tfrmeditor.acteditdelete.hint"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmeditor.acteditfind.caption
|
||
#, fuzzy
|
||
#| msgid "&Find "
|
||
msgctxt "tfrmeditor.acteditfind.caption"
|
||
msgid "&Find"
|
||
msgstr "З&найти"
|
||
|
||
#: tfrmeditor.acteditfind.hint
|
||
msgctxt "tfrmeditor.acteditfind.hint"
|
||
msgid "Find"
|
||
msgstr "Знайти"
|
||
|
||
#: tfrmeditor.acteditfindnext.caption
|
||
msgctxt "tfrmeditor.acteditfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Знайти наступний"
|
||
|
||
#: tfrmeditor.acteditfindnext.hint
|
||
msgctxt "tfrmeditor.acteditfindnext.hint"
|
||
msgid "Find next"
|
||
msgstr "Знайти наступний"
|
||
|
||
#: tfrmeditor.acteditfindprevious.caption
|
||
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
||
msgid "Find previous"
|
||
msgstr ""
|
||
|
||
#: tfrmeditor.acteditgotoline.caption
|
||
msgctxt "tfrmeditor.acteditgotoline.caption"
|
||
msgid "Goto Line..."
|
||
msgstr "Перехід до рядка"
|
||
|
||
#: tfrmeditor.acteditlineendcr.caption
|
||
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcr.hint
|
||
msgctxt "tfrmeditor.acteditlineendcr.hint"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.hint
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.hint
|
||
msgctxt "tfrmeditor.acteditlineendlf.hint"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditpaste.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: tfrmeditor.acteditpaste.hint
|
||
msgctxt "tfrmeditor.acteditpaste.hint"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: tfrmeditor.acteditredo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Повторити"
|
||
|
||
#: tfrmeditor.acteditredo.hint
|
||
msgctxt "tfrmeditor.acteditredo.hint"
|
||
msgid "Redo"
|
||
msgstr "Повторити"
|
||
|
||
#: tfrmeditor.acteditrplc.caption
|
||
msgid "&Replace"
|
||
msgstr "&Замінити"
|
||
|
||
#: tfrmeditor.acteditrplc.hint
|
||
msgctxt "tfrmeditor.acteditrplc.hint"
|
||
msgid "Replace"
|
||
msgstr "Замінити"
|
||
|
||
#: tfrmeditor.acteditselectall.caption
|
||
msgid "Select&All"
|
||
msgstr "Виділити &все"
|
||
|
||
#: tfrmeditor.acteditselectall.hint
|
||
msgctxt "tfrmeditor.acteditselectall.hint"
|
||
msgid "Select All"
|
||
msgstr "Виділити &усе"
|
||
|
||
#: tfrmeditor.acteditundo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Вернути"
|
||
|
||
#: tfrmeditor.acteditundo.hint
|
||
msgctxt "tfrmeditor.acteditundo.hint"
|
||
msgid "Undo"
|
||
msgstr "Вернути"
|
||
|
||
#: tfrmeditor.actfileclose.caption
|
||
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmeditor.actfileclose.hint
|
||
msgctxt "tfrmeditor.actfileclose.hint"
|
||
msgid "Close"
|
||
msgstr "Закрити"
|
||
|
||
#: tfrmeditor.actfileexit.caption
|
||
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Ви&хід"
|
||
|
||
#: tfrmeditor.actfileexit.hint
|
||
msgctxt "tfrmeditor.actfileexit.hint"
|
||
msgid "Exit"
|
||
msgstr "Вихід"
|
||
|
||
#: tfrmeditor.actfilenew.caption
|
||
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
|
||
msgid "&New"
|
||
msgstr "&Створити"
|
||
|
||
#: tfrmeditor.actfilenew.hint
|
||
msgctxt "tfrmeditor.actfilenew.hint"
|
||
msgid "New"
|
||
msgstr "Створити"
|
||
|
||
#: tfrmeditor.actfileopen.caption
|
||
msgid "&Open"
|
||
msgstr "&Відкрити"
|
||
|
||
#: tfrmeditor.actfileopen.hint
|
||
msgctxt "tfrmeditor.actfileopen.hint"
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: tfrmeditor.actfilesave.caption
|
||
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Збере&гти"
|
||
|
||
#: tfrmeditor.actfilesave.hint
|
||
msgctxt "tfrmeditor.actfilesave.hint"
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: tfrmeditor.actfilesaveas.caption
|
||
#, fuzzy
|
||
#| msgid "Save &As.."
|
||
msgid "Save &As..."
|
||
msgstr "Зберегти &як.."
|
||
|
||
#: tfrmeditor.actfilesaveas.hint
|
||
msgid "Save As"
|
||
msgstr "Зберегти як"
|
||
|
||
#: tfrmeditor.actsaveall.caption
|
||
msgid "Sa&ve All"
|
||
msgstr "&Зберегти все"
|
||
|
||
#: tfrmeditor.actsaveall.hint
|
||
msgid "Save All"
|
||
msgstr "Зберегти все"
|
||
|
||
#: tfrmeditor.caption
|
||
msgctxt "tfrmeditor.caption"
|
||
msgid "Editor"
|
||
msgstr "Редактор"
|
||
|
||
#: tfrmeditor.help1.caption
|
||
msgctxt "TFRMEDITOR.HELP1.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Довід&ка"
|
||
|
||
#: tfrmeditor.menuitem1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmeditor.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.midiv.caption
|
||
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miedit.caption
|
||
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Редагувати"
|
||
|
||
#: tfrmeditor.miencoding.caption
|
||
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "&Кодування"
|
||
|
||
#: tfrmeditor.miencodingin.caption
|
||
msgid "Open as"
|
||
msgstr "Відкрити як"
|
||
|
||
#: tfrmeditor.miencodingout.caption
|
||
msgctxt "tfrmeditor.miencodingout.caption"
|
||
msgid "Save as"
|
||
msgstr "Зберегти як"
|
||
|
||
#: tfrmeditor.mifile.caption
|
||
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmeditor.mihighlight.caption
|
||
msgid "Syntax highlight"
|
||
msgstr "&Підсвітка синтаксису"
|
||
|
||
#: tfrmeditor.milineendtype.caption
|
||
msgid "End Of Line"
|
||
msgstr "Кінець рядка"
|
||
|
||
#: tfrmeditor.miseparator1.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miseparator2.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n1.caption
|
||
msgctxt "TFRMEDITOR.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n3.caption
|
||
msgctxt "TFRMEDITOR.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n4.caption
|
||
msgctxt "TFRMEDITOR.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n5.caption
|
||
msgctxt "TFRMEDITOR.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
|
||
msgid "C&ase sensitivity"
|
||
msgstr "&Чутливість до регістру"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
|
||
msgid "S&earch from caret"
|
||
msgstr "Шукати від &курсора"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
|
||
msgid "&Regular expressions"
|
||
msgstr "&Регулярні вирази"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
|
||
msgid "Selected &text only"
|
||
msgstr "Лише виділений &текст"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
|
||
msgid "&Whole words only"
|
||
msgstr "Лише слова &повністю"
|
||
|
||
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
|
||
msgid "Option"
|
||
msgstr "Опції"
|
||
|
||
#: tfrmeditsearchreplace.lblreplacewith.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
|
||
msgid "&Replace with:"
|
||
msgstr "&Замінити на:"
|
||
|
||
#: tfrmeditsearchreplace.lblsearchfor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
|
||
msgid "&Search for:"
|
||
msgstr "З&найти:"
|
||
|
||
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
|
||
msgid "Direction"
|
||
msgstr "Напрямок"
|
||
|
||
#: tfrmextractdlg.caption
|
||
msgctxt "TFRMEXTRACTDLG.CAPTION"
|
||
msgid "Unpack files"
|
||
msgstr "Розпакувати файли"
|
||
|
||
#: tfrmextractdlg.cbextractpath.caption
|
||
msgid "&Unpack path names if stored with files"
|
||
msgstr "Роз&пакувати шляхи якщо такі є з файлами"
|
||
|
||
#: tfrmextractdlg.cbfilemask.text
|
||
msgctxt "tfrmextractdlg.cbfilemask.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmextractdlg.cbinseparatefolder.caption
|
||
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
||
msgstr "Розпакувати кожен архів в &окремий каталог (з іменем архіву)"
|
||
|
||
#: tfrmextractdlg.cboverwrite.caption
|
||
msgid "O&verwrite existing files"
|
||
msgstr "&Замінювати існуючі файли"
|
||
|
||
#: tfrmextractdlg.lblextractto.caption
|
||
msgid "To the &directory:"
|
||
msgstr "В катало&г:"
|
||
|
||
#: tfrmextractdlg.lblfilemask.caption
|
||
msgid "&Extract files matching file mask:"
|
||
msgstr "Розпакувати файли по мас&ці:"
|
||
|
||
#: tfrmextractdlg.lblpassword.caption
|
||
msgid "&Password for encrypted files:"
|
||
msgstr "Пароль для за&шифрованих файлів:"
|
||
|
||
#: tfrmfileexecuteyourself.btnclose.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmfileexecuteyourself.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
|
||
msgid "Wait..."
|
||
msgstr "Почекайте..."
|
||
|
||
#: tfrmfileexecuteyourself.lblfilename.caption
|
||
msgid "File name:"
|
||
msgstr "Ім'я файлу:"
|
||
|
||
#: tfrmfileexecuteyourself.lblfrompath.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
|
||
msgid "From:"
|
||
msgstr "З"
|
||
|
||
#: tfrmfileexecuteyourself.lblprompt.caption
|
||
msgid "Click on Close when the temporary file can be deleted!"
|
||
msgstr "Натисніть \"Закрити\", коли тимчасовий файл може бути видалений!"
|
||
|
||
#: tfrmfileop.btncancel.caption
|
||
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmfileop.btnminimizetopanel.caption
|
||
msgid "&To panel"
|
||
msgstr "&На панель"
|
||
|
||
#: tfrmfileop.btnviewoperations.caption
|
||
msgid "&View all"
|
||
msgstr "Переглянути &все"
|
||
|
||
#: tfrmfileop.lblcurrentoperation.caption
|
||
msgid "Current operation:"
|
||
msgstr "Поточна операція:"
|
||
|
||
#: tfrmfileop.lblfrom.caption
|
||
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
||
msgid "From:"
|
||
msgstr "З"
|
||
|
||
#: tfrmfileop.lblto.caption
|
||
msgid "To:"
|
||
msgstr "В"
|
||
|
||
#: tfrmfileproperties.btnclose.caption
|
||
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmfileproperties.btnsetproperties.caption
|
||
msgid "&Set properties"
|
||
msgstr "В&становити властивості"
|
||
|
||
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
||
msgid "Set to &all selected files"
|
||
msgstr "Встановити для &всіх вибраних файлів"
|
||
|
||
#: tfrmfileproperties.btnskipfile.caption
|
||
msgid "Ski&p this file"
|
||
msgstr "&Пропустити цей файл"
|
||
|
||
#: tfrmfileproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Властивості"
|
||
|
||
#: tfrmfileproperties.cbsgid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmfileproperties.cbsticky.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Закріплювальний біт"
|
||
|
||
#: tfrmfileproperties.cbsuid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmfileproperties.gbowner.caption
|
||
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Власник"
|
||
|
||
#: tfrmfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Біти:"
|
||
|
||
#: tfrmfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: tfrmfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Інші"
|
||
|
||
#: tfrmfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Власник"
|
||
|
||
#: tfrmfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "У вигляді тексту:"
|
||
|
||
#: tfrmfileproperties.lblcontains.caption
|
||
msgctxt "tfrmfileproperties.lblcontains.caption"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblcontainsstr.caption
|
||
msgid "Contains:"
|
||
msgstr "Містить:"
|
||
|
||
#: tfrmfileproperties.lblexec.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Виконати"
|
||
|
||
#: tfrmfileproperties.lblfile.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ім'я файлу"
|
||
|
||
#: tfrmfileproperties.lblfilename.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfilestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ім'я файлу"
|
||
|
||
#: tfrmfileproperties.lblfolder.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfolderstr.caption
|
||
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
||
msgid "Path:"
|
||
msgstr "Шлях:"
|
||
|
||
#: tfrmfileproperties.lblgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
|
||
msgid "&Group"
|
||
msgstr "Гру&па"
|
||
|
||
#: tfrmfileproperties.lbllastaccess.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastaccessstr.caption
|
||
msgid "Last access:"
|
||
msgstr "Останній доступ:"
|
||
|
||
#: tfrmfileproperties.lbllastmodif.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastmodifstr.caption
|
||
msgid "Last modification:"
|
||
msgstr "Остання зміна:"
|
||
|
||
#: tfrmfileproperties.lbllaststchange.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllaststchangestr.caption
|
||
msgid "Last status change:"
|
||
msgstr "Остання зміна статусу:"
|
||
|
||
#: tfrmfileproperties.lbloctal.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Вісімковий"
|
||
|
||
#: tfrmfileproperties.lblownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
|
||
msgid "O&wner"
|
||
msgstr "Власни&к"
|
||
|
||
#: tfrmfileproperties.lblread.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Читання"
|
||
|
||
#: tfrmfileproperties.lblsize.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsizestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
|
||
msgid "Size:"
|
||
msgstr "Розмір:"
|
||
|
||
#: tfrmfileproperties.lblsymlink.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsymlinkstr.caption
|
||
msgid "Symlink to:"
|
||
msgstr "Симв. посилання для:"
|
||
|
||
#: tfrmfileproperties.lbltype.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbltypestr.caption
|
||
msgid "Type:"
|
||
msgstr "Тип:"
|
||
|
||
#: tfrmfileproperties.lblwrite.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Запис"
|
||
|
||
#: tfrmfileproperties.tsattributes.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Атрибути"
|
||
|
||
#: tfrmfileproperties.tsproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Властивості"
|
||
|
||
#: tfrmfinddlg.actcancel.caption
|
||
msgctxt "tfrmfinddlg.actcancel.caption"
|
||
msgid "C&ancel"
|
||
msgstr "Ск&асувати"
|
||
|
||
#: tfrmfinddlg.actcancelclose.caption
|
||
msgid "Cancel search and close window"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmfinddlg.actclose.caption
|
||
msgctxt "tfrmfinddlg.actclose.caption"
|
||
msgid "&Close"
|
||
msgstr "Закрити"
|
||
|
||
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
||
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actedit.caption
|
||
msgctxt "tfrmfinddlg.actedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Р&едагувати"
|
||
|
||
#: tfrmfinddlg.actfeedtolistbox.caption
|
||
msgid "Feed to &listbox"
|
||
msgstr "Фай&ли на панель"
|
||
|
||
#: tfrmfinddlg.actfreefrommem.caption
|
||
msgid "Cancel search, close and free from memory"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actfreefrommemallothers.caption
|
||
msgid "For all other \"Find files\", cancel, close and free from memory"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actgotofile.caption
|
||
msgid "&Go to file"
|
||
msgstr "Пере&йти до файлу"
|
||
|
||
#: tfrmfinddlg.actintellifocus.caption
|
||
msgctxt "tfrmfinddlg.actintellifocus.caption"
|
||
msgid "Find Data"
|
||
msgstr "Пошук даних з текстом"
|
||
|
||
#: tfrmfinddlg.actlastsearch.caption
|
||
msgid "&Last search"
|
||
msgstr "Останній пошу&к"
|
||
|
||
#: tfrmfinddlg.actnewsearch.caption
|
||
msgid "&New search"
|
||
msgstr "Н&овий пошук"
|
||
|
||
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
||
msgid "New search (clear filters)"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageadvanced.caption
|
||
msgid "Go to page \"Advanced\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageloadsave.caption
|
||
msgid "Go to page \"Load/Save\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageplugins.caption
|
||
msgid "Go to page \"Plugins\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageresults.caption
|
||
msgid "Go to page \"Results\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpagestandard.caption
|
||
msgid "Go to page \"Standard\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actstart.caption
|
||
msgctxt "tfrmfinddlg.actstart.caption"
|
||
msgid "&Start"
|
||
msgstr "&Старт"
|
||
|
||
#: tfrmfinddlg.actview.caption
|
||
msgctxt "tfrmfinddlg.actview.caption"
|
||
msgid "&View"
|
||
msgstr "&Перегляд"
|
||
|
||
#: tfrmfinddlg.btnaddattribute.caption
|
||
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Додати"
|
||
|
||
#: tfrmfinddlg.btnattrshelp.caption
|
||
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Довід&ка"
|
||
|
||
#: tfrmfinddlg.btnsavetemplate.caption
|
||
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Збере&гти"
|
||
|
||
#: tfrmfinddlg.btnsearchdelete.caption
|
||
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Ви&далити"
|
||
|
||
#: tfrmfinddlg.btnsearchload.caption
|
||
msgid "L&oad"
|
||
msgstr "Заван&тажити"
|
||
|
||
#: tfrmfinddlg.btnsearchsave.caption
|
||
msgid "S&ave"
|
||
msgstr "Збере&гти"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
||
msgid "Sa&ve with \"Start in directory\""
|
||
msgstr "З&берегти з \"Починати з каталога\""
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
||
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
||
msgstr "Якщо шлях запуску збережено, то його буде відновлено при завантаженні шаблону. Використовуйте його, якщо ви хочете виправити пошук в певному каталозі."
|
||
|
||
#: tfrmfinddlg.btnusetemplate.caption
|
||
msgid "Use template"
|
||
msgstr "Використати шаблон"
|
||
|
||
#: tfrmfinddlg.caption
|
||
msgctxt "tfrmfinddlg.caption"
|
||
msgid "Find files"
|
||
msgstr "Пошук файлів"
|
||
|
||
#: tfrmfinddlg.cbcasesens.caption
|
||
msgid "Case sens&itive"
|
||
msgstr "З врахуванням регістру"
|
||
|
||
#: tfrmfinddlg.cbdatefrom.caption
|
||
msgid "&Date from:"
|
||
msgstr "Дата в&ід:"
|
||
|
||
#: tfrmfinddlg.cbdateto.caption
|
||
msgid "Dat&e to:"
|
||
msgstr "Дата д&о:"
|
||
|
||
#: tfrmfinddlg.cbfilesizefrom.caption
|
||
msgid "S&ize from:"
|
||
msgstr "Розмір &від:"
|
||
|
||
#: tfrmfinddlg.cbfilesizeto.caption
|
||
msgid "Si&ze to:"
|
||
msgstr "Розмір &до:"
|
||
|
||
#: tfrmfinddlg.cbfindinarchive.caption
|
||
msgid "Search in &archives"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.cbfindtext.caption
|
||
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
|
||
msgid "Find &text in file"
|
||
msgstr "&Шукати текст у файлі"
|
||
|
||
#: tfrmfinddlg.cbfollowsymlinks.caption
|
||
msgctxt "tfrmfinddlg.cbfollowsymlinks.caption"
|
||
msgid "Follow s&ymlinks"
|
||
msgstr "Пере&йти за посиланнями"
|
||
|
||
#: tfrmfinddlg.cbnotcontainingtext.caption
|
||
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
|
||
msgid "Find files N&OT containing the text"
|
||
msgstr "Шукати файли, що &НЕ містять текст"
|
||
|
||
#: tfrmfinddlg.cbnotolderthan.caption
|
||
msgid "N&ot older than:"
|
||
msgstr "Н&е старші ніж:"
|
||
|
||
#: tfrmfinddlg.cbopenedtabs.caption
|
||
msgid "Opened tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.cbpartialnamesearch.caption
|
||
msgid "Searc&h for part of file name"
|
||
msgstr "Шукати по &частині імені файла"
|
||
|
||
#: tfrmfinddlg.cbregexp.caption
|
||
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
|
||
msgid "&Regular expression"
|
||
msgstr "&Регулярні вирази"
|
||
|
||
#: tfrmfinddlg.cbreplacetext.caption
|
||
msgid "Re&place by"
|
||
msgstr "За&мінити на"
|
||
|
||
#: tfrmfinddlg.cbselectedfiles.caption
|
||
msgid "Selected directories and &files"
|
||
msgstr "Вибрані &файли і каталоги"
|
||
|
||
#: tfrmfinddlg.cbtextregexp.caption
|
||
msgid "Regular &expression"
|
||
msgstr "Р&егулярний вираз"
|
||
|
||
#: tfrmfinddlg.cbtimefrom.caption
|
||
msgid "&Time from:"
|
||
msgstr "&Час від:"
|
||
|
||
#: tfrmfinddlg.cbtimeto.caption
|
||
msgid "Ti&me to:"
|
||
msgstr "Ча&с до:"
|
||
|
||
#: tfrmfinddlg.cbuseplugin.caption
|
||
msgid "&Use search plugin:"
|
||
msgstr "Використовувати пошуковий п&лагін"
|
||
|
||
#: tfrmfinddlg.cmbexcludedirectories.hint
|
||
msgid "Enter directories names that should be excluded from search separated with \";\""
|
||
msgstr "Введіть імена каталогів, які повинні бути виключені з пошуку, через \";\""
|
||
|
||
#: tfrmfinddlg.cmbexcludefiles.hint
|
||
msgid "Enter files names that should be excluded from search separated with \";\""
|
||
msgstr "Введіть імена файлів, які повинні бути виключені з пошуку, через \";\""
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.hint
|
||
msgid "Enter files names separated with \";\""
|
||
msgstr "Введіть імена файлів, через \";\""
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.text
|
||
msgctxt "TFRMFINDDLG.CMBFINDFILEMASK.TEXT"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmfinddlg.gbdirectories.caption
|
||
msgctxt "tfrmfinddlg.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Каталоги"
|
||
|
||
#: tfrmfinddlg.gbfiles.caption
|
||
msgctxt "tfrmfinddlg.gbfiles.caption"
|
||
msgid "Files"
|
||
msgstr "Файли"
|
||
|
||
#: tfrmfinddlg.gbfinddata.caption
|
||
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
||
msgid "Find Data"
|
||
msgstr "Пошук даних з текстом"
|
||
|
||
#: tfrmfinddlg.lblattributes.caption
|
||
msgid "Attri&butes"
|
||
msgstr "Атри&бути"
|
||
|
||
#: tfrmfinddlg.lblencoding.caption
|
||
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
|
||
msgid "Encodin&g:"
|
||
msgstr "Кодуванн&я:"
|
||
|
||
#: tfrmfinddlg.lblexcludedirectories.caption
|
||
msgid "E&xclude subdirectories"
|
||
msgstr "Пр&опустити підкаталоги"
|
||
|
||
#: tfrmfinddlg.lblexcludefiles.caption
|
||
msgid "&Exclude files"
|
||
msgstr "Проп&устити файли"
|
||
|
||
#: tfrmfinddlg.lblfindfilemask.caption
|
||
msgid "&File mask"
|
||
msgstr "По &масці файлу"
|
||
|
||
#: tfrmfinddlg.lblfindpathstart.caption
|
||
msgid "Start in &directory"
|
||
msgstr "Шукати в &каталозі:"
|
||
|
||
#: tfrmfinddlg.lblsearchdepth.caption
|
||
msgid "Search su&bdirectories:"
|
||
msgstr "Шукати в під&каталогах:"
|
||
|
||
#: tfrmfinddlg.lbltemplateheader.caption
|
||
msgid "&Previous searches:"
|
||
msgstr "&Попередні пошуки:"
|
||
|
||
#: tfrmfinddlg.miaction.caption
|
||
msgid "&Action"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.mifreefrommemallothers.caption
|
||
msgid "For all others, cancel, close and free from memory"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.miopeninnewtab.caption
|
||
msgid "Open In New Tab(s)"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.mioptions.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfinddlg.mioptions.caption"
|
||
msgid "Options"
|
||
msgstr "Налаштування"
|
||
|
||
#: tfrmfinddlg.miremovefromllist.caption
|
||
msgid "Remove from list"
|
||
msgstr "Видалити зі списку"
|
||
|
||
#: tfrmfinddlg.miresult.caption
|
||
msgid "&Result"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.miseparator1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfinddlg.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.miseparator2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfinddlg.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.mishowallfound.caption
|
||
msgid "Show all found items"
|
||
msgstr "Показати все знайдене"
|
||
|
||
#: tfrmfinddlg.mishowineditor.caption
|
||
msgid "Show In Editor"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.mishowinviewer.caption
|
||
msgid "Show In Viewer"
|
||
msgstr "Перегляд"
|
||
|
||
#: tfrmfinddlg.miviewtab.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfinddlg.miviewtab.caption"
|
||
msgid "&View"
|
||
msgstr "&Перегляд"
|
||
|
||
#: tfrmfinddlg.tsadvanced.caption
|
||
msgid "Advanced"
|
||
msgstr "Розширені"
|
||
|
||
#: tfrmfinddlg.tsloadsave.caption
|
||
msgid "Load/Save"
|
||
msgstr "Завантажити/Зберегти"
|
||
|
||
#: tfrmfinddlg.tsplugins.caption
|
||
msgctxt "tfrmfinddlg.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Плагіни"
|
||
|
||
#: tfrmfinddlg.tsresults.caption
|
||
msgid "Results"
|
||
msgstr "Результати"
|
||
|
||
#: tfrmfinddlg.tsstandard.caption
|
||
msgid "Standard"
|
||
msgstr "Стандартні"
|
||
|
||
#: tfrmfindview.btnclose.caption
|
||
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmfindview.btnfind.caption
|
||
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
||
msgid "&Find"
|
||
msgstr "&Знайти"
|
||
|
||
#: tfrmfindview.caption
|
||
msgctxt "TFRMFINDVIEW.CAPTION"
|
||
msgid "Find"
|
||
msgstr "Знайти"
|
||
|
||
#: tfrmfindview.cbcasesens.caption
|
||
msgid "C&ase sensitive"
|
||
msgstr "З урахуванням рег&істру"
|
||
|
||
#: tfrmhardlink.btncancel.caption
|
||
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmhardlink.btnok.caption
|
||
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmhardlink.caption
|
||
msgid "Create hard link"
|
||
msgstr "Створити жорстке посилання"
|
||
|
||
#: tfrmhardlink.lblexistingfile.caption
|
||
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "О&б’єкт на який вказуватиме посилання"
|
||
|
||
#: tfrmhardlink.lbllinktocreate.caption
|
||
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "Ім'я п&осилання"
|
||
|
||
#: tfrmhotdirexportimport.btnselectall.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
|
||
msgid "Import all!"
|
||
msgstr "Імпортувати все!"
|
||
|
||
#: tfrmhotdirexportimport.btnselectiondone.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
|
||
msgid "Import selected"
|
||
msgstr "Імпортувати виділене"
|
||
|
||
#: tfrmhotdirexportimport.caption
|
||
msgctxt "tfrmhotdirexportimport.caption"
|
||
msgid "Select the entries your want to import"
|
||
msgstr "Виділіть елементи для імпотру"
|
||
|
||
#: tfrmhotdirexportimport.lbhint.caption
|
||
msgctxt "tfrmhotdirexportimport.lbhint.caption"
|
||
msgid "When clicking a sub-menu, it will select the whole menu"
|
||
msgstr "При клацанні на підменю, буде обрано все меню"
|
||
|
||
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
||
msgid "Hold CTRL and click entries to select multiple ones"
|
||
msgstr "При утриманні CTRL можна вибирати кілька елементів"
|
||
|
||
#: tfrmlinker.btnsave.caption
|
||
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmlinker.caption
|
||
msgctxt "TFRMLINKER.CAPTION"
|
||
msgid "Linker"
|
||
msgstr "Компонувальник"
|
||
|
||
#: tfrmlinker.gbsaveto.caption
|
||
msgid "Save to..."
|
||
msgstr "Зберегти до..."
|
||
|
||
#: tfrmlinker.grbxcontrol.caption
|
||
msgid "Item"
|
||
msgstr "Елемент"
|
||
|
||
#: tfrmlinker.lblfilename.caption
|
||
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
|
||
msgid "&File name"
|
||
msgstr "Ім'&я файлу"
|
||
|
||
#: tfrmlinker.spbtndown.caption
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
|
||
msgid "Do&wn"
|
||
msgstr "В&низ"
|
||
|
||
#: tfrmlinker.spbtndown.hint
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
|
||
msgid "Down"
|
||
msgstr "Вниз"
|
||
|
||
#: tfrmlinker.spbtnrem.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmlinker.spbtnrem.caption"
|
||
msgid "&Remove"
|
||
msgstr "Вид&алити"
|
||
|
||
#: tfrmlinker.spbtnrem.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmlinker.spbtnrem.hint"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmlinker.spbtnup.caption
|
||
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
|
||
msgid "&Up"
|
||
msgstr "Вгор&у"
|
||
|
||
#: tfrmlinker.spbtnup.hint
|
||
msgctxt "TFRMLINKER.SPBTNUP.HINT"
|
||
msgid "Up"
|
||
msgstr "Вгору"
|
||
|
||
#: tfrmmain.actabout.caption
|
||
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
|
||
msgid "&About"
|
||
msgstr "Пр&о програму"
|
||
|
||
#: tfrmmain.actaddfilenametocmdline.caption
|
||
msgid "Add file name to command line"
|
||
msgstr "Додати ім'я файлу в командний рядок"
|
||
|
||
#: tfrmmain.actaddnewsearch.caption
|
||
msgid "New search instance..."
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
||
msgid "Add path and file name to command line"
|
||
msgstr "Додати шлях і ім'я файлу в командний рядок"
|
||
|
||
#: tfrmmain.actaddpathtocmdline.caption
|
||
msgid "Copy path to command line"
|
||
msgstr "Копіювати шлях в командний рядок"
|
||
|
||
#: tfrmmain.actbriefview.caption
|
||
#, fuzzy
|
||
#| msgid "Brief"
|
||
msgctxt "tfrmmain.actbriefview.caption"
|
||
msgid "Brief view"
|
||
msgstr "Короткий"
|
||
|
||
#: tfrmmain.actbriefview.hint
|
||
msgid "Brief View"
|
||
msgstr "Cтислий вигляд"
|
||
|
||
#: tfrmmain.actcalculatespace.caption
|
||
msgid "Calculate &Occupied Space"
|
||
msgstr "Розрахувати зайнятий об'&єм"
|
||
|
||
#: tfrmmain.actchangedir.caption
|
||
msgid "Change directory"
|
||
msgstr "Змінити каталог"
|
||
|
||
#: tfrmmain.actchangedirtohome.caption
|
||
msgid "Change directory to home"
|
||
msgstr "Перейти в домашній каталог"
|
||
|
||
#: tfrmmain.actchangedirtoparent.caption
|
||
msgid "Change Directory To Parent"
|
||
msgstr "Перейти в батьківський каталог"
|
||
|
||
#: tfrmmain.actchangedirtoroot.caption
|
||
msgid "Change directory to root"
|
||
msgstr "Перейти в кореневий каталог"
|
||
|
||
#: tfrmmain.actchecksumcalc.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
|
||
msgid "Calculate Check&sum..."
|
||
msgstr "&Розрахувати контрольну суму..."
|
||
|
||
#: tfrmmain.actchecksumverify.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
|
||
msgid "&Verify Checksum..."
|
||
msgstr "Перевірити контрол&ьну суму..."
|
||
|
||
#: tfrmmain.actclearlogfile.caption
|
||
msgid "Clear log file"
|
||
msgstr "Очистити файл звіту"
|
||
|
||
#: tfrmmain.actclearlogwindow.caption
|
||
msgid "Clear log window"
|
||
msgstr "Очистити вікно звіту"
|
||
|
||
#: tfrmmain.actclosealltabs.caption
|
||
msgctxt "tfrmmain.actclosealltabs.caption"
|
||
msgid "Close &All Tabs"
|
||
msgstr "За&акрити всі вкладки"
|
||
|
||
#: tfrmmain.actcloseduplicatetabs.caption
|
||
msgid "Close Duplicate Tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actclosetab.caption
|
||
msgctxt "tfrmmain.actclosetab.caption"
|
||
msgid "&Close Tab"
|
||
msgstr "&Закрити вкладку"
|
||
|
||
#: tfrmmain.actcmdlinenext.caption
|
||
msgid "Next Command Line"
|
||
msgstr "Наступний командний рядок"
|
||
|
||
#: tfrmmain.actcmdlinenext.hint
|
||
msgid "Set command line to next command in history"
|
||
msgstr "Встановіть командному рядку наступну команду з історії"
|
||
|
||
#: tfrmmain.actcmdlineprev.caption
|
||
msgid "Previous Command Line"
|
||
msgstr "Попередній командний рядок"
|
||
|
||
#: tfrmmain.actcmdlineprev.hint
|
||
msgid "Set command line to previous command in history"
|
||
msgstr "Встановіть командному рядку попередню команду з історії"
|
||
|
||
#: tfrmmain.actcolumnsview.caption
|
||
msgid "Full"
|
||
msgstr "Повний"
|
||
|
||
#: tfrmmain.actcolumnsview.hint
|
||
msgid "Columns View"
|
||
msgstr "Набір колонок"
|
||
|
||
#: tfrmmain.actcomparecontents.caption
|
||
msgid "Compare by &Contents"
|
||
msgstr "Порівняти за &вмістом"
|
||
|
||
#: tfrmmain.actcomparedirectories.caption
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
|
||
msgid "Compare Directories"
|
||
msgstr "Порівняти файли у каталогах"
|
||
|
||
#: tfrmmain.actcomparedirectories.hint
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
||
msgid "Compare Directories"
|
||
msgstr "Порівняти файли у каталогах"
|
||
|
||
#: tfrmmain.actconfigdirhotlist.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Налаштування обраних каталогів"
|
||
|
||
#: tfrmmain.actconfigfavoritetabs.caption
|
||
msgid "Configuration of Favorite Tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigfoldertabs.caption
|
||
msgid "Configuration of folder tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfighotkeys.caption
|
||
msgctxt "tfrmmain.actconfighotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigsavesettings.caption
|
||
msgid "Save Settings"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigsearches.caption
|
||
msgid "Configuration of searches"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigtoolbars.caption
|
||
msgid "Toolbar..."
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigtreeviewmenus.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcontextmenu.caption
|
||
msgid "Show context menu"
|
||
msgstr "Показати контекстне меню"
|
||
|
||
#: tfrmmain.actcopy.caption
|
||
msgctxt "tfrmmain.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmmain.actcopyalltabstoopposite.caption
|
||
msgid "Copy all tabs to opposite side"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcopyfiledetailstoclip.caption
|
||
msgid "Copy all shown &columns"
|
||
msgstr "Копіювати в&сі показані колонки"
|
||
|
||
#: tfrmmain.actcopyfullnamestoclip.caption
|
||
msgid "Copy Filename(s) with Full &Path"
|
||
msgstr "Копіювати ім'я файла(ів) разом з повним шля&хом"
|
||
|
||
#: tfrmmain.actcopynamestoclip.caption
|
||
msgid "Copy &Filename(s) to Clipboard"
|
||
msgstr "Копіювати ім'я файла(ів) в &буфер"
|
||
|
||
#: tfrmmain.actcopynoask.caption
|
||
msgid "Copy files without asking for confirmation"
|
||
msgstr "Копіювати файли без запиту підтвердження"
|
||
|
||
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcopypathoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s)"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcopysamepanel.caption
|
||
msgid "Copy to same panel"
|
||
msgstr "Копіювати в ту ж панель"
|
||
|
||
#: tfrmmain.actcopytoclipboard.caption
|
||
msgid "&Copy"
|
||
msgstr "&Копіювати"
|
||
|
||
#: tfrmmain.actcountdircontent.caption
|
||
msgid "Sho&w Occupied Space"
|
||
msgstr "&Показати зайнятий простір"
|
||
|
||
#: tfrmmain.actcuttoclipboard.caption
|
||
msgid "Cu&t"
|
||
msgstr "Ви&різати"
|
||
|
||
#: tfrmmain.actdebugshowcommandparameters.caption
|
||
msgid "Show Command Parameters"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actdelete.caption
|
||
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmmain.actdeletesearches.caption
|
||
msgid "For all searches, cancel, close and free memory"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actdirhistory.caption
|
||
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
|
||
msgid "Directory history"
|
||
msgstr "Історія каталогів"
|
||
|
||
#: tfrmmain.actdirhotlist.caption
|
||
msgid "Directory &Hotlist"
|
||
msgstr "Особистий спис&ок каталогів"
|
||
|
||
#: tfrmmain.actdoanycmcommand.caption
|
||
msgid "Select any command and execute it"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actedit.caption
|
||
msgctxt "tfrmmain.actedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: tfrmmain.acteditcomment.caption
|
||
msgid "Edit Co&mment..."
|
||
msgstr "Редагувати &коментар..."
|
||
|
||
#: tfrmmain.acteditnew.caption
|
||
msgid "Edit new file"
|
||
msgstr "Редагувати новий файл"
|
||
|
||
#: tfrmmain.acteditpath.caption
|
||
msgid "Edit path field above file list"
|
||
msgstr "Редагувати шлях в заголовку списку"
|
||
|
||
#: tfrmmain.actexchange.caption
|
||
msgid "Swap &Panels"
|
||
msgstr "Поміняти панелі місцями"
|
||
|
||
#: tfrmmain.actexecutescript.caption
|
||
msgid "Execute Script"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actexit.caption
|
||
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Ви&хід"
|
||
|
||
#: tfrmmain.actextractfiles.caption
|
||
msgid "&Extract Files..."
|
||
msgstr "Розпак&увати файли..."
|
||
|
||
#: tfrmmain.actfileassoc.caption
|
||
#, fuzzy
|
||
#| msgid "File &Associations..."
|
||
msgid "Configuration of File &Associations"
|
||
msgstr "Асоціаці&ї з файлами..."
|
||
|
||
#: tfrmmain.actfilelinker.caption
|
||
msgid "Com&bine Files..."
|
||
msgstr "Ск&леїти файли..."
|
||
|
||
#: tfrmmain.actfileproperties.caption
|
||
msgid "Show &File Properties"
|
||
msgstr "Властивост&і файлу"
|
||
|
||
#: tfrmmain.actfilespliter.caption
|
||
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
|
||
msgid "Spl&it File..."
|
||
msgstr "Ро&зрізати файл..."
|
||
|
||
#: tfrmmain.actflatview.caption
|
||
msgid "&Flat view"
|
||
msgstr "Плоский вигл&яд"
|
||
|
||
#: tfrmmain.actfocuscmdline.caption
|
||
msgid "Focus command line"
|
||
msgstr "Перейти в командний рядок"
|
||
|
||
#: tfrmmain.actgotofirstfile.caption
|
||
msgid "Place cursor on first file in list"
|
||
msgstr "Помістити курсор на перший у списку файл"
|
||
|
||
#: tfrmmain.actgotolastfile.caption
|
||
msgid "Place cursor on last file in list"
|
||
msgstr "Помістити курсор на останній у списку файл"
|
||
|
||
#: tfrmmain.acthardlink.caption
|
||
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
|
||
msgid "Create &Hard Link..."
|
||
msgstr "Створити &жорстке посилання..."
|
||
|
||
#: tfrmmain.acthelpindex.caption
|
||
msgid "&Contents"
|
||
msgstr "&Довідка"
|
||
|
||
#: tfrmmain.acthorizontalfilepanels.caption
|
||
msgid "&Horizontal Panels Mode"
|
||
msgstr "&Горизонтальне розміщення панелей"
|
||
|
||
#: tfrmmain.actkeyboard.caption
|
||
msgid "&Keyboard"
|
||
msgstr "Гарячі &клавіші"
|
||
|
||
#: tfrmmain.actleftbriefview.caption
|
||
msgid "Brief view on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftcolumnsview.caption
|
||
msgid "Columns view on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftequalright.caption
|
||
msgid "Left &= Right"
|
||
msgstr "Ліва &= Права"
|
||
|
||
#: tfrmmain.actleftflatview.caption
|
||
msgid "&Flat view on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftopendrives.caption
|
||
msgid "Open left drive list"
|
||
msgstr "Відкрити список дисків зліва"
|
||
|
||
#: tfrmmain.actleftreverseorder.caption
|
||
msgid "Re&verse order on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbyattr.caption
|
||
msgid "Sort left panel by &Attributes"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbydate.caption
|
||
msgid "Sort left panel by &Date"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbyext.caption
|
||
msgid "Sort left panel by &Extension"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbyname.caption
|
||
msgid "Sort left panel by &Name"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbysize.caption
|
||
msgid "Sort left panel by &Size"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftthumbview.caption
|
||
msgid "Thumbnails view on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actloadfavoritetabs.caption
|
||
msgid "Load tabs from Favorite Tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actloadselectionfromclip.caption
|
||
msgid "Load Selection from Clip&board"
|
||
msgstr "Завантажити виділенння з б&уферу"
|
||
|
||
#: tfrmmain.actloadselectionfromfile.caption
|
||
msgid "&Load Selection from File..."
|
||
msgstr "Завантажити виділенння з ф&айлу..."
|
||
|
||
#: tfrmmain.actloadtabs.caption
|
||
msgid "&Load Tabs from File"
|
||
msgstr "Завантажити вкладки &з файлу"
|
||
|
||
#: tfrmmain.actmakedir.caption
|
||
msgid "Create &Directory"
|
||
msgstr "Створити ката&лог"
|
||
|
||
#: tfrmmain.actmarkcurrentextension.caption
|
||
msgid "Select All with the Same E&xtension"
|
||
msgstr "Виділити всі з такими ж роз&ширеннями"
|
||
|
||
#: tfrmmain.actmarkcurrentname.caption
|
||
msgid "Select all files with same name"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actmarkcurrentnameext.caption
|
||
msgid "Select all files with same name and extension"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actmarkcurrentpath.caption
|
||
msgid "Select all in same path"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actmarkinvert.caption
|
||
msgid "&Invert Selection"
|
||
msgstr "&Інверсія виділення"
|
||
|
||
#: tfrmmain.actmarkmarkall.caption
|
||
msgid "&Select All"
|
||
msgstr "&Виділити все"
|
||
|
||
#: tfrmmain.actmarkminus.caption
|
||
msgid "Unselect a Gro&up..."
|
||
msgstr "Зняти виділення з г&рупи..."
|
||
|
||
#: tfrmmain.actmarkplus.caption
|
||
msgid "Select a &Group..."
|
||
msgstr "Виділити &групу..."
|
||
|
||
#: tfrmmain.actmarkunmarkall.caption
|
||
msgid "&Unselect All"
|
||
msgstr "Зняти виділення з у&сіх"
|
||
|
||
#: tfrmmain.actminimize.caption
|
||
msgid "Minimize window"
|
||
msgstr "Згорнути"
|
||
|
||
#: tfrmmain.actmultirename.caption
|
||
msgid "Multi &Rename Tool"
|
||
msgstr "&Мультиперейменування"
|
||
|
||
#: tfrmmain.actnetworkconnect.caption
|
||
msgid "Network &Connect..."
|
||
msgstr "З'&єднання з мережею..."
|
||
|
||
#: tfrmmain.actnetworkdisconnect.caption
|
||
msgid "Network &Disconnect"
|
||
msgstr "Розірвати з'є&днання"
|
||
|
||
#: tfrmmain.actnetworkquickconnect.caption
|
||
msgid "Network &Quick Connect..."
|
||
msgstr "Н&ове з'єднання..."
|
||
|
||
#: tfrmmain.actnewtab.caption
|
||
msgid "&New Tab"
|
||
msgstr "Н&ова вкладка"
|
||
|
||
#: tfrmmain.actnextfavoritetabs.caption
|
||
msgid "Load the Next Favorite Tabs in the list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actnexttab.caption
|
||
msgid "Switch to Nex&t Tab"
|
||
msgstr "Перейти до нас&тупної вкладки"
|
||
|
||
#: tfrmmain.actopen.caption
|
||
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: tfrmmain.actopenarchive.caption
|
||
msgid "Try open archive"
|
||
msgstr "Спробувати відкрити архів"
|
||
|
||
#: tfrmmain.actopenbar.caption
|
||
msgid "Open bar file"
|
||
msgstr "Відкрити bar файл"
|
||
|
||
#: tfrmmain.actopendirinnewtab.caption
|
||
msgid "Open &Folder in a New Tab"
|
||
msgstr "Відкрити теку у новій вклад&ці"
|
||
|
||
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
||
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
|
||
msgid "Open &VFS List"
|
||
msgstr "Відкрити сп&исок VFS"
|
||
|
||
#: tfrmmain.actoperationsviewer.caption
|
||
msgid "Operations &Viewer"
|
||
msgstr "Показати операції з &файлами"
|
||
|
||
#: tfrmmain.actoptions.caption
|
||
msgid "&Options..."
|
||
msgstr "&Основні..."
|
||
|
||
#: tfrmmain.actpackfiles.caption
|
||
msgid "&Pack Files..."
|
||
msgstr "У&пакувати файли..."
|
||
|
||
#: tfrmmain.actpanelssplitterperpos.caption
|
||
msgid "Set splitter position"
|
||
msgstr "Встановити позицію роздільника"
|
||
|
||
#: tfrmmain.actpastefromclipboard.caption
|
||
msgid "&Paste"
|
||
msgstr "&Вставити"
|
||
|
||
#: tfrmmain.actpreviousfavoritetabs.caption
|
||
msgid "Load the Previous Favorite Tabs in the list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actprevtab.caption
|
||
msgid "Switch to &Previous Tab"
|
||
msgstr "Перейти до &попередньої вкладки"
|
||
|
||
#: tfrmmain.actquickfilter.caption
|
||
msgid "Quick filter"
|
||
msgstr "Швидкий фільтр"
|
||
|
||
#: tfrmmain.actquicksearch.caption
|
||
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
|
||
msgid "Quick search"
|
||
msgstr "Швидкий пошук"
|
||
|
||
#: tfrmmain.actquickview.caption
|
||
msgid "&Quick View Panel"
|
||
msgstr "&Панель швидкого перегляду"
|
||
|
||
#: tfrmmain.actrefresh.caption
|
||
msgid "&Refresh"
|
||
msgstr "&Оновити"
|
||
|
||
#: tfrmmain.actreloadfavoritetabs.caption
|
||
msgid "Reload the last Favorite Tabs loaded"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrename.caption
|
||
msgctxt "tfrmmain.actrename.caption"
|
||
msgid "Move"
|
||
msgstr "Перемістити"
|
||
|
||
#: tfrmmain.actrenamenoask.caption
|
||
msgid "Move/Rename files without asking for confirmation"
|
||
msgstr "Перемістити/Перейменувати файли без запиту підтвердження"
|
||
|
||
#: tfrmmain.actrenameonly.caption
|
||
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Перейменувати"
|
||
|
||
#: tfrmmain.actrenametab.caption
|
||
msgid "&Rename Tab"
|
||
msgstr "Перей&менувати вкладку"
|
||
|
||
#: tfrmmain.actresavefavoritetabs.caption
|
||
msgid "Resave on the last Favorite Tabs loaded"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrestoreselection.caption
|
||
msgid "&Restore Selection"
|
||
msgstr "Ві&дновити виділення"
|
||
|
||
#: tfrmmain.actreverseorder.caption
|
||
msgid "Re&verse Order"
|
||
msgstr "О&бернений порядок"
|
||
|
||
#: tfrmmain.actrightbriefview.caption
|
||
msgid "Brief view on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightcolumnsview.caption
|
||
msgid "Columns view on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightequalleft.caption
|
||
msgid "Right &= Left"
|
||
msgstr "Права &= Ліва"
|
||
|
||
#: tfrmmain.actrightflatview.caption
|
||
msgid "&Flat view on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightopendrives.caption
|
||
msgid "Open right drive list"
|
||
msgstr "Відкрити список дисків справа"
|
||
|
||
#: tfrmmain.actrightreverseorder.caption
|
||
msgid "Re&verse order on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbyattr.caption
|
||
msgid "Sort right panel by &Attributes"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbydate.caption
|
||
msgid "Sort right panel by &Date"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbyext.caption
|
||
msgid "Sort right panel by &Extension"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbyname.caption
|
||
msgid "Sort right panel by &Name"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbysize.caption
|
||
msgid "Sort right panel by &Size"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightthumbview.caption
|
||
msgid "Thumbnails view on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrunterm.caption
|
||
msgid "Run &Terminal"
|
||
msgstr "Запуск &терміналу"
|
||
|
||
#: tfrmmain.actsavefavoritetabs.caption
|
||
msgid "Save current tabs to a New Favorite Tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsaveselection.caption
|
||
msgid "Sa&ve Selection"
|
||
msgstr "&Зберегти виділенння"
|
||
|
||
#: tfrmmain.actsaveselectiontofile.caption
|
||
msgid "Save S&election to File..."
|
||
msgstr "Зберегти виділення у фай&л..."
|
||
|
||
#: tfrmmain.actsavetabs.caption
|
||
msgid "&Save Tabs to File"
|
||
msgstr "Зберегти вкладки &до файлу"
|
||
|
||
#: tfrmmain.actsearch.caption
|
||
msgid "&Search..."
|
||
msgstr "По&шук..."
|
||
|
||
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
||
msgid "All tabs Locked with Dir Opened in New Tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsetalltabsoptionnormal.caption
|
||
msgid "Set all tabs to Normal"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
||
msgid "Set all tabs to Locked"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
||
msgid "All tabs Locked with Dir Changes Allowed"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsetfileproperties.caption
|
||
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change &Attributes..."
|
||
msgstr "Змінити &атрибути..."
|
||
|
||
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
||
msgid "Locked with Directories Opened in New &Tabs"
|
||
msgstr "Забло&кувати і відкривати каталоги у нових вкладках"
|
||
|
||
#: tfrmmain.actsettaboptionnormal.caption
|
||
msgid "&Normal"
|
||
msgstr "Звичай&но"
|
||
|
||
#: tfrmmain.actsettaboptionpathlocked.caption
|
||
msgid "&Locked"
|
||
msgstr "Заб&локувати"
|
||
|
||
#: tfrmmain.actsettaboptionpathresets.caption
|
||
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
|
||
msgid "Locked with &Directory Changes Allowed"
|
||
msgstr "Заблоку&вати, але дозволити зміну каталогу"
|
||
|
||
#: tfrmmain.actshellexecute.caption
|
||
msgctxt "tfrmmain.actshellexecute.caption"
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: tfrmmain.actshellexecute.hint
|
||
msgid "Open using system associations"
|
||
msgstr "Відкрийте за допомогою системи асоціацій"
|
||
|
||
#: tfrmmain.actshowbuttonmenu.caption
|
||
msgid "Show button menu"
|
||
msgstr "Показати меню кнопки"
|
||
|
||
#: tfrmmain.actshowcmdlinehistory.caption
|
||
msgid "Show command line history"
|
||
msgstr "Історія командного рядка"
|
||
|
||
#: tfrmmain.actshowmainmenu.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
|
||
msgid "Menu"
|
||
msgstr "Меню"
|
||
|
||
#: tfrmmain.actshowsysfiles.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
|
||
msgid "Show &Hidden/System Files"
|
||
msgstr "Показувати при&ховані/системні файли"
|
||
|
||
#: tfrmmain.actsortbyattr.caption
|
||
msgid "Sort by &Attributes"
|
||
msgstr "Сортувати за &атрибутами"
|
||
|
||
#: tfrmmain.actsortbydate.caption
|
||
msgid "Sort by &Date"
|
||
msgstr "Сортувати за &датою"
|
||
|
||
#: tfrmmain.actsortbyext.caption
|
||
msgid "Sort by &Extension"
|
||
msgstr "Сортувати за роз&ширенням"
|
||
|
||
#: tfrmmain.actsortbyname.caption
|
||
msgid "Sort by &Name"
|
||
msgstr "Сортувати за &ім’ям"
|
||
|
||
#: tfrmmain.actsortbysize.caption
|
||
msgid "Sort by &Size"
|
||
msgstr "Сортувати за роз&міром"
|
||
|
||
#: tfrmmain.actsrcopendrives.caption
|
||
msgid "Open drive list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actswitchignorelist.caption
|
||
msgid "Enable/disable ignore list file to not show file names"
|
||
msgstr "Включити/виключити чорний список файлів, щоб не показувати імена файлів"
|
||
|
||
#: tfrmmain.actsymlink.caption
|
||
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
|
||
msgid "Create Symbolic &Link..."
|
||
msgstr "Створити &символічне посилання..."
|
||
|
||
#: tfrmmain.actsyncdirs.caption
|
||
msgid "Synchronize dirs..."
|
||
msgstr "Синхронізація тек..."
|
||
|
||
#: tfrmmain.acttargetequalsource.caption
|
||
msgid "Target &= Source"
|
||
msgstr "Ціль &= Джерелу"
|
||
|
||
#: tfrmmain.acttestarchive.caption
|
||
msgid "&Test Archive(s)"
|
||
msgstr "Перевіри&ти архів(и)"
|
||
|
||
#: tfrmmain.actthumbnailsview.caption
|
||
msgctxt "tfrmmain.actthumbnailsview.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Мініатюри"
|
||
|
||
#: tfrmmain.actthumbnailsview.hint
|
||
msgid "Thumbnails View"
|
||
msgstr "Перегляд мініатюр"
|
||
|
||
#: tfrmmain.acttogglefullscreenconsole.caption
|
||
msgid "Toggle fullscreen mode console"
|
||
msgstr "Перейти до повноекранного режиму консолі"
|
||
|
||
#: tfrmmain.acttransferleft.caption
|
||
msgid "Transfer dir under cursor to left window"
|
||
msgstr "Відкрити каталог під курсором на лівій панелі"
|
||
|
||
#: tfrmmain.acttransferright.caption
|
||
msgid "Transfer dir under cursor to right window"
|
||
msgstr "Відкрити каталог під курсором на правій панелі"
|
||
|
||
#: tfrmmain.acttreeview.caption
|
||
msgid "&Tree View Panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actuniversalsingledirectsort.caption
|
||
msgid "Sort according to parameters"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actunmarkcurrentextension.caption
|
||
msgid "Unselect All with the Same Ex&tension"
|
||
msgstr "Зняти виділення з усіх з таким &же розширенням"
|
||
|
||
#: tfrmmain.actunmarkcurrentname.caption
|
||
msgid "Unselect all files with same name"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actunmarkcurrentnameext.caption
|
||
msgid "Unselect all files with same name and extension"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actunmarkcurrentpath.caption
|
||
msgid "Unselect all in same path"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actview.caption
|
||
msgctxt "tfrmmain.actview.caption"
|
||
msgid "View"
|
||
msgstr "Перегляд"
|
||
|
||
#: tfrmmain.actviewhistory.caption
|
||
msgid "Show history of visited paths for active view"
|
||
msgstr "Показати історію відвіданих шляхів для активної панелі"
|
||
|
||
#: tfrmmain.actviewhistorynext.caption
|
||
msgid "Go to next entry in history"
|
||
msgstr "Перейти до наступного запису в історії"
|
||
|
||
#: tfrmmain.actviewhistoryprev.caption
|
||
msgid "Go to previous entry in history"
|
||
msgstr "Перейти до попереднього запису в історії"
|
||
|
||
#: tfrmmain.actviewlogfile.caption
|
||
msgid "View log file"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actviewsearches.caption
|
||
msgid "View current search instances"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actvisithomepage.caption
|
||
msgid "&Visit Double Commander Website"
|
||
msgstr "Відвідати домашн&ю сторінку Double Commander"
|
||
|
||
#: tfrmmain.actwipe.caption
|
||
msgid "Wipe"
|
||
msgstr "Очистити"
|
||
|
||
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
||
msgid "Work with Directory Hotlist and parameters"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.btnf10.caption
|
||
msgctxt "tfrmmain.btnf10.caption"
|
||
msgid "Exit"
|
||
msgstr "Вихід"
|
||
|
||
#: tfrmmain.btnf7.caption
|
||
msgctxt "tfrmmain.btnf7.caption"
|
||
msgid "Directory"
|
||
msgstr "Каталог"
|
||
|
||
#: tfrmmain.btnf8.caption
|
||
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmmain.btnf9.caption
|
||
msgctxt "tfrmmain.btnf9.caption"
|
||
msgid "Terminal"
|
||
msgstr "Термінал"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.hint
|
||
#, fuzzy
|
||
#| msgid "Directory hotlist"
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Вибрані каталоги"
|
||
|
||
#: tfrmmain.btnleftequalright.caption
|
||
msgctxt "tfrmmain.btnleftequalright.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmmain.btnleftequalright.hint
|
||
msgid "Show current directory of the right panel in the left panel"
|
||
msgstr "Показати поточний каталог правої панелі в лівій панелі"
|
||
|
||
#: tfrmmain.btnlefthome.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnlefthome.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
|
||
msgid "Go to home directory"
|
||
msgstr "Перейти в домашній каталог"
|
||
|
||
#: tfrmmain.btnleftroot.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnleftroot.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
|
||
msgid "Go to root directory"
|
||
msgstr "Перейти в кореневий каталог"
|
||
|
||
#: tfrmmain.btnleftup.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.btnleftup.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
|
||
msgid "Go to parent directory"
|
||
msgstr "Перейти у каталог вище"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Вибрані каталоги"
|
||
|
||
#: tfrmmain.btnrightequalleft.caption
|
||
msgctxt "tfrmmain.btnrightequalleft.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmmain.btnrightequalleft.hint
|
||
msgid "Show current directory of the left panel in the right panel"
|
||
msgstr "Показати поточний каталог лівої панелі в правій панелі"
|
||
|
||
#: tfrmmain.btnrighthome.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnrightroot.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnrightup.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.caption
|
||
msgctxt "tfrmmain.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmain.lblcommandpath.caption
|
||
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
|
||
msgid "Path"
|
||
msgstr "Шлях"
|
||
|
||
#: tfrmmain.menuitem2.caption
|
||
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mi2080.caption
|
||
msgid "&20/80"
|
||
msgstr "&20/80"
|
||
|
||
#: tfrmmain.mi3070.caption
|
||
msgid "&30/70"
|
||
msgstr "&30/70"
|
||
|
||
#: tfrmmain.mi4060.caption
|
||
msgid "&40/60"
|
||
msgstr "&40/60"
|
||
|
||
#: tfrmmain.mi5050.caption
|
||
msgid "&50/50"
|
||
msgstr "&50/50"
|
||
|
||
#: tfrmmain.mi6040.caption
|
||
msgid "&60/40"
|
||
msgstr "&60/40"
|
||
|
||
#: tfrmmain.mi7030.caption
|
||
msgid "&70/30"
|
||
msgstr "&70/30"
|
||
|
||
#: tfrmmain.mi8020.caption
|
||
msgid "&80/20"
|
||
msgstr "&80/20"
|
||
|
||
#: tfrmmain.micancel.caption
|
||
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: tfrmmain.micopy.caption
|
||
msgid "Copy..."
|
||
msgstr "Копіювати..."
|
||
|
||
#: tfrmmain.mihardlink.caption
|
||
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
|
||
msgid "Create link..."
|
||
msgstr "Створити посилання..."
|
||
|
||
#: tfrmmain.miline1.caption
|
||
msgctxt "TFRMMAIN.MILINE1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline10.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.miline10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline11.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.miline11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline12.caption
|
||
msgctxt "TFRMMAIN.MILINE12.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline13.caption
|
||
msgctxt "TFRMMAIN.MILINE13.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline14.caption
|
||
msgctxt "TFRMMAIN.MILINE14.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline15.caption
|
||
msgctxt "TFRMMAIN.MILINE15.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline16.caption
|
||
msgctxt "TFRMMAIN.MILINE16.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline17.caption
|
||
msgctxt "TFRMMAIN.MILINE17.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline18.caption
|
||
msgctxt "TFRMMAIN.MILINE18.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline19.caption
|
||
msgctxt "TFRMMAIN.MILINE19.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline2.caption
|
||
msgctxt "TFRMMAIN.MILINE2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline20.caption
|
||
msgctxt "TFRMMAIN.MILINE20.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline21.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.miline21.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline22.caption
|
||
msgctxt "TFRMMAIN.MILINE22.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline23.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.miline23.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline24.caption
|
||
msgctxt "TFRMMAIN.MILINE24.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline25.caption
|
||
msgctxt "TFRMMAIN.MILINE25.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline26.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.miline26.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline3.caption
|
||
msgctxt "TFRMMAIN.MILINE3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline32.caption
|
||
msgctxt "TFRMMAIN.MILINE32.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline33.caption
|
||
msgctxt "tfrmmain.miline33.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline37.caption
|
||
msgctxt "TFRMMAIN.MILINE37.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline38.caption
|
||
msgctxt "tfrmmain.miline38.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline39.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.miline39.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline4.caption
|
||
msgctxt "TFRMMAIN.MILINE4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline40.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.miline40.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline47.caption
|
||
msgctxt "TFRMMAIN.MILINE47.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline5.caption
|
||
msgctxt "TFRMMAIN.MILINE5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline50.caption
|
||
msgctxt "tfrmmain.miline50.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline55.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.miline55.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline6.caption
|
||
msgctxt "TFRMMAIN.MILINE6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline7.caption
|
||
msgctxt "TFRMMAIN.MILINE7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline8.caption
|
||
msgctxt "TFRMMAIN.MILINE8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline9.caption
|
||
msgctxt "TFRMMAIN.MILINE9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.milogclear.caption
|
||
msgid "Clear"
|
||
msgstr "Очистити"
|
||
|
||
#: tfrmmain.milogcopy.caption
|
||
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmmain.miloghide.caption
|
||
msgid "Hide"
|
||
msgstr "Сховати"
|
||
|
||
#: tfrmmain.milogselectall.caption
|
||
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Виділити все"
|
||
|
||
#: tfrmmain.mimove.caption
|
||
msgid "Move..."
|
||
msgstr "Перемістити..."
|
||
|
||
#: tfrmmain.misymlink.caption
|
||
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
|
||
msgid "Create symlink..."
|
||
msgstr "Створити символічне посилання..."
|
||
|
||
#: tfrmmain.mitaboptions.caption
|
||
msgid "Tab options"
|
||
msgstr "Налаштування вкладки"
|
||
|
||
#: tfrmmain.mitrayiconexit.caption
|
||
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Ви&хід"
|
||
|
||
#: tfrmmain.mitrayiconrestore.caption
|
||
msgid "Restore"
|
||
msgstr "Відновити"
|
||
|
||
#: tfrmmain.mnualloperpause.caption
|
||
msgctxt "tfrmmain.mnualloperpause.caption"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmmain.mnualloperstart.caption
|
||
msgctxt "tfrmmain.mnualloperstart.caption"
|
||
msgid "Start"
|
||
msgstr "Старт"
|
||
|
||
#: tfrmmain.mnualloperstop.caption
|
||
msgctxt "tfrmmain.mnualloperstop.caption"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: tfrmmain.mnucmd.caption
|
||
msgid "&Commands"
|
||
msgstr "&Команди"
|
||
|
||
#: tfrmmain.mnuconfig.caption
|
||
msgid "C&onfiguration"
|
||
msgstr "&Налаштування"
|
||
|
||
#: tfrmmain.mnucontextline1.caption
|
||
msgctxt "tfrmmain.mnucontextline1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnucontextline2.caption
|
||
msgctxt "tfrmmain.mnucontextline2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnufavoritetabs.caption
|
||
msgid "Favorites"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.mnufiles.caption
|
||
msgid "&Files"
|
||
msgstr "&Файли"
|
||
|
||
#: tfrmmain.mnuhelp.caption
|
||
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Дов&ідка"
|
||
|
||
#: tfrmmain.mnumark.caption
|
||
msgid "&Mark"
|
||
msgstr "&Виділення"
|
||
|
||
#: tfrmmain.mnunetwork.caption
|
||
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
|
||
msgid "Network"
|
||
msgstr "Мережа"
|
||
|
||
#: tfrmmain.mnushow.caption
|
||
msgid "&Show"
|
||
msgstr "Ви&гляд"
|
||
|
||
#: tfrmmain.mnutaboptions.caption
|
||
#, fuzzy
|
||
#| msgid "&Options"
|
||
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
|
||
msgid "Tab &Options"
|
||
msgstr "&Налаштування"
|
||
|
||
#: tfrmmain.mnutabs.caption
|
||
msgid "&Tabs"
|
||
msgstr "Вкладк&и"
|
||
|
||
#: tfrmmain.tbchangedir.caption
|
||
msgid "CD"
|
||
msgstr "CD"
|
||
|
||
#: tfrmmain.tbcopy.caption
|
||
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmmain.tbcut.caption
|
||
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: tfrmmain.tbdelete.caption
|
||
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmmain.tbedit.caption
|
||
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: tfrmmain.tbpaste.caption
|
||
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: tfrmmain.tbseparator.caption
|
||
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmaincommandsdlg.btncancel.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmmaincommandsdlg.btnok.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaincommandsdlg.btnok.caption"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmmaincommandsdlg.caption
|
||
msgid "Select your internal command"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
||
msgid "Select all categories by default"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.gbselection.caption
|
||
msgid "Selection:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblcategory.caption
|
||
msgid "&Categories:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblcommandname.caption
|
||
msgid "Command &name:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
||
msgid "&Filter:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblhint.caption
|
||
msgid "Hint:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblhotkey.caption
|
||
msgid "Hotkey:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
||
msgid "cm_name"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
||
msgid "Category"
|
||
msgstr "Категорії"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
||
msgid "Help"
|
||
msgstr "Довідка"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
||
msgid "Hint"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
||
msgid "Hotkey"
|
||
msgstr "Гаряча клавіша"
|
||
|
||
#: tfrmmaskinputdlg.btnaddattribute.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Додати"
|
||
|
||
#: tfrmmaskinputdlg.btnattrshelp.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Довід&ка"
|
||
|
||
#: tfrmmaskinputdlg.btncancel.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
||
msgid "&Define..."
|
||
msgstr "Ви&значити..."
|
||
|
||
#: tfrmmaskinputdlg.btnok.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
||
msgid "Case sensitive"
|
||
msgstr "Чутливість до регістру"
|
||
|
||
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
||
msgid "Ignore accents and ligatures"
|
||
msgstr ""
|
||
|
||
#: tfrmmaskinputdlg.lblattributes.caption
|
||
msgid "Attri&butes:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaskinputdlg.lblprompt.caption
|
||
msgid "Input Mask:"
|
||
msgstr "Вкажіть маску (роздільник - ';'):"
|
||
|
||
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
||
msgid "O&r select predefined selection type:"
|
||
msgstr "Або вибе&ріть тип виділення за шаблоном:"
|
||
|
||
#: tfrmmkdir.btncancel.caption
|
||
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmmkdir.btnok.caption
|
||
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmmkdir.caption
|
||
msgid "Create new directory"
|
||
msgstr "Створити новий каталог"
|
||
|
||
#: tfrmmkdir.lblmakedir.caption
|
||
msgid "&Input new directory name:"
|
||
msgstr "Введіть &ім'я каталогу:"
|
||
|
||
#: tfrmmodview.btnpath1.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath2.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath3.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath4.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath5.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.caption
|
||
msgctxt "TFRMMODVIEW.CAPTION"
|
||
msgid "New Size"
|
||
msgstr "Новий розмір"
|
||
|
||
#: tfrmmodview.lblheight.caption
|
||
msgid "Height :"
|
||
msgstr "Висота :"
|
||
|
||
#: tfrmmodview.lblpath1.caption
|
||
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmodview.lblpath2.caption
|
||
msgid "2"
|
||
msgstr "2"
|
||
|
||
#: tfrmmodview.lblpath3.caption
|
||
msgid "3"
|
||
msgstr "3"
|
||
|
||
#: tfrmmodview.lblpath4.caption
|
||
msgid "4"
|
||
msgstr "4"
|
||
|
||
#: tfrmmodview.lblpath5.caption
|
||
msgid "5"
|
||
msgstr "5"
|
||
|
||
#: tfrmmodview.lblquality.caption
|
||
msgid "Quality of compress to Jpg"
|
||
msgstr "Якість стиснення в Jpg"
|
||
|
||
#: tfrmmodview.lblwidth.caption
|
||
msgid "Width :"
|
||
msgstr "Ширина :"
|
||
|
||
#: tfrmmodview.rbbmp.caption
|
||
msgid "BMP"
|
||
msgstr "BMP"
|
||
|
||
#: tfrmmodview.rbico.caption
|
||
msgid "ICO"
|
||
msgstr "ICO"
|
||
|
||
#: tfrmmodview.rbjpg.caption
|
||
msgid "JPG"
|
||
msgstr "JPG"
|
||
|
||
#: tfrmmodview.rbpng.caption
|
||
msgid "PNG"
|
||
msgstr "PNG"
|
||
|
||
#: tfrmmodview.rbpnm.caption
|
||
msgid "PNM"
|
||
msgstr "PNM"
|
||
|
||
#: tfrmmodview.teheight.text
|
||
msgid "Height"
|
||
msgstr "Висота"
|
||
|
||
#: tfrmmodview.tequality.text
|
||
msgid "80"
|
||
msgstr "80"
|
||
|
||
#: tfrmmodview.tewidth.text
|
||
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
|
||
msgid "Width"
|
||
msgstr "Ширина"
|
||
|
||
#: tfrmmsg.lblmsg.caption
|
||
msgid "456456465465465"
|
||
msgstr ""
|
||
|
||
#: tfrmmultirename.btnclose.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmmultirename.btndeletepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Ви&далити"
|
||
|
||
#: tfrmmultirename.btnedit.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmultirename.btnedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Р&едагувати"
|
||
|
||
#: tfrmmultirename.btnextmenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnloadpreset.caption
|
||
msgid "&Load"
|
||
msgstr "&Завантажити"
|
||
|
||
#: tfrmmultirename.btnnamemenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnrename.caption
|
||
msgctxt "tfrmmultirename.btnrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "&Перейменувати"
|
||
|
||
#: tfrmmultirename.btnrestore.caption
|
||
msgid "Reset &all"
|
||
msgstr "Відн&овити все"
|
||
|
||
#: tfrmmultirename.btnsavepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "З&берегти"
|
||
|
||
#: tfrmmultirename.caption
|
||
msgctxt "tfrmmultirename.caption"
|
||
msgid "MultiRename"
|
||
msgstr "Групове перейменування"
|
||
|
||
#: tfrmmultirename.cblog.caption
|
||
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
|
||
msgid "Ena&ble"
|
||
msgstr "Ввімкн&ено"
|
||
|
||
#: tfrmmultirename.cbregexp.caption
|
||
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
|
||
msgid "Regular e&xpressions"
|
||
msgstr "Регулярні вира&зи"
|
||
|
||
#: tfrmmultirename.cbusesubs.caption
|
||
msgid "&Use substitution"
|
||
msgstr "Використов&увати заміну"
|
||
|
||
#: tfrmmultirename.cmbxwidth.text
|
||
msgid "01"
|
||
msgstr "01"
|
||
|
||
#: tfrmmultirename.edinterval.text
|
||
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.edpoc.text
|
||
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.extension.caption
|
||
msgid "[E] Extension"
|
||
msgstr "[E] Розширення"
|
||
|
||
#: tfrmmultirename.gbcounter.caption
|
||
msgid "Counter"
|
||
msgstr "Лічильник"
|
||
|
||
#: tfrmmultirename.gbfindreplace.caption
|
||
msgid "Find && Replace"
|
||
msgstr "Знайти &та замінити"
|
||
|
||
#: tfrmmultirename.gblog.caption
|
||
msgid "Log Result"
|
||
msgstr "Результат у звіт"
|
||
|
||
#: tfrmmultirename.gbmaska.caption
|
||
msgid "Mask"
|
||
msgstr "Маска"
|
||
|
||
#: tfrmmultirename.gbpresets.caption
|
||
msgid "Presets"
|
||
msgstr "Шаблони"
|
||
|
||
#: tfrmmultirename.lbext.caption
|
||
msgid "&Extension"
|
||
msgstr "Розшир&ення"
|
||
|
||
#: tfrmmultirename.lbfind.caption
|
||
msgid "&Find..."
|
||
msgstr "Зна&йти..."
|
||
|
||
#: tfrmmultirename.lbinterval.caption
|
||
msgid "&Interval"
|
||
msgstr "&Інтервал"
|
||
|
||
#: tfrmmultirename.lbname.caption
|
||
msgid "File &Name"
|
||
msgstr "І&м'я файлу"
|
||
|
||
#: tfrmmultirename.lbreplace.caption
|
||
msgid "Re&place..."
|
||
msgstr "Заміни&ти..."
|
||
|
||
#: tfrmmultirename.lbstnb.caption
|
||
msgid "S&tart Number"
|
||
msgstr "Поча&ткове значення"
|
||
|
||
#: tfrmmultirename.lbwidth.caption
|
||
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
|
||
msgid "&Width"
|
||
msgstr "&Ширина"
|
||
|
||
#: tfrmmultirename.micounter.caption
|
||
msgid "[C] Counter"
|
||
msgstr "[C] Лічильник"
|
||
|
||
#: tfrmmultirename.miday.caption
|
||
msgid "[D] Day"
|
||
msgstr "[D] День"
|
||
|
||
#: tfrmmultirename.miday1.caption
|
||
msgid "[DD] Day (2 digits)"
|
||
msgstr "[DD] День (2 цифри)"
|
||
|
||
#: tfrmmultirename.miday2.caption
|
||
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
||
msgstr "[DDD] День тижня (коротко, \"mon\")"
|
||
|
||
#: tfrmmultirename.miday3.caption
|
||
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
||
msgstr "[DDDD] День тижня (довге, \"monday\")"
|
||
|
||
#: tfrmmultirename.miextensionx.caption
|
||
msgid "[Ex] Character at position x"
|
||
msgstr "[Ex] Символ на позиції x"
|
||
|
||
#: tfrmmultirename.miextensionxx.caption
|
||
msgid "[Ex:y] Characters from position x to y"
|
||
msgstr "[Ex:y] Символи між позиціями x і y"
|
||
|
||
#: tfrmmultirename.mihour.caption
|
||
msgid "[h] Hour"
|
||
msgstr "[h] Година"
|
||
|
||
#: tfrmmultirename.mihour1.caption
|
||
msgid "[hh] Hour (2 digits)"
|
||
msgstr "[hh] Години (2 цифри)"
|
||
|
||
#: tfrmmultirename.miminute.caption
|
||
msgid "[n] Minute"
|
||
msgstr "[n] Хвилина"
|
||
|
||
#: tfrmmultirename.miminute1.caption
|
||
msgid "[nn] Minute (2 digits)"
|
||
msgstr "[nn] Хвилини (2 цифри)"
|
||
|
||
#: tfrmmultirename.mimonth.caption
|
||
msgid "[M] Month"
|
||
msgstr "[M] Місяць"
|
||
|
||
#: tfrmmultirename.mimonth1.caption
|
||
msgid "[MM] Month (2 digits)"
|
||
msgstr "[MM] Місяць (2 цифри)"
|
||
|
||
#: tfrmmultirename.mimonth2.caption
|
||
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
||
msgstr "[MMM] Назва місяця (коротко, \"jan\")"
|
||
|
||
#: tfrmmultirename.mimonth3.caption
|
||
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
||
msgstr "[MMMM] Назва місяця (довга, \"грудень\")"
|
||
|
||
#: tfrmmultirename.miname.caption
|
||
msgid "[N] Name"
|
||
msgstr "[N] Ім’я"
|
||
|
||
#: tfrmmultirename.minamex.caption
|
||
msgid "[Nx] Character at position x"
|
||
msgstr "[Nx] Символ на позиції x"
|
||
|
||
#: tfrmmultirename.minamexx.caption
|
||
msgid "[Nx:y] Characters from position x to y"
|
||
msgstr "[Nx:y] Символи між позиціями x і y"
|
||
|
||
#: tfrmmultirename.minext.caption
|
||
msgid "Time..."
|
||
msgstr "Час..."
|
||
|
||
#: tfrmmultirename.minextextension.caption
|
||
msgid "Extension..."
|
||
msgstr "Розширення..."
|
||
|
||
#: tfrmmultirename.minextname.caption
|
||
msgid "Name..."
|
||
msgstr "Ім’я..."
|
||
|
||
#: tfrmmultirename.miplugin.caption
|
||
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "Плагін"
|
||
|
||
#: tfrmmultirename.misecond.caption
|
||
msgid "[s] Second"
|
||
msgstr "[s] Секунда"
|
||
|
||
#: tfrmmultirename.misecond1.caption
|
||
msgid "[ss] Second (2 digits)"
|
||
msgstr "[ss] Секунди (2 цифри)"
|
||
|
||
#: tfrmmultirename.miyear.caption
|
||
msgid "[Y] Year (2 digits)"
|
||
msgstr "[Y] Рік (2 цифри)"
|
||
|
||
#: tfrmmultirename.miyear1.caption
|
||
msgid "[YYYY] Year (4 digits)"
|
||
msgstr "[YYYY] Рік (4 цифри)"
|
||
|
||
#: tfrmmultirename.mnueditnames.caption
|
||
msgid "Edit names..."
|
||
msgstr ""
|
||
|
||
#: tfrmmultirename.mnuloadfromfile.caption
|
||
msgid "Load names from file..."
|
||
msgstr ""
|
||
|
||
#: tfrmmultirename.n1.caption
|
||
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n2.caption
|
||
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n3.caption
|
||
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n4.caption
|
||
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n5.caption
|
||
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
|
||
msgid "Old File Name"
|
||
msgstr "Старе ім’я файла"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
|
||
msgid "New File Name"
|
||
msgstr "Нове ім’я файла"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
|
||
msgid "File Path"
|
||
msgstr "Шлях до файла"
|
||
|
||
#: tfrmmultirenamewait.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmultirenamewait.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmultirenamewait.lblmessage.caption
|
||
msgid "Click OK when you have closed the editor to load the changed names!"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.caption
|
||
msgid "Choose an application"
|
||
msgstr "Вибір програми"
|
||
|
||
#: tfrmopenwith.chkcustomcommand.caption
|
||
msgid "Custom command"
|
||
msgstr "Власна команда"
|
||
|
||
#: tfrmopenwith.chksaveassociation.caption
|
||
msgid "Save association"
|
||
msgstr "Зберегти асоціації"
|
||
|
||
#: tfrmopenwith.chkuseasdefault.caption
|
||
msgid "Set selected application as default action"
|
||
msgstr "Встановити обрану програму як типову дію"
|
||
|
||
#: tfrmopenwith.lblmimetype.caption
|
||
msgid "File type to be opened: %s"
|
||
msgstr "Відкривати тип файлу: %s"
|
||
|
||
#: tfrmopenwith.milistoffiles.caption
|
||
#, fuzzy
|
||
msgid "Multiple file names"
|
||
msgstr "Кілька імен файлів"
|
||
|
||
#: tfrmopenwith.milistoffiles.hint
|
||
msgid "%F"
|
||
msgstr "%F"
|
||
|
||
#: tfrmopenwith.milistofurls.caption
|
||
#, fuzzy
|
||
msgid "Multiple URIs"
|
||
msgstr "Кілька посилань"
|
||
|
||
#: tfrmopenwith.milistofurls.hint
|
||
msgid "%U"
|
||
msgstr "%U"
|
||
|
||
#: tfrmopenwith.misinglefilename.caption
|
||
#, fuzzy
|
||
msgid "Single file name"
|
||
msgstr "Одиночне ім’я"
|
||
|
||
#: tfrmopenwith.misinglefilename.hint
|
||
msgid "%f"
|
||
msgstr "%f"
|
||
|
||
#: tfrmopenwith.misingleurl.caption
|
||
#, fuzzy
|
||
msgid "Single URI"
|
||
msgstr "Одиночне посилання"
|
||
|
||
#: tfrmopenwith.misingleurl.hint
|
||
msgid "%u"
|
||
msgstr "%u"
|
||
|
||
#: tfrmoptions.btnapply.caption
|
||
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
|
||
msgid "&Apply"
|
||
msgstr "&Застосувати"
|
||
|
||
#: tfrmoptions.btncancel.caption
|
||
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "С&касувати"
|
||
|
||
#: tfrmoptions.btnok.caption
|
||
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmoptions.caption
|
||
msgctxt "tfrmoptions.caption"
|
||
msgid "Options"
|
||
msgstr "Налаштування"
|
||
|
||
#: tfrmoptions.lblemptyeditor.caption
|
||
msgid "Please select one of the subpages, this page does not contain any settings."
|
||
msgstr "Будь ласка, виберіть підсторінку, ця сторінка не містить налаштувань."
|
||
|
||
#: tfrmoptionsarchivers.btnautoconfig.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNAUTOCONFIG.CAPTION"
|
||
msgid "A&uto Configure"
|
||
msgstr "Автоналашт&ування"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcadd.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "До&дати"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcapply.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Застосувати"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCDELETE.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Ви&далити"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcrename.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
|
||
msgid "&Rename"
|
||
msgstr "Пе&рейменувати"
|
||
|
||
#: tfrmoptionsarchivers.btnrelativearchiver.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCDEBUG.CAPTION"
|
||
msgid "De&bug mode"
|
||
msgstr "Ре&жим налагодження"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCENABLED.CAPTION"
|
||
msgid "E&nabled"
|
||
msgstr "Ввімкне&но"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCOUTPUT.CAPTION"
|
||
msgid "S&how console output"
|
||
msgstr "Показати вивід на консол&ь"
|
||
|
||
#: tfrmoptionsarchivers.gbarchiveroptions.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Налаштування"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveadd.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEADD.CAPTION"
|
||
msgid "Add&ing:"
|
||
msgstr "Додат&и:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextension.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTENSION.CAPTION"
|
||
msgid "E&xtension:"
|
||
msgstr "Роз&ширення:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextract.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTRACT.CAPTION"
|
||
msgid "Ex&tract:"
|
||
msgstr "Розпакува&ти:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelist.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELIST.CAPTION"
|
||
msgid "&List:"
|
||
msgstr "Спис&ок:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistend.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTEND.CAPTION"
|
||
msgid "Listing &finish (optional):"
|
||
msgstr "Кіне&ць списку (за бажанням)"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistformat.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTFORMAT.CAPTION"
|
||
msgid "Listing for&mat:"
|
||
msgstr "Форма&т списку:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveliststart.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTSTART.CAPTION"
|
||
msgid "Listin&g start (optional):"
|
||
msgstr "По&чаток списку (за бажанням)"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiver.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVER.CAPTION"
|
||
msgid "Arc&hiver:"
|
||
msgstr "Ар&хіватор:"
|
||
|
||
#: tfrmoptionsarchivers.lbldescription.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLDESCRIPTION.CAPTION"
|
||
msgid "De&scription:"
|
||
msgstr "Опи&с:"
|
||
|
||
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
|
||
msgid "Additional"
|
||
msgstr "Додатково"
|
||
|
||
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
|
||
msgid "General"
|
||
msgstr "Основні"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
|
||
msgid "When &size, date or attributes change"
|
||
msgstr "&Також оновлювати при зміні розміру, дати чи атрибутів"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Для наступних шляхів і їх підкаталогів:"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
|
||
msgid "When &files are created, deleted or renamed"
|
||
msgstr "&Оновлювати при створенні, копіюванні чи видаленні файлів"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
|
||
msgid "When application is in the &background"
|
||
msgstr "Не реагувати на зміни якщо вікно у &фоні"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
|
||
msgid "Disable auto-refresh"
|
||
msgstr "Відключити автооновлення"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
|
||
msgid "Refresh file list"
|
||
msgstr "Оновлення списку файлів"
|
||
|
||
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
|
||
msgid "Al&ways show tray icon"
|
||
msgstr "Завжди показувати іконку в тре&ї"
|
||
|
||
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
||
msgid "Automatically &hide unmounted devices"
|
||
msgstr "Автоматично при&ховувати відмонтовані пристрої"
|
||
|
||
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
|
||
msgid "Mo&ve icon to system tray when minimized"
|
||
msgstr "Перемістити іконку в системний трей при згортанні"
|
||
|
||
#: tfrmoptionsbehavior.cbonlyonce.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
|
||
msgid "A&llow only one copy of DC at a time"
|
||
msgstr "Н&е запускати більше однієї копії DC"
|
||
|
||
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
||
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
||
msgstr "Тут ви можете ввести один або декілька дисків, розділених \";\"."
|
||
|
||
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
||
msgid "Drives &blacklist"
|
||
msgstr "Чорний список дискі&в"
|
||
|
||
#: tfrmoptionsbriefview.gbcolumns.caption
|
||
msgid "Columns size"
|
||
msgstr "Розмір колонок"
|
||
|
||
#: tfrmoptionsbriefview.gbshowfileext.caption
|
||
msgid "Show file extensions"
|
||
msgstr "Показувати розширення файлів"
|
||
|
||
#: tfrmoptionsbriefview.rbaligned.caption
|
||
msgid "ali&gned (with Tab)"
|
||
msgstr "вирівнян&о (по Tab)"
|
||
|
||
#: tfrmoptionsbriefview.rbdirectly.caption
|
||
msgid "di&rectly after filename"
|
||
msgstr "одразу після &імені файлу"
|
||
|
||
#: tfrmoptionsbriefview.rbuseautosize.caption
|
||
msgid "Auto"
|
||
msgstr "Автоматично"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
||
msgid "Fixed columns count"
|
||
msgstr "Стала кількість колонок"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
||
msgid "Fixed columns width"
|
||
msgstr "Стала ширниа колонок"
|
||
|
||
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBCUTTEXTTOCOLWIDTH.CAPTION"
|
||
msgid "Cut &text to column width"
|
||
msgstr "Обр&ізати текст до ширини колонки"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDHORZLINE.CAPTION"
|
||
msgid "&Horizontal lines"
|
||
msgstr "&Горизонтальні лінії"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDVERTLINE.CAPTION"
|
||
msgid "&Vertical lines"
|
||
msgstr "&Вертикальні лінії"
|
||
|
||
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CHKAUTOFILLCOLUMNS.CAPTION"
|
||
msgid "A&uto fill columns"
|
||
msgstr "Розтягуват&и колонки на ширину панелі"
|
||
|
||
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
||
msgid "Show grid"
|
||
msgstr "Показати сітку"
|
||
|
||
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
||
msgid "Auto-size columns"
|
||
msgstr "Автоматична зміна розмірів колонок"
|
||
|
||
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.LBLAUTOSIZECOLUMN.CAPTION"
|
||
msgid "Auto si&ze column:"
|
||
msgstr "Пристосовув&ати розмір:"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Застосувати"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Редаг&увати"
|
||
|
||
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBCMDLINEHISTORY.CAPTION"
|
||
msgid "Co&mmand line history"
|
||
msgstr "І&сторія командного рядка"
|
||
|
||
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
|
||
msgid "&Directory history"
|
||
msgstr "Історія катало&гів"
|
||
|
||
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBFILEMASKHISTORY.CAPTION"
|
||
msgid "&File mask history"
|
||
msgstr "Історія масок &файлів"
|
||
|
||
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSAVECONFIGURATION.CAPTION"
|
||
msgid "Sa&ve configuration"
|
||
msgstr "З&берегти налаштування"
|
||
|
||
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSEARCHREPLACEHISTORY.CAPTION"
|
||
msgid "Searc&h/Replace history"
|
||
msgstr "Іст&орія пошуку/заміни"
|
||
|
||
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.GBLOCCONFIGFILES.CAPTION"
|
||
msgid "Location of configuration files"
|
||
msgstr "Розміщення файлів конфігурації"
|
||
|
||
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.GBSAVEONEXIT.CAPTION"
|
||
msgid "Save on exit"
|
||
msgstr "Зберігати при виході"
|
||
|
||
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
||
msgid "Sort order of configuration order in left tree"
|
||
msgstr "Сортіування конфігурації в лівому дереві"
|
||
|
||
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.LBLCMDLINECONFIGDIR.CAPTION"
|
||
msgid "Set on command line"
|
||
msgstr "Встановити в командному рядку"
|
||
|
||
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.RBPROGRAMDIR.CAPTION"
|
||
msgid "P&rogram directory (portable version)"
|
||
msgstr "Каталог п&рограми (для переносної версії)"
|
||
|
||
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.RBUSERHOMEDIR.CAPTION"
|
||
msgid "&User home directory"
|
||
msgstr "Домашній каталог корист&увача"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursortext.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
|
||
msgid "&Delete"
|
||
msgstr "Ви&далити кнопку"
|
||
|
||
#: tfrmoptionscustomcolumns.btnfont.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
||
msgid "Go to set default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
|
||
msgid "New"
|
||
msgstr "Створити"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnext.caption
|
||
msgid "Next"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnprev.caption
|
||
msgid "Previous"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
|
||
msgid "Rename"
|
||
msgstr "Перейменувати"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
|
||
msgid "Save as"
|
||
msgstr "Зберегти як"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Дозволити виділення кольором"
|
||
|
||
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
||
msgid "When clicking to change something, change for all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
|
||
msgid "General"
|
||
msgstr "Основні"
|
||
|
||
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Межі курсору"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
||
msgid "Use Frame Cursor"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Selection Color"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
||
msgid "Use Inverted Selection"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
||
msgid "Use custom font and color for this view"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
|
||
msgid "BackGround:"
|
||
msgstr "Фон:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
|
||
msgid "Background 2:"
|
||
msgstr "Фон 2:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
||
#, fuzzy
|
||
#| msgid "Con&figure columns for file system:"
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCONFIGCOLUMNS.CAPTION"
|
||
msgid "Con&figure columns view:"
|
||
msgstr "На&лаштувати колонки для файлової системи:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
||
msgid "[Current Column Name]"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
|
||
msgid "Cursor Color:"
|
||
msgstr "Колір курсора"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
|
||
msgid "Cursor Text:"
|
||
msgstr "Текст &під курсором"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontname.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
|
||
msgid "Font:"
|
||
msgstr "Шрифт:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
|
||
msgid "Size:"
|
||
msgstr "Розмір:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
|
||
msgid "Text Color:"
|
||
msgstr "Колір тексту:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
|
||
msgid "Mark Color:"
|
||
msgstr "Виділення"
|
||
|
||
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Нижче попередній перегляд. Ви можете переміщати курсор і вибрати файли, щоб отримати фактичний вигляд різних налаштувань."
|
||
|
||
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
||
msgid "Settings for column:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
|
||
msgid "Add column"
|
||
msgstr "Додати колонку"
|
||
|
||
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
||
msgid "Position of frame panel after the comparison:"
|
||
msgstr "Позиція панелі після порівняння:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
||
msgid "Add..."
|
||
msgstr "Додати..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
||
msgid "Backup..."
|
||
msgstr "Резервн копіювання..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
||
msgid "Delete..."
|
||
msgstr "Видалити..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Експортувати..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
|
||
msgid "Help"
|
||
msgstr "Довідка"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Імпорт..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
||
msgid "Insert..."
|
||
msgstr "Вставити..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
||
msgid "Miscellaneous..."
|
||
msgstr "Різне..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Кілька функцій для вибору відповідного шляху"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
|
||
msgid "Some functions to select appropriate target"
|
||
msgstr "Кілька функцій для вибору відповідного місця призначення"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
||
msgid "Sort..."
|
||
msgstr "Сортувати..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
||
msgid "When adding directory, add also target"
|
||
msgstr "Додаючи каталог, додавати каталог призначення"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
||
msgid "Always expand tree"
|
||
msgstr "Завжди розгортати дерево"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
||
msgid "Show only valid environment variables"
|
||
msgstr "Показувати лише дійсні змінні оточення"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
||
msgid "In popup, show [path also]"
|
||
msgstr "У спливаючому вікні показувати шлях"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Ім’я, a-z"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Ім’я, a-z"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
||
msgid "Directory Hotlist (reorder by drag && drop)"
|
||
msgstr "Вибрані теки (можна сортувати перетягуванням)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Інші налаштування"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
|
||
msgid "Name:"
|
||
msgstr "Ім'я:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
|
||
msgid "Path:"
|
||
msgstr "Шлях:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
|
||
msgid "Target:"
|
||
msgstr "Призначення:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miactiveframedirectory.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miactiveframedirectory.caption"
|
||
msgid "directory of the active frame"
|
||
msgstr "теку активної панелі"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miactiveinactiveframedirectory.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miactiveinactiveframedirectory.caption"
|
||
msgid "directories of the active && inactive frames"
|
||
msgstr "теки активної &і неактивної панелей"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcommand.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddcommand.caption"
|
||
msgid "a command"
|
||
msgstr "команду"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcommand2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddcommand2.caption"
|
||
msgid "Add a command"
|
||
msgstr "Додати команду"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddcopyofselected.caption"
|
||
msgid "a copy of the selected entry"
|
||
msgstr "копія виділеного елемента"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddcopyofselected2.caption"
|
||
msgid "Add a copy of the selected entry"
|
||
msgstr "Додати копію виділеного елемента"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddseparator.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddseparator.caption"
|
||
msgid "a separator"
|
||
msgstr "роздільник"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddseparator2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddseparator2.caption"
|
||
msgid "Add a separator"
|
||
msgstr "Додати роздільник"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddsubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu.caption"
|
||
msgid "sub-menu"
|
||
msgstr "підменю"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption"
|
||
msgid "Add sub-menu"
|
||
msgstr "Додати підменю"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mibrowsetodirectory.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mibrowsetodirectory.caption"
|
||
msgid "directory I will browse to"
|
||
msgstr "теку до якої я перейду"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micollapseall.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Згорнути все"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr "...поточний рівень виділених елементів"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentselectedoractivedirectories.caption
|
||
msgid "current selected or active directories of active frame"
|
||
msgstr "...поточні виділені чи активні теки в поточній панелі"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micutselection.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micutselection.caption"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption"
|
||
msgid "delete all!"
|
||
msgstr "видалити все!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "підменю і всі його елементи"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "тільки підменю без елементів"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption"
|
||
msgid "selected item"
|
||
msgstr "виділений елемент"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Видалити виділений елемент"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
|
||
msgid "Scan all hotdir's path to validate the ones that actually exist"
|
||
msgstr "Перевірити чи дійсні шляхи в обраних теках"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
|
||
msgid "Scan all hotdir's path && target to validate the ones that actually exist"
|
||
msgstr "Перевірити чи існують шляхи в обраних каталогах і призначеннях"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
||
msgid "to a Directory Hotlist file (.hotlist)"
|
||
msgstr "у файл Обрані теки ((.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "у файл \"wincmd.ini\" від TC (лишити існуючий)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "у файл \"wincmd.ini\" від TC (видалити існуючий)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
||
msgid "Go to configure TC related info"
|
||
msgstr "Перейти до налаштувань данних пов’язаних з ТС"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
|
||
msgid "Go to configure TC related info"
|
||
msgstr "Перейти до налаштувань данних пов’язаних з ТС"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
||
#, fuzzy
|
||
msgid "HotDirTestMenu"
|
||
msgstr "HotDirTestMenu"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
||
msgid "from a Directory Hotlist file (.hotlist)"
|
||
msgstr "з файлу Обрані теки (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
||
msgid "from \"wincmd.ini\" of TC"
|
||
msgstr "з файла \"wincmd.ini\" від TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miopenallbranches.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Відкрити всі гілки"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mipasteselection.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mipasteselection.caption"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
||
msgid "Restore a backup of Directory Hotlist"
|
||
msgstr "Відновити з резервної копії Обрані теки"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
||
msgid "Save a backup of current Directory Hotlist"
|
||
msgstr "Зберегти резевну копію Обраних тек"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
||
msgid "Search and replace..."
|
||
msgstr "Пошук і заміна..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplaceinpath.caption
|
||
msgid "in path..."
|
||
msgstr "на шляху..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplaceintargetpath.caption
|
||
msgid "in target path..."
|
||
msgstr "на шляху призначення..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchinreplaceinbothpaths.caption
|
||
msgid "in path and target path..."
|
||
msgstr "на шляху і шляху призначення..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator10.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator11.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator12.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator12.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator13.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator13.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator3.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator4.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator4.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator5.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator5.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator6.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator6.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator7.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator8.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miseparator9.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "...все, від А до Я!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr "...тільки одну групу елементів"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr "Сортувати тількиодну групу елементів"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr "...вміст підменю виділено, без підрівнів"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr "...вміст підменю виділено разом з підрівнями"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr "Перевірити меню"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitypethedirectory.caption"
|
||
msgid "directory I will type"
|
||
msgstr "теку, яку я введу"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitypethedirectory2.caption"
|
||
msgid "Add directory I will type"
|
||
msgstr "Додати теку яку я введу"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitypethedirectory3.caption
|
||
msgid "Insert directory I will type"
|
||
msgstr "Вставити теку яку я введу"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
||
msgid "Addition from main panel:"
|
||
msgstr "Додавання з головної панелі:"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
||
msgid "From all the supported formats, ask which one to use every time"
|
||
msgstr "З усіх підтримуваних форматів, запитати, який з них щоразу використовувати"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
||
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
||
msgstr "При збереженні тексту Unicode, збережіть його у форматі UTF8 (інакше буде UTF16)"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
||
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
||
msgstr "При перетягуванні тексті, давати ім’я автоматично (інакше питати користувача)"
|
||
|
||
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
||
msgid "&Show confirmation dialog after drop"
|
||
msgstr "&Показувати діалог підтвердження при перетягуванні"
|
||
|
||
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
||
msgid "When drag && dropping text into panels:"
|
||
msgstr "При перетя&гуванні текста в панелі:"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
||
msgid "Place the most desired format on top of list (use dag && drop):"
|
||
msgstr "Помістіть найбільш бажаний формат на початку списку (використовуйте перетя&гування):"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
||
msgid "(if the most desired is not present, we'll take second one and so on)"
|
||
msgstr "(якщо найбільш бажаного немає, брати другий і так далі)"
|
||
|
||
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
||
msgid "(will not work with some source application, so try to uncheck if problem)"
|
||
msgstr "(якщо з деякими додатками не працює, зніміть галочку)"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
||
msgid "Show &file system"
|
||
msgstr "Показувати &файлову систему"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
||
msgid "Show fr&ee space"
|
||
msgstr "Показувати вільн&е місце"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
||
msgid "Show &label"
|
||
msgstr "Показувати &мітки"
|
||
|
||
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
||
msgid "Drives list"
|
||
msgstr "Список дисків"
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.caption
|
||
msgid "Caret past end of line"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.caption
|
||
msgid "Show special characters"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.gbinternaleditor.caption
|
||
msgid "Internal editor options"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "&Фон"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "&Фон"
|
||
|
||
#: tfrmoptionseditorcolors.btnresetmask.hint
|
||
msgid "Reset"
|
||
msgstr "Скинути"
|
||
|
||
#: tfrmoptionseditorcolors.btnsavemask.hint
|
||
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
||
msgid "Element Attributes"
|
||
msgstr "Атрибути елементу"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
||
msgid "Fo®round"
|
||
msgstr "&Передній план"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
|
||
msgid "Fo®round"
|
||
msgstr "&Передній план"
|
||
|
||
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
||
msgid "&Text-mark"
|
||
msgstr "&Текстова мітка"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
||
msgid "Use (and edit) &global scheme settings"
|
||
msgstr "Використати (і редагувати) глобальні налаштування схеми"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
||
msgid "Use &local scheme settings"
|
||
msgstr "Використати локальні параметри схеми"
|
||
|
||
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
||
msgid "&Bold"
|
||
msgstr "&Bold"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "І&нвертувати"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "&Вимк"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Увімк."
|
||
|
||
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
||
msgid "&Italic"
|
||
msgstr "&Italic"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "І&нвертувати"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "&Вимк"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Увімк."
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
||
msgid "&Strike Out"
|
||
msgstr "&Закреслений"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "І&нвертувати"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "&Вимк"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Увімк."
|
||
|
||
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
||
msgid "&Underline"
|
||
msgstr "&Підкреслений"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "І&нвертувати"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "&Вимк"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Увімк."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnadd.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
|
||
msgid "Add..."
|
||
msgstr "Додати..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btndelete.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
|
||
msgid "Delete..."
|
||
msgstr "Видалити..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
||
msgid "Import/Export"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.btninsert.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
|
||
msgid "Insert..."
|
||
msgstr "Вставити..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnrename.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Перейменувати"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnsort.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
|
||
msgid "Sort..."
|
||
msgstr "Сортувати..."
|
||
|
||
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
|
||
msgid "Always expand tree"
|
||
msgstr "Завжди розгортати дерево"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Ні"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
||
msgid "Right"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
||
msgid "Favorite Tabs list (reorder by drag && drop)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Інші налаштування"
|
||
|
||
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
||
msgid "What to restore where for the selected entry:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
||
msgid "Existing tabs to keep:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
||
msgid "Save dir history:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
||
msgid "Tabs saved on left to be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
||
msgid "Tabs saved on right to be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
|
||
msgid "a separator"
|
||
msgstr "роздільник"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
||
msgid "Add separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
|
||
msgid "sub-menu"
|
||
msgstr "підменю"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
|
||
msgid "Add sub-menu"
|
||
msgstr "Додати підменю"
|
||
|
||
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Згорнути все"
|
||
|
||
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr "...поточний рівень виділених елементів"
|
||
|
||
#: tfrmoptionsfavoritetabs.micutselection.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
|
||
msgid "delete all!"
|
||
msgstr "видалити все!"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "підменю і всі його елементи"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "тільки підменю без елементів"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
|
||
msgid "selected item"
|
||
msgstr "виділений елемент"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Видалити виділений елемент"
|
||
|
||
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
||
msgid "Export selection to legacy .tab file(s)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
||
msgid "FavoriteTabsTestMenu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
||
msgid "Import legacy .tab file(s) according to default setting"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
||
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
||
msgid "Insert separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
||
msgid "Insert sub-menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Відкрити всі гілки"
|
||
|
||
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: tfrmoptionsfavoritetabs.mirename.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
|
||
msgid "Rename"
|
||
msgstr "Перейменувати"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "...все, від А до Я!"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr "...тільки одну групу елементів"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr "Сортувати тількиодну групу елементів"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr "...вміст підменю виділено, без підрівнів"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr "...вміст підменю виділено разом з підрівнями"
|
||
|
||
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr "Перевірити меню"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
|
||
msgid "Add"
|
||
msgstr "Додати"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
|
||
msgid "&Add"
|
||
msgstr "&Додати"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
|
||
msgid "A&dd"
|
||
msgstr "До&дати"
|
||
|
||
#: tfrmoptionsfileassoc.btncloneact.caption
|
||
msgid "Clone"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btndownact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
|
||
msgid "&Down"
|
||
msgstr "В&низ"
|
||
|
||
#: tfrmoptionsfileassoc.btneditext.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
||
msgid "Insert"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btninsertext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
|
||
msgid "Insert"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
|
||
msgid "Remo&ve"
|
||
msgstr "&Видалити"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
|
||
msgid "Re&move"
|
||
msgstr "В&идалити"
|
||
|
||
#: tfrmoptionsfileassoc.btnremovetype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
|
||
msgid "&Remove"
|
||
msgstr "Вид&алити"
|
||
|
||
#: tfrmoptionsfileassoc.btnrenametype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
||
msgid "R&ename"
|
||
msgstr "Пере&йменувати"
|
||
|
||
#: tfrmoptionsfileassoc.btnupact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
|
||
msgid "&Up"
|
||
msgstr "Вгор&у"
|
||
|
||
#: tfrmoptionsfileassoc.destartpath.hint
|
||
msgid "Starting path of the command. Never quote this string."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.edbactionname.hint
|
||
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.edtparams.hint
|
||
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.fnecommand.hint
|
||
msgid "Command to execute. Long filename with space should be quoted."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
||
msgid "Action description:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.gbactions.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
||
msgid "Actions"
|
||
msgstr "Дії"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
|
||
msgid "Extensions"
|
||
msgstr "Розширення"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.hint
|
||
msgid "Can be sorted by drag & drop"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
||
msgid "File types"
|
||
msgstr "Типи файлів"
|
||
|
||
#: tfrmoptionsfileassoc.gbicon.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
|
||
msgid "Icon"
|
||
msgstr "Іконка"
|
||
|
||
#: tfrmoptionsfileassoc.lbactions.hint
|
||
msgid "Actions may be sorted by drag & drop"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.lbexts.hint
|
||
msgid "Extensions may be sorted by drag & drop"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
||
msgid "File types may be sorted by drag & drop"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.lblaction.caption
|
||
#, fuzzy
|
||
#| msgid "Action:"
|
||
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
|
||
msgid "Action name:"
|
||
msgstr "Дія:"
|
||
|
||
#: tfrmoptionsfileassoc.lblcommand.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
|
||
msgid "&Command:"
|
||
msgstr "&Команда:"
|
||
|
||
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Параметр&и:"
|
||
|
||
#: tfrmoptionsfileassoc.lblstartpath.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "Шля&х запуску:"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem3.caption
|
||
msgid "Custom with..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.micustom.caption
|
||
msgid "Custom"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.miedit.caption
|
||
msgctxt "tfrmoptionsfileassoc.miedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: tfrmoptionsfileassoc.mieditor.caption
|
||
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
|
||
msgid "Open in Editor"
|
||
msgstr "Відкрити у редакторі"
|
||
|
||
#: tfrmoptionsfileassoc.mieditwith.caption
|
||
msgid "Edit with..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
||
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
|
||
msgid "Get output from command"
|
||
msgstr "Отримати вивід команди"
|
||
|
||
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
||
msgid "Open in Internal Editor"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
||
msgid "Open in Internal Viewer"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.miopen.caption
|
||
msgctxt "tfrmoptionsfileassoc.miopen.caption"
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: tfrmoptionsfileassoc.miopenwith.caption
|
||
msgid "Open with..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.miseparator.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.mishell.caption
|
||
msgctxt "tfrmoptionsfileassoc.mishell.caption"
|
||
msgid "Run in terminal"
|
||
msgstr "Запустити у терміналі"
|
||
|
||
#: tfrmoptionsfileassoc.miview.caption
|
||
msgctxt "tfrmoptionsfileassoc.miview.caption"
|
||
msgid "View"
|
||
msgstr "Перегляд"
|
||
|
||
#: tfrmoptionsfileassoc.miviewer.caption
|
||
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
|
||
msgid "Open in Viewer"
|
||
msgstr "Відкрити у переглядачі"
|
||
|
||
#: tfrmoptionsfileassoc.miviewwith.caption
|
||
msgid "View with..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.sbtnicon.hint
|
||
msgid "Click me to change icon!"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
||
msgid "Execute via shell"
|
||
msgstr "Виконати через оболонку"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
||
msgid "Extended context menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
||
msgid "File association configuration"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
||
msgid "Offer to add selection to file association when not included already"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Виконати через термінал і закрити"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Виконати через термінал і лишити відкритим"
|
||
|
||
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
||
msgid "Extended options items:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
||
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
|
||
msgid "Show confirmation window for:"
|
||
msgstr "Показувати вікно підтвердження для:"
|
||
|
||
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
||
msgid "Cop&y operation"
|
||
msgstr "Операції &копіювання"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
||
msgid "&Delete operation"
|
||
msgstr "Операції &видалення"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDELETETOTRASH.CAPTION"
|
||
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
||
msgstr "F8/Del - видалення в Кошик (з Shift - на&завжди)"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
||
msgid "D&elete to trash operation"
|
||
msgstr "Операції видалення до к&ошика"
|
||
|
||
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "D&rop readonly flag"
|
||
msgstr "С&кинути прапорець \"Лише читання\""
|
||
|
||
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
||
msgid "&Move operation"
|
||
msgstr "Операції &переміщення"
|
||
|
||
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBPROCESSCOMMENTS.CAPTION"
|
||
msgid "&Process comments with files/folders"
|
||
msgstr "О&працьовувати коментарі з файлами/каталогами"
|
||
|
||
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBRENAMESELONLYNAME.CAPTION"
|
||
msgid "Select &file name without extension when renaming"
|
||
msgstr "П&ри перейменуванні виділяти лише ім'я файлу (без розширення)"
|
||
|
||
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSHOWCOPYTABSELECTPANEL.CAPTION"
|
||
msgid "Sho&w tab select panel in copy/move dialog"
|
||
msgstr "Показу&вати панель вибору вкладок при перейменування/переміщенні"
|
||
|
||
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSKIPFILEOPERROR.CAPTION"
|
||
msgid "S&kip file operations errors and write them to log window"
|
||
msgstr "Пропус&кати помилки при файлових операціях і заносити їх у звіт"
|
||
|
||
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
||
msgid "Executing operations"
|
||
msgstr "Виконання операцій"
|
||
|
||
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
||
msgid "User interface"
|
||
msgstr "Інтерфейс користувача"
|
||
|
||
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
||
msgid "&Buffer size for file operations (in KB):"
|
||
msgstr "Розмір &буфера для операцій з файлами (в КB):"
|
||
|
||
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
||
msgid "Buffer size for &hash calculation (in KB):"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
||
msgid "Show operations progress &initially in"
|
||
msgstr "Показати прогрес &операцій спочатку в"
|
||
|
||
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
||
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
|
||
msgid "Duplicated name auto-rename style:"
|
||
msgstr "Стиль автопереіменування співпадаючих імен:"
|
||
|
||
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLWIPEPASSNUMBER.CAPTION"
|
||
msgid "&Number of wipe passes:"
|
||
msgstr "Кіл-&ть проходів стирання:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
||
msgid "Reset to DC default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Дозволити виділення кольором"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEFRAMECURSOR.CAPTION"
|
||
msgid "Use &Frame Cursor"
|
||
msgstr "Використовувати курсор-&рамку"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
||
msgid "Use &Gradient Indicator"
|
||
msgstr "Використовувати &градієнтну заливку індикатора"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Sel Color"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "U&se Inverted Selection"
|
||
msgstr "В&икористовувати інверсне виділення"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Межі курсору"
|
||
|
||
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
|
||
msgid "Drive Free Space Indicator"
|
||
msgstr "Керування індикатором вільного місця"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR.CAPTION"
|
||
msgid "Bac&kground:"
|
||
msgstr "&Фон:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
|
||
msgid "Backg&round 2:"
|
||
msgstr "Фон &2:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
|
||
msgid "C&ursor Color:"
|
||
msgstr "Колір к&урсора"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
|
||
msgid "Cursor Te&xt:"
|
||
msgstr "Текст під курсоро&м"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEPANELBRIGHTNESS.CAPTION"
|
||
msgid "&Brightness level of inactive panel"
|
||
msgstr "Рівень &яскравості неактивної панелі"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
||
msgid "In&dicator Back Color:"
|
||
msgstr "Колір віл&ьного місця:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
||
msgid "&Indicator Fore Color:"
|
||
msgstr "Колір заповненн&я:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
|
||
msgid "&Mark Color:"
|
||
msgstr "Ко&лір виділення:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
||
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
|
||
msgid "T&ext Color:"
|
||
msgstr "Колір &тексту:"
|
||
|
||
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
||
msgid "When launching file search, clear file mask filter"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
||
msgid "&Search for part of file name"
|
||
msgstr "&Шукати по частині імені файла"
|
||
|
||
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
||
msgid "Show menu bar in \"Find files\""
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
||
msgid "Text search in files"
|
||
msgstr "Пошук тексту у файлах"
|
||
|
||
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
|
||
msgid "File search"
|
||
msgstr "Пошук файлів"
|
||
|
||
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
||
msgid "Current filters with \"New search\" button:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
||
msgid "Default search template:"
|
||
msgstr "Типовий шаблон для пошуку:"
|
||
|
||
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
||
msgid "Use memory mapping for search te&xt in files"
|
||
msgstr "Використати відображенн&я в пам'ять при пошуку тексту у файлах"
|
||
|
||
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
||
msgid "&Use stream for search text in files"
|
||
msgstr "Використати п&отік при пошуку тексту в файлах"
|
||
|
||
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Додати"
|
||
|
||
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "До&відка"
|
||
|
||
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
||
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
||
msgid "Do&n't load file list until a tab is activated"
|
||
msgstr "Не зава&нтажувати список файлів доки вкладка не активна"
|
||
|
||
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBDIRBRACKETS.CAPTION"
|
||
msgid "S&how square brackets around directories"
|
||
msgstr "Показувати квадратні ду&жки навколо каталогів"
|
||
|
||
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
||
msgid "Hi&ghlight new and updated files"
|
||
msgstr "Виділяти но&ві та оновлені файли"
|
||
|
||
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
||
msgid "Enable inplace &renaming when clicking twice on a name"
|
||
msgstr "Увімкнути &оперативне переіменування при подвійному клацанні на імені"
|
||
|
||
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
|
||
msgid "Load &file list in separate thread"
|
||
msgstr "Завантажувати список &файлів в окремому потоці"
|
||
|
||
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
|
||
msgid "Load icons af&ter file list"
|
||
msgstr "Завантажувати іконки після сп&иску"
|
||
|
||
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
|
||
msgid "Show s&ystem and hidden files"
|
||
msgstr "Показувати системні та п&риховані файли"
|
||
|
||
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBSPACEMOVESDOWN.CAPTION"
|
||
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
||
msgstr "При виділенні файлів пр&обілом переміщувати курсор на наступний файл (як в <INSERT>)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
|
||
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
|
||
msgid "Use an independant attribute filter in mask input dialog each time"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.gbformatting.caption
|
||
msgid "Formatting"
|
||
msgstr "Форматування"
|
||
|
||
#: tfrmoptionsfilesviews.gbmarking.caption
|
||
msgid "Marking/Unmarking entries"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.gbsorting.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.GBSORTING.CAPTION"
|
||
msgid "Sorting"
|
||
msgstr "Сортування"
|
||
|
||
#: tfrmoptionsfilesviews.lbattributemask.caption
|
||
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
|
||
msgid "Default attribute mask value to use:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
||
msgid "Case s&ensitivity:"
|
||
msgstr "&Чутливість до регістру:"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.lblDateTimeExample.CAPTION"
|
||
msgid "Incorrect format"
|
||
msgstr "Неправильний формат"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.LBLDATETIMEFORMAT.CAPTION"
|
||
msgid "&Date and time format:"
|
||
msgstr "Формат &дати і часу:"
|
||
|
||
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
||
msgid "File si&ze format:"
|
||
msgstr "&Формат розміру файла:"
|
||
|
||
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
||
msgid "&Insert new files:"
|
||
msgstr "Вставити нов&і файли:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
||
msgid "So&rting directories:"
|
||
msgstr "Со&ртування каталогів:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.LBLSORTMETHOD.CAPTION"
|
||
msgid "&Sort method:"
|
||
msgstr "&Метод сортування:"
|
||
|
||
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
||
msgid "&Move updated files:"
|
||
msgstr "Перемістити оновлені фай&ли:"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "До&дати"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Застосувати"
|
||
|
||
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "&Видалити"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Шаблон..."
|
||
|
||
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.GBFILETYPESCOLORS.CAPTION"
|
||
msgid "File types colors (sort by drag&&drop)"
|
||
msgstr "Кольори за &типом файлу (сортувати перетягуванням)"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYATTR.CAPTION"
|
||
msgid "Category a&ttributes:"
|
||
msgstr "&Атрибути категорії:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYCOLOR.CAPTION"
|
||
msgid "Category co&lor:"
|
||
msgstr "&Колір категорії:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "&Маска категорії:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "&Назва категорії:"
|
||
|
||
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnseleditfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsellogfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselmainfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.lblconsolefont.caption
|
||
msgid "&Console font"
|
||
msgstr "Шрифт &консолі"
|
||
|
||
#: tfrmoptionsfonts.lbleditorfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
|
||
msgid "&Editor font"
|
||
msgstr "Шрифт &редактора"
|
||
|
||
#: tfrmoptionsfonts.lbllogfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
|
||
msgid "&Log font"
|
||
msgstr "Шрифт &логу"
|
||
|
||
#: tfrmoptionsfonts.lblmainfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
|
||
msgid "Main &font"
|
||
msgstr "Основний &шрифт"
|
||
|
||
#: tfrmoptionsfonts.lblpatheditfont.caption
|
||
msgid "Path font"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
||
msgid "Search results font"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
|
||
msgid "Viewer&Book Font"
|
||
msgstr "Шрифт переглядача &книг"
|
||
|
||
#: tfrmoptionsfonts.lblviewerfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
|
||
msgid "&Viewer font"
|
||
msgstr "Шрифт &переглядача"
|
||
|
||
#: tfrmoptionshotkeys.actaddhotkey.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
|
||
msgid "Add &hotkey"
|
||
msgstr "Додати &гар.кл."
|
||
|
||
#: tfrmoptionshotkeys.actcopy.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmoptionshotkeys.actdelete.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
|
||
msgid "&Delete hotkey"
|
||
msgstr "&Видалити гар.кл."
|
||
|
||
#: tfrmoptionshotkeys.actedithotkey.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
|
||
msgid "&Edit hotkey"
|
||
msgstr "&Редагувати гар.кл."
|
||
|
||
#: tfrmoptionshotkeys.actnextcategory.caption
|
||
msgid "Next category"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
||
msgid "Make popup the file related menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
||
msgid "Previous category"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actrename.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Перейменувати"
|
||
|
||
#: tfrmoptionshotkeys.actrestoredefault.caption
|
||
msgid "Restore DC default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actsavenow.caption
|
||
msgid "Save now"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actsortbycommand.caption
|
||
msgid "Sort by command name"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
||
msgid "Sort by hotkeys (grouped)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
||
msgid "Sort by hotkeys (one per row)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.lbfilter.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
|
||
msgid "&Filter"
|
||
msgstr "&Фільтр"
|
||
|
||
#: tfrmoptionshotkeys.lblcategories.caption
|
||
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
|
||
msgid "C&ategories:"
|
||
msgstr "К&атегорії:"
|
||
|
||
#: tfrmoptionshotkeys.lblcommands.caption
|
||
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
|
||
msgid "Co&mmands:"
|
||
msgstr "Ко&манди:"
|
||
|
||
#: tfrmoptionshotkeys.lblscfiles.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
|
||
msgid "&Shortcut files:"
|
||
msgstr "&Ярлики:"
|
||
|
||
#: tfrmoptionshotkeys.lblsortorder.caption
|
||
msgid "So&rt order:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.micategories.caption
|
||
msgid "Categories"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.micommands.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.micommands.caption"
|
||
msgid "Command"
|
||
msgstr "Команди"
|
||
|
||
#: tfrmoptionshotkeys.miseparator1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionshotkeys.misortorder.caption
|
||
msgid "Sort order"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.cbiconsexclude.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Для наступних шляхів і їх підкаталогів:"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenus.caption
|
||
msgid "Show icons for actions in &menus"
|
||
msgstr "Показувати іконки для дій в &меню"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenussize.text
|
||
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
||
msgid "Show icons on buttons"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
|
||
msgid "Show o&verlay icons, e.g. for links"
|
||
msgstr "Показувати оверле&йні &іконки (наприклад для ярликів)"
|
||
|
||
#: tfrmoptionsicons.cbiconssize.text
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSSIZE.TEXT"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
||
msgid "Disable special icons"
|
||
msgstr "Вимкнути спеціальні іконки"
|
||
|
||
#: tfrmoptionsicons.gbiconsinmenus.caption
|
||
msgid "Icons in menus"
|
||
msgstr "Іконки в меню"
|
||
|
||
#: tfrmoptionsicons.gbiconsonbuttons.caption
|
||
msgid "Icons on buttons"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.gbiconssize.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
|
||
msgid " Icon size "
|
||
msgstr "Розмір іконок"
|
||
|
||
#: tfrmoptionsicons.gbshowiconsmode.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
|
||
msgid " Show icons to the left of the filename "
|
||
msgstr " Показ іконок зв’язаних з типом файлу "
|
||
|
||
#: tfrmoptionsicons.rbiconsshowall.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
||
msgid "A&ll"
|
||
msgstr "&Усі"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
|
||
msgid "All associated + &EXE/LNK (slow)"
|
||
msgstr "Усі асоційовані + &EXE/LNK (повільно)"
|
||
|
||
#: tfrmoptionsicons.rbiconsshownone.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
|
||
msgid "&No icons"
|
||
msgstr "&Без іконок"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
|
||
msgid "Only &standard icons"
|
||
msgstr "Лише &стандартні іконки"
|
||
|
||
#: tfrmoptionsignorelist.btnaddsel.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
|
||
msgid "A&dd selected names"
|
||
msgstr "До&дати виділені імена"
|
||
|
||
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
|
||
msgid "Add selected names with &full path"
|
||
msgstr "Додати виділені імена з &повними шляхами"
|
||
|
||
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях"
|
||
|
||
#: tfrmoptionsignorelist.chkignoreenable.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
|
||
msgid "&Ignore (don't show) the following files and folders:"
|
||
msgstr "&Ігнорувати (не показувати) такі файли і папки:"
|
||
|
||
#: tfrmoptionsignorelist.lblsavein.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
|
||
msgid "&Save in:"
|
||
msgstr "&Зберегти в:"
|
||
|
||
#: tfrmoptionskeyboard.cblynxlike.caption
|
||
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
||
msgstr "Зміна каталогу с&трілками Вліво, Вправо (Навігація в стилі Lynx)"
|
||
|
||
#: tfrmoptionskeyboard.gbtyping.caption
|
||
#, fuzzy
|
||
msgid "Typing"
|
||
msgstr "Введення"
|
||
|
||
#: tfrmoptionskeyboard.lblalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
|
||
msgid "Alt+L&etters:"
|
||
msgstr "Alt+Літ&ери:"
|
||
|
||
#: tfrmoptionskeyboard.lblctrlalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
|
||
msgid "Ctrl+Alt+Le&tters:"
|
||
msgstr "Ctrl+Alt+Лі&тери:"
|
||
|
||
#: tfrmoptionskeyboard.lblnomodifier.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
|
||
msgid "&Letters:"
|
||
msgstr "&Літери:"
|
||
|
||
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
|
||
msgid "&Flat buttons"
|
||
msgstr "Пло&скі кнопки"
|
||
|
||
#: tfrmoptionslayout.cbflatinterface.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
|
||
msgid "Flat i&nterface"
|
||
msgstr "Плоский і&нтерфейс"
|
||
|
||
#: tfrmoptionslayout.cbflattoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
|
||
msgid "Flat b&uttons"
|
||
msgstr "Пл&оскі кнопки"
|
||
|
||
#: tfrmoptionslayout.cbfreespaceind.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
|
||
msgid "Show fr&ee space indicator on drive label"
|
||
msgstr "Показувати індикатор вільного місця на пан&елі дисків"
|
||
|
||
#: tfrmoptionslayout.cblogwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
|
||
msgid "Show lo&g window"
|
||
msgstr "Показувати &вікно звіту"
|
||
|
||
#: tfrmoptionslayout.cbpanelofoperations.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
|
||
msgid "Show panel of operation in background"
|
||
msgstr "Показувати панель операцій у фоні"
|
||
|
||
#: tfrmoptionslayout.cbproginmenubar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
|
||
msgid "Show common progress in menu bar"
|
||
msgstr "Показувати загальний прогрес в рядку меню"
|
||
|
||
#: tfrmoptionslayout.cbshowcmdline.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
|
||
msgid "Show command l&ine"
|
||
msgstr "Показувати &командний рядок"
|
||
|
||
#: tfrmoptionslayout.cbshowcurdir.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
|
||
msgid "Show current director&y"
|
||
msgstr "Показувати по&точний каталог"
|
||
|
||
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
|
||
msgid "Show &drive buttons"
|
||
msgstr "Показувати кнопки &дисків"
|
||
|
||
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
|
||
msgid "Show free s&pace label"
|
||
msgstr "Показувати індикатор вільного міс&ця"
|
||
|
||
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
||
msgid "Show drives list bu&tton"
|
||
msgstr "Показувати кнопки мен&ю дисків"
|
||
|
||
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
|
||
msgid "Show function &key buttons"
|
||
msgstr "Показувати кнопки &функціональних клавіш"
|
||
|
||
#: tfrmoptionslayout.cbshowmainmenu.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
|
||
msgid "Show &main menu"
|
||
msgstr "Показувати &головне меню"
|
||
|
||
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
||
#, fuzzy
|
||
#| msgid "Show &button bar"
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
|
||
msgid "Show tool&bar"
|
||
msgstr "Показувати &панель кнопок"
|
||
|
||
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
||
msgid "Show short free space &label"
|
||
msgstr "Короткий індикатор ві&льного місця"
|
||
|
||
#: tfrmoptionslayout.cbshowstatusbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
|
||
msgid "Show &status bar"
|
||
msgstr "Показувати рядок стану"
|
||
|
||
#: tfrmoptionslayout.cbshowtabheader.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
|
||
msgid "S&how tabstop header"
|
||
msgstr "Показувати &заголовки табуляторів"
|
||
|
||
#: tfrmoptionslayout.cbshowtabs.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
|
||
msgid "Sho&w folder tabs"
|
||
msgstr "Показувати вкл&адки"
|
||
|
||
#: tfrmoptionslayout.cbtermwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
|
||
msgid "Show te&rminal window"
|
||
msgstr "Показувати вікно терм&іналу"
|
||
|
||
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
|
||
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
||
msgstr "Показувати д&ві панелі кнопок дисків (фіксована довжина, над файловими панелями)"
|
||
|
||
#: tfrmoptionslayout.gbscreenlayout.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
|
||
msgid " Screen layout "
|
||
msgstr " Компоненти основного вікна "
|
||
|
||
#: tfrmoptionslog.btnrelativelogfile.hint
|
||
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях"
|
||
|
||
#: tfrmoptionslog.btnviewlogfile.hint
|
||
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Переглянути вміст звіту"
|
||
|
||
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
||
msgid "Include date in log filename"
|
||
msgstr "Додавати дату до імені звіту"
|
||
|
||
#: tfrmoptionslog.cblogarcop.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
|
||
msgid "&Pack/Unpack"
|
||
msgstr "Запак&увати/Розпакувати"
|
||
|
||
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
||
msgid "External command line execution"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionslog.cblogcpmvln.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
|
||
msgid "Cop&y/Move/Create link/symlink"
|
||
msgstr "Копі&ювання/Переміщення/Створення посилань"
|
||
|
||
#: tfrmoptionslog.cblogdelete.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Ви&далити"
|
||
|
||
#: tfrmoptionslog.cblogdirop.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
|
||
msgid "Crea&te/Delete directories"
|
||
msgstr "Створення/Видалення ка&талогів"
|
||
|
||
#: tfrmoptionslog.cblogerrors.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
|
||
msgid "Log &errors"
|
||
msgstr "Звіт &помилок"
|
||
|
||
#: tfrmoptionslog.cblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
|
||
msgid "C&reate a log file:"
|
||
msgstr "&Створити файл звіту:"
|
||
|
||
#: tfrmoptionslog.cbloginfo.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
|
||
msgid "Log &information messages"
|
||
msgstr "Звіт &інформаційних повідомлень"
|
||
|
||
#: tfrmoptionslog.cblogstartshutdown.caption
|
||
msgid "Start/shutdown"
|
||
msgstr "Пуск/Завершення роботи"
|
||
|
||
#: tfrmoptionslog.cblogsuccess.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
|
||
msgid "Log &successful operations"
|
||
msgstr "Звіт про ус&пішні операції"
|
||
|
||
#: tfrmoptionslog.cblogvfs.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
|
||
msgid "&File system plugins"
|
||
msgstr "Плагіни &файлової системи"
|
||
|
||
#: tfrmoptionslog.gblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
|
||
msgid "File operation log file"
|
||
msgstr "Звіт про операції з файлами"
|
||
|
||
#: tfrmoptionslog.gblogfileop.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILEOP.CAPTION"
|
||
msgid "Log operations"
|
||
msgstr "Підзвітні дії"
|
||
|
||
#: tfrmoptionslog.gblogfilestatus.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILESTATUS.CAPTION"
|
||
msgid "Operation status"
|
||
msgstr "Статус операції"
|
||
|
||
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
||
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях"
|
||
|
||
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
||
msgid "&Remove thumbnails for no longer existing files"
|
||
msgstr "Видалити мініат&юри для не існуючих файлів"
|
||
|
||
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Переглянути вміст звіту"
|
||
|
||
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
||
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
|
||
msgid "Create new with the encoding:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.chkgotoroot.caption
|
||
msgid "Always &go to the root of a drive when changing drives"
|
||
msgstr "Завжди переходити в &корінь диску при зміні дисків"
|
||
|
||
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
||
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
|
||
msgid "Show &warning messages (\"OK\" button only)"
|
||
msgstr "Показу&вати попередження (лише кнопка \"OK\")"
|
||
|
||
#: tfrmoptionsmisc.chkthumbsave.caption
|
||
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
|
||
msgid "&Save thumbnails in cache"
|
||
msgstr "Зберігати мініат&юри в кеші"
|
||
|
||
#: tfrmoptionsmisc.dblthumbnails.caption
|
||
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Мініатюри"
|
||
|
||
#: tfrmoptionsmisc.gbfilecomments.caption
|
||
msgid "File comments (descript.ion)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.gbtcexportimport.caption
|
||
msgid "Regarding TC export/import:"
|
||
msgstr "Стосовно імпорту/експорту ТС:"
|
||
|
||
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
||
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
|
||
msgid "Default encoding:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.lbltcconfig.caption
|
||
msgid "Configuration file:"
|
||
msgstr "Файл налаштувань:"
|
||
|
||
#: tfrmoptionsmisc.lbltcexecutable.caption
|
||
msgid "TC executable:"
|
||
msgstr "Виконуваний файл ТС:"
|
||
|
||
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
||
msgid "Toolbar output path:"
|
||
msgstr "Шлях до теки з панелями інструментів:"
|
||
|
||
#: tfrmoptionsmisc.lblthumbpixels.caption
|
||
msgid "pixels"
|
||
msgstr "пікселів"
|
||
|
||
#: tfrmoptionsmisc.lblthumbseparator.caption
|
||
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmoptionsmisc.lblthumbsize.caption
|
||
msgid "&Thumbnail size:"
|
||
msgstr "Розмір мініа&тюр:"
|
||
|
||
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
||
msgid "&Selection by mouse"
|
||
msgstr "Виділе&ння мишкою"
|
||
|
||
#: tfrmoptionsmouse.gbscrolling.caption
|
||
msgid "Scrolling"
|
||
msgstr "Прокрутка"
|
||
|
||
#: tfrmoptionsmouse.gbselection.caption
|
||
msgid "Selection"
|
||
msgstr "Виділення"
|
||
|
||
#: tfrmoptionsmouse.lblmousemode.caption
|
||
msgid "&Mode:"
|
||
msgstr "Ре&жим:"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
||
msgid "&Line by line"
|
||
msgstr "Через ряд&ків"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
||
msgid "Line by line &with cursor movement"
|
||
msgstr "Р&ядок за рядком з рухом курсора"
|
||
|
||
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
||
msgid "&Page by page"
|
||
msgstr "&Посторінково"
|
||
|
||
#: tfrmoptionsplugins.btnaddplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "До&дати"
|
||
|
||
#: tfrmoptionsplugins.btnconfigplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "Налашту&вати"
|
||
|
||
#: tfrmoptionsplugins.btnenableplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
|
||
msgid "E&nable"
|
||
msgstr "&Увімкнути"
|
||
|
||
#: tfrmoptionsplugins.btnremoveplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "&Видалити"
|
||
|
||
#: tfrmoptionsplugins.btntweakplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
|
||
msgid "&Tweak"
|
||
msgstr "Пара&метри"
|
||
|
||
#: tfrmoptionsplugins.lbldsxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
|
||
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
||
msgstr "По&шукові плагіни дозволяють використовувати альтернативні алгоритми пошуку або зовнішні засоби (такі як \"locate\", та інші)"
|
||
|
||
#: tfrmoptionsplugins.lblwcxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
|
||
msgid "Pack&er plugins are used to work with archives"
|
||
msgstr "Ар&хіваторні плагіни дозволяють працювати з архівами"
|
||
|
||
#: tfrmoptionsplugins.lblwdxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
|
||
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
||
msgstr "&Інформаційні плагіни дозволяють відображати розширені відомості про файли, такі як mp3 теги або атрибути зображення, або використовувати їх для пошуку або у інструменті масового перейменування."
|
||
|
||
#: tfrmoptionsplugins.lblwfxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
|
||
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
||
msgstr "Плагіни &файлових систем дозволяють звертатися до дисків, недоступних з ОС або до зовнішніх пристроїв, напр. Palm/PocketPC, тощо."
|
||
|
||
#: tfrmoptionsplugins.lblwlxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
|
||
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
||
msgstr "&Плагіни перегляду дозволяють відобразити різні формати файлів, такі як: зображення, бази даних, таблиці та інші у Переглядачі (F3, Ctrl+Q)"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
|
||
msgid "Active"
|
||
msgstr "Активний"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "Плагін"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
|
||
msgid "Registered for"
|
||
msgstr "Асоціації з"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ім'я файлу"
|
||
|
||
#: tfrmoptionsplugins.tsdsx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
|
||
msgid "&Search plugins (.DSX)"
|
||
msgstr "По&шукові плагіни (.DSX)"
|
||
|
||
#: tfrmoptionsplugins.tswcx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
|
||
msgid "Pac&ker plugins (.WCX)"
|
||
msgstr "&Архіваторні плагіни (.WCX)"
|
||
|
||
#: tfrmoptionsplugins.tswdx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
|
||
msgid "Content pl&ugins (.WDX)"
|
||
msgstr "&Контентні плагіни (.WDX)"
|
||
|
||
#: tfrmoptionsplugins.tswfx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
|
||
msgid "F&ile system plugins (.WFX)"
|
||
msgstr "Плагіни &файлової системи (.WFX)"
|
||
|
||
#: tfrmoptionsplugins.tswlx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
|
||
msgid "&Viewer plugins (.WLX)"
|
||
msgstr "Плагіни &перегляду (.WLX)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
|
||
msgid "&Beginning (name must start with first typed character)"
|
||
msgstr "По&чаток (ім'я має починатись з набраних символів)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
|
||
msgid "En&ding (last character before a typed dot . must match)"
|
||
msgstr "Кі&нець (останні символи до набраної крапки '.' повинні співпадати)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Налаштування"
|
||
|
||
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.GBEXACTNAMEMATCH.CAPTION"
|
||
msgid "Exact name match"
|
||
msgstr "Точне співпадіння імені"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
||
msgid "Search case"
|
||
msgstr "Регістр при пошуку"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
||
msgid "Search for these items"
|
||
msgstr "Критерії пошуку"
|
||
|
||
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
||
msgid "Keep renamed name when unlocking a tab"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
|
||
msgid "Activate target &panel when clicking on one of its Tabs"
|
||
msgstr "Робити &панель активною при клацанні по одній з її вкладок"
|
||
|
||
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
|
||
msgid "&Show tab header also when there is only one tab"
|
||
msgstr "Показувати заголовок вкладки, нав&іть якщо вона одна"
|
||
|
||
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
||
msgid "Close duplicate tabs when closing application"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
|
||
msgid "Con&firm close all tabs"
|
||
msgstr "Підтверд&жувати закриття всіх вкладок"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
||
msgid "Confirm close locked tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabslimitoption.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
|
||
msgid "&Limit tab title length to"
|
||
msgstr "&Обмежити розмір заголовка вкладки до"
|
||
|
||
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
|
||
msgid "Show locked tabs &with an asterisk *"
|
||
msgstr "Показувати заблоковані вкладки зі знаком зірочки *"
|
||
|
||
#: tfrmoptionstabs.cbtabsmultilines.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
|
||
msgid "&Tabs on multiple lines"
|
||
msgstr "Розміщати вкладки в декі&лька рядів"
|
||
|
||
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
|
||
msgid "Ctrl+&Up opens new tab in foreground"
|
||
msgstr "Ctrl+&Up відкриває нову вкладку на передньому плані"
|
||
|
||
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
|
||
msgid "Open &new tabs near current tab"
|
||
msgstr "Відкривати &нову вкладку поряд з поточною"
|
||
|
||
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
||
msgid "Reuse existing tab when possible"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
|
||
msgid "Show ta&b close button"
|
||
msgstr "Показувати кнопку закриття &вкладки"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
||
msgid "Always show drive letter in tab title"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.gbtabs.caption
|
||
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
|
||
msgid "Folder tabs headers"
|
||
msgstr "Заголовки вкладок"
|
||
|
||
#: tfrmoptionstabs.lblchar.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
|
||
msgid "characters"
|
||
msgstr "символів"
|
||
|
||
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
||
msgid "Action to do when double click on a tab:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.lbltabsposition.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
|
||
msgid "Ta&bs position"
|
||
msgstr "Поло&ження вкладок"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Ні"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
||
msgid "Right"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after resaving"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
||
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
||
msgid "Default extra settings when saving new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.gbtabs.caption
|
||
msgid "Folder tabs headers extra"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
||
msgid "When restoring tab, existing tabs to keep:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
||
msgid "Tabs saved on left will be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
||
msgid "Tabs saved on right will be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
||
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
||
msgid "Default position in menu when saving a new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edruntermparams.hint
|
||
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
||
msgid "Command for just running terminal:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
||
msgid "Command for running a command in terminal and close after:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
||
msgid "Command for running a command in terminal and stay open:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Команди:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Параметри:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Команди:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Параметри:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermcmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Команди:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Параметри:"
|
||
|
||
#: tfrmoptionstoolbar.btnclonebutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btnclonebutton.caption"
|
||
msgid "C&lone button"
|
||
msgstr "К&лонувати кнопку"
|
||
|
||
#: tfrmoptionstoolbar.btndeletebutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
|
||
msgid "&Delete"
|
||
msgstr "Ви&далити кнопку"
|
||
|
||
#: tfrmoptionstoolbar.btnedithotkey.caption
|
||
msgctxt "tfrmoptionstoolbar.btnedithotkey.caption"
|
||
msgid "Edit hot&key"
|
||
msgstr "Реда&гувати"
|
||
|
||
#: tfrmoptionstoolbar.btninsertbutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btninsertbutton.caption"
|
||
msgid "&Insert new button"
|
||
msgstr "В&ставити нову кнопку"
|
||
|
||
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
||
#, fuzzy
|
||
msgid "Select"
|
||
msgstr "Виділення"
|
||
|
||
#: tfrmoptionstoolbar.btnopenfile.caption
|
||
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnother.caption
|
||
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
||
msgid "Other..."
|
||
msgstr "Інше..."
|
||
|
||
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
||
msgctxt "tfrmoptionstoolbar.btnremovehotkey.caption"
|
||
msgid "Remove hotke&y"
|
||
msgstr "Видалит&и гар.кл."
|
||
|
||
#: tfrmoptionstoolbar.btnstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
||
msgid "Suggest"
|
||
msgstr "Пропозиції"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
||
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
||
msgstr "DC буде пропонувати підказки на основі типу кнопки, команди і параметрів"
|
||
|
||
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
||
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
||
msgid "&Flat buttons"
|
||
msgstr "П&ласкі кнопки"
|
||
|
||
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
||
msgid "Report errors with commands"
|
||
msgstr "Звітувати про помилки з командами"
|
||
|
||
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
||
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
||
msgstr "Введіть параметри команди, кожен в окремому рядку. Натисніть F1, щоб отримати довідку по параметрах."
|
||
|
||
#: tfrmoptionstoolbar.gbgroupbox.caption
|
||
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
|
||
msgid "Appearance"
|
||
msgstr "Вигляд кнопок"
|
||
|
||
#: tfrmoptionstoolbar.lblbarsize.caption
|
||
msgctxt "tfrmoptionstoolbar.lblbarsize.caption"
|
||
msgid "&Bar size:"
|
||
msgstr "Розмір п&анелі:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblexternalcommand.caption"
|
||
msgid "Comman&d:"
|
||
msgstr "Коман&да:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Параметр&и:"
|
||
|
||
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
|
||
msgid "Help"
|
||
msgstr "Довідка"
|
||
|
||
#: tfrmoptionstoolbar.lblhotkey.caption
|
||
msgid "Hot key:"
|
||
msgstr "Гаряча клавіша:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconfile.caption
|
||
msgctxt "tfrmoptionstoolbar.lbliconfile.caption"
|
||
msgid "Ico&n:"
|
||
msgstr "Іко&нка:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconsize.caption
|
||
msgctxt "tfrmoptionstoolbar.lbliconsize.caption"
|
||
msgid "Icon si&ze:"
|
||
msgstr "Р&озмір іконки:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
|
||
msgid "Co&mmand:"
|
||
msgstr "Коман&да:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
|
||
msgid "&Parameters:"
|
||
msgstr "&Параметри:"
|
||
|
||
#: tfrmoptionstoolbar.lblstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "Шля&х запуску:"
|
||
|
||
#: tfrmoptionstoolbar.lbltooltip.caption
|
||
msgctxt "tfrmoptionstoolbar.lbltooltip.caption"
|
||
msgid "&Tooltip:"
|
||
msgstr "Під&казка:"
|
||
|
||
#: tfrmoptionstoolbar.miaddallcmds.caption
|
||
msgid "Add toolbar with ALL DC commands"
|
||
msgstr "Додати панель інструментів зі всіма командами DC"
|
||
|
||
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
||
msgid "for an external command"
|
||
msgstr "для зовнішньої команди"
|
||
|
||
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
||
msgid "for an internal command"
|
||
msgstr "для внутрішньої команди"
|
||
|
||
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
||
msgid "for a separator"
|
||
msgstr "для роздільника"
|
||
|
||
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
||
msgid "for a sub-tool bar"
|
||
msgstr "для підпанелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.mibackup.caption
|
||
msgctxt "tfrmoptionstoolbar.mibackup.caption"
|
||
msgid "Backup..."
|
||
msgstr "Резервне копіювання..."
|
||
|
||
#: tfrmoptionstoolbar.miexport.caption
|
||
msgctxt "tfrmoptionstoolbar.miexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Експортувати..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrent.caption
|
||
msgid "Current toolbar..."
|
||
msgstr "Поточна панель інстументів..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "у файл Панелі інструментів (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "у файл TC .BAR (лишити існуючий)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "у файл TC .BAR (видалити існуючий)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "у файл \"wincmd.ini\" від ТС (лишити існуючий)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "у файл \"wincmd.ini\" від ТС (видалити існуючий)"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator3.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator4.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexporttop.caption
|
||
msgid "Top toolbar..."
|
||
msgstr "Головна панель інструментів..."
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
||
msgid "Save a backup of Toolbar"
|
||
msgstr "Зберегти резервну копію Панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "у файл Панелі інструментів (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "у файл TC .BAR (лишити існуючий)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "у файл TC .BAR (видалити існуючий)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "у файл \"wincmd.ini\" від ТС (лишити існуючий)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "у файл \"wincmd.ini\" від ТС (видалити існуючий)"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "одразу після обраного"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "як перший елемент"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "як останній елемент"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "одразу перед обраним"
|
||
|
||
#: tfrmoptionstoolbar.miimport.caption
|
||
msgctxt "tfrmoptionstoolbar.miimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Імпортувати..."
|
||
|
||
#: tfrmoptionstoolbar.miimportbackup.caption
|
||
msgid "Restore a backup of Toolbar"
|
||
msgstr "Відновити з резервної копії Панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "додати до поточної панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
||
#, fuzzy
|
||
#| msgid "to add to a new toobar to current toolbar"
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "додати до нової панелі на поточній панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "додати до нової панелі на головній панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "додати до головної панелі"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "замінити головну панель інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbar.caption
|
||
msgid "from a Toolbar File (.toolbar)"
|
||
msgstr "з файлу Панель інструментів (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "додати до поточної панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "додати до нової панелі на поточній панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "додати до нової панелі на головній панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "додати до головної панелі"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "замінити головну панель інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimportseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbar.caption
|
||
msgid "from a single TC .BAR file"
|
||
msgstr "з одного файлу ТС .BAR"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "додати до поточної панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
||
#, fuzzy
|
||
#| msgid "to add to a new toobar to current toolbar"
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "додати до нової панелі на поточній панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "додати до нової панелі на головній панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "додати до головної панелі"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "замінити головну панель інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcini.caption
|
||
msgid "from \"wincmd.ini\" of TC..."
|
||
msgstr "з файлу \"wincmd.ini\" від ТС..."
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "додати до поточної панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
||
#, fuzzy
|
||
#| msgid "to add to a new toobar to current toolbar"
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "додати до нової панелі на поточній панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "додати до нової панелі на головній панелі інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "додати до головної панелі"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "замінити головну панель інструментів"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "одразу після обраного"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "as first element"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "як останній елемент"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "одразу перед обраним"
|
||
|
||
#: tfrmoptionstoolbar.misearchandreplace.caption
|
||
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
|
||
msgid "Search and replace..."
|
||
msgstr "Знайти і замінити..."
|
||
|
||
#: tfrmoptionstoolbar.miseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator10.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator11.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator13.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator14.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator6.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator7.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator8.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator9.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "одразу після обраного"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
||
msgid "as first element"
|
||
msgstr "як перший елемент"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "як останній елемент"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "одразу перед обраним"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
||
msgid "in all of all the above..."
|
||
msgstr "в усіх усіх вищезгаданих..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
||
msgid "in all commands..."
|
||
msgstr "у всіх командах..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
||
msgid "in all icon names..."
|
||
msgstr "у всіх іменах іконок..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
||
msgid "in all parameters..."
|
||
msgstr "у всіх параметрах..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
||
msgid "in all start path..."
|
||
msgstr "у всіх шляхах запуску..."
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "одразу після обраного"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "as first element"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "як останній елемент"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "одразу перед обраним"
|
||
|
||
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
||
msgid "Button type"
|
||
msgstr "Тип кнопки"
|
||
|
||
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSKEEPTERMINALOPEN.CAPTION"
|
||
msgid "&Keep terminal window open after executing program"
|
||
msgstr "Тримати ві&кно терміналу відкритим після виконання програми"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSRUNINTERMINAL.CAPTION"
|
||
msgid "&Execute in terminal"
|
||
msgstr "Виконати у т&ерміналі"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSUSEEXTERNALPROGRAM.CAPTION"
|
||
msgid "&Use external program"
|
||
msgstr "Використовувати &зовнішню програму"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPARAMETERS.CAPTION"
|
||
msgid "A&dditional parameters"
|
||
msgstr "Додатков&і параметри"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolspath.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPATH.CAPTION"
|
||
msgid "&Path to program to execute"
|
||
msgstr "&Шлях до зовнішньої програми"
|
||
|
||
#: tfrmoptionstooltips.btnaddfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "До&дати"
|
||
|
||
#: tfrmoptionstooltips.btnapplyfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Застосувати"
|
||
|
||
#: tfrmoptionstooltips.btndeletefields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "&Видалити"
|
||
|
||
#: tfrmoptionstooltips.btnfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Шаблон..."
|
||
|
||
#: tfrmoptionstooltips.chkshowtooltip.caption
|
||
#, fuzzy
|
||
#| msgid "Show tool tip"
|
||
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
|
||
msgid "&Show tooltip for files in the file panel"
|
||
msgstr "Показати спливаючі підказки"
|
||
|
||
#: tfrmoptionstooltips.gbcustomfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
|
||
msgid "Custom fields by file type"
|
||
msgstr "Додаткові поля за типами файлів"
|
||
|
||
#: tfrmoptionstooltips.lblfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
|
||
msgid "Category &hint:"
|
||
msgstr "&Підказка категорії:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsmask.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "&Маска категорії:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsname.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "&Назва категорії:"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
||
msgid "With double-click on the bar on top of a file panel"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
||
msgid "Double click in tree select and exit"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
||
msgid "With double-click on a tab (if configured for it)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
||
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
||
msgid "Single mouse click in tree select and exit"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
||
msgid "Use it for Command Line History"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
||
msgid "Use it for the Dir History"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
||
msgid "Use it for the View History (Visited paths for active view)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
||
msgid "Behavior regarding selection:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
||
msgid "Tree View Menus related options:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
||
msgid "Where to use Tree View Menus:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lblnote.caption
|
||
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
||
msgid "With Directory Hotlist:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
||
msgid "With Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
||
msgid "With History:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
||
msgid "Use and display keyboard shortcut for choosing items"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
||
msgid "Layout and colors options:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
||
msgid "Background color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
||
msgid "Cursor color:"
|
||
msgstr "Колір курсора"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
||
msgid "Found text color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
||
msgid "Found text under cursor:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
||
msgid "Normal text color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
||
msgid "Normal text under cursor:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
||
msgid "Tree View Menu Preview:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
||
msgid "Secondary text color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
||
msgid "Secondary text under cursor:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
||
msgid "Shortcut color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
||
msgid "Shortcut under cursor:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
||
msgid "Unselectable text color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
||
msgid "Unselectable under cursor:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
||
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWERBOOKMODE.CAPTION"
|
||
msgid "Viewer Book Mode"
|
||
msgstr "Режим перегляду книг"
|
||
|
||
#: tfrmoptionsviewer.gbviewerexample.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
|
||
msgid "Example"
|
||
msgstr "Приклад"
|
||
|
||
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLBACKGROUNDCOLORVIEWERBOOK.CAPTION"
|
||
msgid "&Background color in book viewer"
|
||
msgstr "Колір ф&ону в переглядачі книг"
|
||
|
||
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLFONTCOLORVIEWERBOOK.CAPTION"
|
||
msgid "&Font color in book viewer"
|
||
msgstr "Колір шри&фту в переглядачі книг"
|
||
|
||
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLNUMBERCOLUMNSVIEWER.CAPTION"
|
||
msgid "&Number of columns in book viewer"
|
||
msgstr "К-сть колонок у переглядачі к&ниг"
|
||
|
||
#: tfrmpackdlg.btnconfig.caption
|
||
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "&Налаштувати"
|
||
|
||
#: tfrmpackdlg.caption
|
||
msgctxt "TFRMPACKDLG.CAPTION"
|
||
msgid "Pack files"
|
||
msgstr "Упакування файлів"
|
||
|
||
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
||
msgid "C&reate separate archives, one per selected file/dir"
|
||
msgstr "Окремі архіви для кожн&ого вибраного файлу/каталогу"
|
||
|
||
#: tfrmpackdlg.cbcreatesfx.caption
|
||
msgid "Create self e&xtracting archive"
|
||
msgstr "Створити само&розпаковуваний архів"
|
||
|
||
#: tfrmpackdlg.cbencrypt.caption
|
||
msgid "Encr&ypt"
|
||
msgstr "&Шифрувати"
|
||
|
||
#: tfrmpackdlg.cbmovetoarchive.caption
|
||
msgid "Mo&ve to archive"
|
||
msgstr "Перем&істити в архів"
|
||
|
||
#: tfrmpackdlg.cbmultivolume.caption
|
||
msgid "&Multiple disk archive"
|
||
msgstr "Багатото&мний архів"
|
||
|
||
#: tfrmpackdlg.cbotherplugins.caption
|
||
msgid "=>"
|
||
msgstr "=>"
|
||
|
||
#: tfrmpackdlg.cbputintarfirst.caption
|
||
msgid "P&ut in the TAR archive first"
|
||
msgstr "Сперш&у помістити в TAR архів"
|
||
|
||
#: tfrmpackdlg.cbstoredir.caption
|
||
msgid "Also &pack path names (only recursed)"
|
||
msgstr "Зберігати шляхи"
|
||
|
||
#: tfrmpackdlg.lblprompt.caption
|
||
msgid "Pack file(s) to the file:"
|
||
msgstr "Ім'я архіву:"
|
||
|
||
#: tfrmpackdlg.rgpacker.caption
|
||
msgid "Packer"
|
||
msgstr "Пакувальник"
|
||
|
||
#: tfrmpackinfodlg.btnclose.caption
|
||
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
||
msgid "Unpack &all and execute"
|
||
msgstr "Розпакувати все і виконати"
|
||
|
||
#: tfrmpackinfodlg.btnunpackandexec.caption
|
||
msgid "&Unpack and execute"
|
||
msgstr "Розпакувати і виконати"
|
||
|
||
#: tfrmpackinfodlg.caption
|
||
msgctxt "TFRMPACKINFODLG.CAPTION"
|
||
msgid "Properties of packed file"
|
||
msgstr "Властивості стисненого файлу"
|
||
|
||
#: tfrmpackinfodlg.lblattributes.caption
|
||
msgid "Attributes:"
|
||
msgstr "Атрибути:"
|
||
|
||
#: tfrmpackinfodlg.lblcompressionratio.caption
|
||
msgid "Compression ratio:"
|
||
msgstr "Коефіцієнт стиснення:"
|
||
|
||
#: tfrmpackinfodlg.lbldate.caption
|
||
msgid "Date:"
|
||
msgstr "Дата:"
|
||
|
||
#: tfrmpackinfodlg.lblmethod.caption
|
||
msgid "Method:"
|
||
msgstr "Метод:"
|
||
|
||
#: tfrmpackinfodlg.lbloriginalsize.caption
|
||
msgid "Original size:"
|
||
msgstr "Оригінальний розмір:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedfile.caption
|
||
msgid "File:"
|
||
msgstr "Файл:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedsize.caption
|
||
msgid "Packed size:"
|
||
msgstr "Розмір стисненого:"
|
||
|
||
#: tfrmpackinfodlg.lblpacker.caption
|
||
msgid "Packer:"
|
||
msgstr "Пакувальник:"
|
||
|
||
#: tfrmpackinfodlg.lbltime.caption
|
||
msgid "Time:"
|
||
msgstr "Час:"
|
||
|
||
#: tfrmquicksearch.btncancel.caption
|
||
msgctxt "tfrmquicksearch.btncancel.caption"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmquicksearch.btncancel.hint
|
||
msgid "Close filter panel"
|
||
msgstr "Закрити панель фільтрів"
|
||
|
||
#: tfrmquicksearch.edtsearch.hint
|
||
msgid "Enter text to search for or filter by"
|
||
msgstr "Введіть текст для пошуку чи фільтрації"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.caption
|
||
msgid "Aa"
|
||
msgstr "Aa"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.hint
|
||
msgid "Case Sensitive"
|
||
msgstr "Чутливість до регістру"
|
||
|
||
#: tfrmquicksearch.sbdirectories.caption
|
||
msgid "D"
|
||
msgstr "D"
|
||
|
||
#: tfrmquicksearch.sbdirectories.hint
|
||
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
||
msgid "Directories"
|
||
msgstr "Каталоги"
|
||
|
||
#: tfrmquicksearch.sbfiles.caption
|
||
msgid "F"
|
||
msgstr "F"
|
||
|
||
#: tfrmquicksearch.sbfiles.hint
|
||
msgctxt "tfrmquicksearch.sbfiles.hint"
|
||
msgid "Files"
|
||
msgstr "Файли"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.caption
|
||
msgid "{"
|
||
msgstr "{"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.hint
|
||
msgid "Match Beginning"
|
||
msgstr "Початок співпадіння"
|
||
|
||
#: tfrmquicksearch.sbmatchending.caption
|
||
msgid "}"
|
||
msgstr "}"
|
||
|
||
#: tfrmquicksearch.sbmatchending.hint
|
||
msgid "Match Ending"
|
||
msgstr "Кінець співпадіння"
|
||
|
||
#: tfrmquicksearch.tglfilter.caption
|
||
msgctxt "tfrmquicksearch.tglfilter.caption"
|
||
msgid "Filter"
|
||
msgstr "Фільтр"
|
||
|
||
#: tfrmquicksearch.tglfilter.hint
|
||
msgid "Toggle between search or filter"
|
||
msgstr "Перемикання між режимами пошуку або фільтра"
|
||
|
||
#: tfrmsearchplugin.btnadd.caption
|
||
msgid "&More rules"
|
||
msgstr "Д&одати правила"
|
||
|
||
#: tfrmsearchplugin.btndelete.caption
|
||
msgid "L&ess rules"
|
||
msgstr "П&рибрати правила"
|
||
|
||
#: tfrmsearchplugin.chkuseplugins.caption
|
||
msgid "Use &content plugins, combine with:"
|
||
msgstr "Використати контент-плагіни, комбінуючи з:"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[0].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
|
||
msgid "Plugin"
|
||
msgstr "Плагін"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[1].text
|
||
msgid "Field"
|
||
msgstr "Поле"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[2].text
|
||
msgid "Operator"
|
||
msgstr "Оператор"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[3].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
||
msgid "Value"
|
||
msgstr "Значення"
|
||
|
||
#: tfrmsearchplugin.rband.caption
|
||
msgid "&AND (all match)"
|
||
msgstr "&AND (всі правила)"
|
||
|
||
#: tfrmsearchplugin.rbor.caption
|
||
msgid "&OR (any match)"
|
||
msgstr "&OR (будь-яке правило)"
|
||
|
||
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: tfrmselecttextrange.btppanel.closebutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "До&відка"
|
||
|
||
#: tfrmselecttextrange.btppanel.okbutton.caption
|
||
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmselecttextrange.lblselecttext.caption
|
||
msgid "&Select the characters to insert:"
|
||
msgstr "Виберіть &символи для вставки:"
|
||
|
||
#: tfrmsetfileproperties.btncancel.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmsetfileproperties.btnok.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmsetfileproperties.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change attributes"
|
||
msgstr "Змінити атрибути"
|
||
|
||
#: tfrmsetfileproperties.cbsgid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmsetfileproperties.cbsticky.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Закріплювальний біт"
|
||
|
||
#: tfrmsetfileproperties.cbsuid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmsetfileproperties.chkarchive.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
|
||
msgid "Archive"
|
||
msgstr "Архівний"
|
||
|
||
#: tfrmsetfileproperties.chkcreationtime.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
|
||
msgid "Created:"
|
||
msgstr "Створений:"
|
||
|
||
#: tfrmsetfileproperties.chkhidden.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
|
||
msgid "Hidden"
|
||
msgstr "Прихований"
|
||
|
||
#: tfrmsetfileproperties.chklastaccesstime.caption
|
||
msgid "Accessed:"
|
||
msgstr "Доступний:"
|
||
|
||
#: tfrmsetfileproperties.chklastwritetime.caption
|
||
msgid "Modified:"
|
||
msgstr "Змінений:"
|
||
|
||
#: tfrmsetfileproperties.chkreadonly.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
|
||
msgid "Read only"
|
||
msgstr "Лише читання"
|
||
|
||
#: tfrmsetfileproperties.chkrecursive.caption
|
||
msgid "Including subfolders"
|
||
msgstr "Рекурсивно"
|
||
|
||
#: tfrmsetfileproperties.chksystem.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
|
||
msgid "System"
|
||
msgstr "Системний"
|
||
|
||
#: tfrmsetfileproperties.gbtimesamp.caption
|
||
#, fuzzy
|
||
msgid "Timestamp properties"
|
||
msgstr "Властивості мітки часу"
|
||
|
||
#: tfrmsetfileproperties.gbunixattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Атрибути"
|
||
|
||
#: tfrmsetfileproperties.gbwinattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Атрибути"
|
||
|
||
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Біти:"
|
||
|
||
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: tfrmsetfileproperties.lblattrinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(сірі поля змінити неможливо)"
|
||
|
||
#: tfrmsetfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Інші"
|
||
|
||
#: tfrmsetfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Власник"
|
||
|
||
#: tfrmsetfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmsetfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Текст:"
|
||
|
||
#: tfrmsetfileproperties.lblexec.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Виконання"
|
||
|
||
#: tfrmsetfileproperties.lblmodeinfo.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(сірі поля змінити неможливо)"
|
||
|
||
#: tfrmsetfileproperties.lbloctal.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Вісімковий"
|
||
|
||
#: tfrmsetfileproperties.lblread.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Читання"
|
||
|
||
#: tfrmsetfileproperties.lblwrite.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Запис"
|
||
|
||
#: tfrmsplitter.btncancel.caption
|
||
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmsplitter.btnftchoice.caption
|
||
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmsplitter.btnok.caption
|
||
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmsplitter.btnrelativeftchoice.hint
|
||
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях"
|
||
|
||
#: tfrmsplitter.caption
|
||
msgctxt "TFRMSPLITTER.CAPTION"
|
||
msgid "Splitter"
|
||
msgstr "Розбивка"
|
||
|
||
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
||
msgid "Require a CRC32 verification file"
|
||
msgstr "Створити файл контрольної суми"
|
||
|
||
#: tfrmsplitter.cmbxsize.text
|
||
msgid "1457664B - 3.5\""
|
||
msgstr "1457664B - 3.5\""
|
||
|
||
#: tfrmsplitter.grbxfile.caption
|
||
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ім'я файлу"
|
||
|
||
#: tfrmsplitter.grbxsize.caption
|
||
msgid "Size and number of parts"
|
||
msgstr "Розмір і кількість частин"
|
||
|
||
#: tfrmsplitter.lbdirtarget.caption
|
||
msgid "Directory &target"
|
||
msgstr "Катал&ог призначення"
|
||
|
||
#: tfrmsplitter.lbfilesource.caption
|
||
msgid "File &source"
|
||
msgstr "Вхідний фай&л"
|
||
|
||
#: tfrmsplitter.lblnumberparts.caption
|
||
msgid "&Number of parts"
|
||
msgstr "Кількіст&ь частин"
|
||
|
||
#: tfrmsplitter.rbtnbyte.caption
|
||
msgid "&Bytes"
|
||
msgstr "&Байт"
|
||
|
||
#: tfrmsplitter.rbtngigab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
|
||
msgid "&Gigabytes"
|
||
msgstr "&Гігабайти"
|
||
|
||
#: tfrmsplitter.rbtnkilob.caption
|
||
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
|
||
msgid "&Kilobytes"
|
||
msgstr "&Кілобайти"
|
||
|
||
#: tfrmsplitter.rbtnmegab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
|
||
msgid "&Megabytes"
|
||
msgstr "&Мегабайти"
|
||
|
||
#: tfrmstartingsplash.caption
|
||
msgctxt "tfrmstartingsplash.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblbuild.caption
|
||
msgctxt "tfrmstartingsplash.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Збірка"
|
||
|
||
#: tfrmstartingsplash.lblfreepascalver.caption
|
||
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmstartingsplash.lbllazarusver.caption
|
||
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmstartingsplash.lbloperatingsystem.caption
|
||
msgid "Operating System"
|
||
msgstr "Операційна система"
|
||
|
||
#: tfrmstartingsplash.lblplatform.caption
|
||
msgid "Platform"
|
||
msgstr "Платформа"
|
||
|
||
#: tfrmstartingsplash.lblrevision.caption
|
||
msgctxt "tfrmstartingsplash.lblrevision.caption"
|
||
msgid "Revision"
|
||
msgstr "Ревізія:"
|
||
|
||
#: tfrmstartingsplash.lbltitle.caption
|
||
msgctxt "tfrmstartingsplash.lbltitle.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblversion.caption
|
||
msgctxt "tfrmstartingsplash.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Версія"
|
||
|
||
#: tfrmstartingsplash.lblwidgetsetver.caption
|
||
msgid "WidgetsetVer"
|
||
msgstr "Версія додатків"
|
||
|
||
#: tfrmsymlink.btncancel.caption
|
||
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmsymlink.btnok.caption
|
||
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmsymlink.caption
|
||
msgid "Create symbolic link"
|
||
msgstr "Створити симв. посилання"
|
||
|
||
#: tfrmsymlink.lblexistingfile.caption
|
||
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "&Місце, на яке вказуватиме посилання"
|
||
|
||
#: tfrmsymlink.lbllinktocreate.caption
|
||
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "Ім'я поси&лання"
|
||
|
||
#: tfrmsyncdirsdlg.btnclose.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
|
||
msgid "Close"
|
||
msgstr "Закрити"
|
||
|
||
#: tfrmsyncdirsdlg.btncompare.caption
|
||
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Порівняти"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir1.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir2.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Синхронізація"
|
||
|
||
#: tfrmsyncdirsdlg.caption
|
||
msgid "Synchronize directories"
|
||
msgstr "Синхронізувати теки"
|
||
|
||
#: tfrmsyncdirsdlg.cbextfilter.text
|
||
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
||
msgid "asymmetric"
|
||
msgstr "асиметрично"
|
||
|
||
#: tfrmsyncdirsdlg.chkbycontent.caption
|
||
msgid "by content"
|
||
msgstr "за змістом"
|
||
|
||
#: tfrmsyncdirsdlg.chkignoredate.caption
|
||
msgid "ignore date"
|
||
msgstr "ігнорувати дату"
|
||
|
||
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
||
msgid "only selected"
|
||
msgstr "лише виділене"
|
||
|
||
#: tfrmsyncdirsdlg.chksubdirs.caption
|
||
msgid "Subdirs"
|
||
msgstr "Підтеки"
|
||
|
||
#: tfrmsyncdirsdlg.groupbox1.caption
|
||
msgid "Show:"
|
||
msgstr "Показати:"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Ім'я"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
|
||
msgid "Size"
|
||
msgstr "Розмір"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
||
msgid "<=>"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
|
||
msgid "Size"
|
||
msgstr "Розмір"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
|
||
msgid "Name"
|
||
msgstr "Ім'я"
|
||
|
||
#: tfrmsyncdirsdlg.label1.caption
|
||
msgid "(in main window)"
|
||
msgstr "(в основному вікні)"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
||
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Порівняти"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
||
msgid "View left"
|
||
msgstr "Вид зліва"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
||
msgid "View right"
|
||
msgstr "Вид справа"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyright.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmsyncdirsdlg.sbduplicates.caption
|
||
msgid "duplicates"
|
||
msgstr "дублікати"
|
||
|
||
#: tfrmsyncdirsdlg.sbequal.caption
|
||
msgid "="
|
||
msgstr "<=>"
|
||
|
||
#: tfrmsyncdirsdlg.sbnotequal.caption
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: tfrmsyncdirsdlg.sbsingles.caption
|
||
msgid "singles"
|
||
msgstr "унікальні"
|
||
|
||
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
||
msgid "Please press \"Compare\" to start"
|
||
msgstr "Для запуску натисніть \"Порівняти\" "
|
||
|
||
#: tfrmsyncdirsperformdlg.caption
|
||
msgctxt "tfrmsyncdirsperformdlg.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Синхронізація"
|
||
|
||
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
||
msgid "Confirm overwrites"
|
||
msgstr "Підтвердження перезапису"
|
||
|
||
#: tfrmtreeviewmenu.caption
|
||
msgctxt "tfrmtreeviewmenu.caption"
|
||
msgid "Tree View Menu"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
||
msgid "Select your hot directory:"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
||
msgid "Search is case sensitive"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
||
msgid "Full collapse"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmifullexpand.caption
|
||
msgid "Full expand"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
||
msgid "Search ignore accents and ligatures"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
||
msgid "Search is not case sensitive"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
||
msgid "Search is strict regarding accents and ligatures"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
||
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
||
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
||
msgid "Close Tree View Menu"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr ""
|
||
|
||
#: tfrmtweakplugin.btnadd.caption
|
||
msgid "A&dd new"
|
||
msgstr "Д&одати новий"
|
||
|
||
#: tfrmtweakplugin.btncancel.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: tfrmtweakplugin.btnchange.caption
|
||
msgid "C&hange"
|
||
msgstr "З&мінити"
|
||
|
||
#: tfrmtweakplugin.btndefault.caption
|
||
msgid "De&fault"
|
||
msgstr "&Типовий"
|
||
|
||
#: tfrmtweakplugin.btnok.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: tfrmtweakplugin.btnremove.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Вида&лити"
|
||
|
||
#: tfrmtweakplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
|
||
msgid "Tweak plugin"
|
||
msgstr "Параметри плагіну"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
||
msgid "De&tect archive type by content"
|
||
msgstr "Визнача&ти тип архіву за вмістом"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
||
msgid "Can de&lete files"
|
||
msgstr "Може вида&ляти файли"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
||
msgid "Supports e&ncryption"
|
||
msgstr "Підтримує &шифрування"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
||
msgid "Sho&w as normal files (hide packer icon)"
|
||
msgstr "Показувати як нормальні фа&йли (сховати іконку архіву)"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
||
msgid "Supports pac&king in memory"
|
||
msgstr "Підтриму&є стиснення в пам'яті"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
||
msgid "Can &modify existing archives"
|
||
msgstr "Може з&мінювати існуючі архіви"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
||
msgid "&Archive can contain multiple files"
|
||
msgstr "&Архів може містити декілька файлів"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_new.caption
|
||
msgid "Can create new archi&ves"
|
||
msgstr "Може створювати нові архі&ви"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_options.caption
|
||
msgid "S&upports the options dialogbox"
|
||
msgstr "Підтримує діалогове вікно з налашт&уваннями"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
||
msgid "Allow searchin&g for text in archives"
|
||
msgstr "Дозволити шукати текст у архі&вах"
|
||
|
||
#: tfrmtweakplugin.lbldescription.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
|
||
msgid "&Description:"
|
||
msgstr "Оп&ис:"
|
||
|
||
#: tfrmtweakplugin.lbldetectstr.caption
|
||
msgid "D&etect string:"
|
||
msgstr "Визна&чення рядка:"
|
||
|
||
#: tfrmtweakplugin.lblextension.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
|
||
msgid "&Extension:"
|
||
msgstr "&Розширення:"
|
||
|
||
#: tfrmtweakplugin.lblflags.caption
|
||
msgid "Flags:"
|
||
msgstr "Позначки:"
|
||
|
||
#: tfrmtweakplugin.lblname.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
|
||
msgid "&Name:"
|
||
msgstr "І&м'я"
|
||
|
||
#: tfrmtweakplugin.lblplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "&Плагін:"
|
||
|
||
#: tfrmtweakplugin.lblplugin1.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "&Плагін:"
|
||
|
||
#: tfrmviewer.actabout.caption
|
||
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
|
||
msgid "About Viewer..."
|
||
msgstr "Про переглядач..."
|
||
|
||
#: tfrmviewer.actabout.hint
|
||
msgid "Displays the About message"
|
||
msgstr "Відображає інформаційне повідомлення"
|
||
|
||
#: tfrmviewer.actcopyfile.caption
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
||
msgid "Copy File"
|
||
msgstr "Копіювати файл"
|
||
|
||
#: tfrmviewer.actcopyfile.hint
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
||
msgid "Copy File"
|
||
msgstr "Копіювати файл"
|
||
|
||
#: tfrmviewer.actcopytoclipboard.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
||
msgid "Copy To Clipboard"
|
||
msgstr "&Копіювати в буфер"
|
||
|
||
#: tfrmviewer.actcopytoclipboardformatted.caption
|
||
msgid "Copy To Clipboard Formatted"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actdeletefile.caption
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
||
msgid "Delete File"
|
||
msgstr "Видалити файл"
|
||
|
||
#: tfrmviewer.actdeletefile.hint
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
||
msgid "Delete File"
|
||
msgstr "Видалити файл"
|
||
|
||
#: tfrmviewer.actexitviewer.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actexitviewer.caption"
|
||
msgid "E&xit"
|
||
msgstr "Ви&хід"
|
||
|
||
#: tfrmviewer.actfind.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actfind.caption"
|
||
msgid "Find"
|
||
msgstr "Знайти"
|
||
|
||
#: tfrmviewer.actfindnext.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Знайти наступний"
|
||
|
||
#: tfrmviewer.actfindprev.caption
|
||
msgctxt "tfrmviewer.actfindprev.caption"
|
||
msgid "Find previous"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actfullscreen.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actfullscreen.caption"
|
||
msgid "Full Screen"
|
||
msgstr "На весь екран"
|
||
|
||
#: tfrmviewer.actimagecenter.caption
|
||
msgctxt "tfrmviewer.actimagecenter.caption"
|
||
msgid "Center"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actloadnextfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
|
||
msgid "&Next"
|
||
msgstr "На&ступний"
|
||
|
||
#: tfrmviewer.actloadnextfile.hint
|
||
msgid "Load Next File"
|
||
msgstr "Завантажити наступний"
|
||
|
||
#: tfrmviewer.actloadprevfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
|
||
msgid "&Previous"
|
||
msgstr "&Попередній"
|
||
|
||
#: tfrmviewer.actloadprevfile.hint
|
||
msgid "Load Previous File"
|
||
msgstr "Завантажити попередній"
|
||
|
||
#: tfrmviewer.actmirrorhorz.caption
|
||
msgid "Mirror Horizontally"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actmirrorhorz.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actmirrorhorz.hint"
|
||
msgid "Mirror"
|
||
msgstr "Дзеркально"
|
||
|
||
#: tfrmviewer.actmirrorvert.caption
|
||
msgid "Mirror Vertically"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actmovefile.caption
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
||
msgid "Move File"
|
||
msgstr "Перемістити файл"
|
||
|
||
#: tfrmviewer.actmovefile.hint
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
||
msgid "Move File"
|
||
msgstr "Перемістити файл"
|
||
|
||
#: tfrmviewer.actpreview.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actpreview.caption"
|
||
msgid "Preview"
|
||
msgstr "Попередній перегляд"
|
||
|
||
#: tfrmviewer.actreload.caption
|
||
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
||
msgid "Reload"
|
||
msgstr "Перезавантажити"
|
||
|
||
#: tfrmviewer.actreload.hint
|
||
msgid "Reload current file"
|
||
msgstr "Перезавантажити поточний файл"
|
||
|
||
#: tfrmviewer.actrotate180.caption
|
||
#, fuzzy
|
||
#| msgid "Rotate 180"
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
|
||
msgid "+ 180"
|
||
msgstr "Повернути на 180"
|
||
|
||
#: tfrmviewer.actrotate180.hint
|
||
#, fuzzy
|
||
#| msgid "Rotate 180"
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
|
||
msgid "Rotate 180 degrees"
|
||
msgstr "Повернути на 180"
|
||
|
||
#: tfrmviewer.actrotate270.caption
|
||
#, fuzzy
|
||
#| msgid "Rotate 270"
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
|
||
msgid "- 90"
|
||
msgstr "Повернути на 270"
|
||
|
||
#: tfrmviewer.actrotate270.hint
|
||
#, fuzzy
|
||
#| msgid "Rotate 270"
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
|
||
msgid "Rotate -90 degrees"
|
||
msgstr "Повернути на 270"
|
||
|
||
#: tfrmviewer.actrotate90.caption
|
||
#, fuzzy
|
||
#| msgid "Rotate 90"
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
|
||
msgid "+ 90"
|
||
msgstr "Повернути на 90"
|
||
|
||
#: tfrmviewer.actrotate90.hint
|
||
#, fuzzy
|
||
#| msgid "Rotate 90"
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
|
||
msgid "Rotate +90 degrees"
|
||
msgstr "Повернути на 90"
|
||
|
||
#: tfrmviewer.actsave.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actsave.caption"
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: tfrmviewer.actsaveas.caption
|
||
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
|
||
msgid "Save As..."
|
||
msgstr "Зберегти як..."
|
||
|
||
#: tfrmviewer.actsaveas.hint
|
||
msgid "Save File As..."
|
||
msgstr "Зберегти як..."
|
||
|
||
#: tfrmviewer.actscreenshot.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actscreenshot.caption"
|
||
msgid "Screenshot"
|
||
msgstr "Скріншот"
|
||
|
||
#: tfrmviewer.actscreenshotdelay3sec.caption
|
||
msgid "Delay 3 sec"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actscreenshotdelay5sec.caption
|
||
msgid "Delay 5 sec"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actselectall.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actselectall.caption"
|
||
msgid "Select All"
|
||
msgstr "Виділити &усе"
|
||
|
||
#: tfrmviewer.actshowasbin.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actshowasbin.caption"
|
||
msgid "Show as &Bin"
|
||
msgstr "Показати як &двійковий"
|
||
|
||
#: tfrmviewer.actshowasbook.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actshowasbook.caption"
|
||
msgid "Show as B&ook"
|
||
msgstr "Показати як &книгу"
|
||
|
||
#: tfrmviewer.actshowasdec.caption
|
||
msgid "Show as &Dec"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actshowashex.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actshowashex.caption"
|
||
msgid "Show as &Hex"
|
||
msgstr "Показати як &шістнадцятковий"
|
||
|
||
#: tfrmviewer.actshowastext.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actshowastext.caption"
|
||
msgid "Show as &Text"
|
||
msgstr "Показати як &текст"
|
||
|
||
#: tfrmviewer.actshowaswraptext.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actshowaswraptext.caption"
|
||
msgid "Show as &Wrap text"
|
||
msgstr "Показати як текст з &розривами рядків"
|
||
|
||
#: tfrmviewer.actshowgraphics.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actshowgraphics.caption"
|
||
msgid "Graphics"
|
||
msgstr "Графіка"
|
||
|
||
#: tfrmviewer.actshowplugins.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actshowplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Плагіни"
|
||
|
||
#: tfrmviewer.actstretchimage.caption
|
||
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
|
||
msgid "Stretch"
|
||
msgstr "Розтягнути"
|
||
|
||
#: tfrmviewer.actstretchimage.hint
|
||
msgid "Stretch Image"
|
||
msgstr "Розтягнути зображення"
|
||
|
||
#: tfrmviewer.actstretchonlylarge.caption
|
||
msgctxt "tfrmviewer.actstretchonlylarge.caption"
|
||
msgid "Stretch only large"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actzoom.caption
|
||
msgid "Zoom"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actzoomin.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actzoomin.caption"
|
||
msgid "Zoom In"
|
||
msgstr "Збільшити"
|
||
|
||
#: tfrmviewer.actzoomout.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewer.actzoomout.caption"
|
||
msgid "Zoom Out"
|
||
msgstr "Зменшити"
|
||
|
||
#: tfrmviewer.btncopyfile.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmviewer.btncopyfile1.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: tfrmviewer.btncuttuimage.hint
|
||
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
|
||
msgid "Crop"
|
||
msgstr "Обрізати"
|
||
|
||
#: tfrmviewer.btndeletefile.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmviewer.btndeletefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: tfrmviewer.btnfullscreen.hint
|
||
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
||
msgid "Full Screen"
|
||
msgstr "На весь екран"
|
||
|
||
#: tfrmviewer.btngifmove.caption
|
||
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmviewer.btngiftobmp.caption
|
||
msgid "S"
|
||
msgstr "S"
|
||
|
||
#: tfrmviewer.btnhightlight.hint
|
||
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
||
msgid "Highlight"
|
||
msgstr "Підсвітити"
|
||
|
||
#: tfrmviewer.btnmovefile.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
|
||
msgid "Move"
|
||
msgstr "Перемістити"
|
||
|
||
#: tfrmviewer.btnmovefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
|
||
msgid "Move"
|
||
msgstr "Перемістити"
|
||
|
||
#: tfrmviewer.btnnextgifframe.caption
|
||
msgid "||>"
|
||
msgstr "||>"
|
||
|
||
#: tfrmviewer.btnpaint.hint
|
||
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
||
msgid "Paint"
|
||
msgstr "Малювати"
|
||
|
||
#: tfrmviewer.btnprevgifframe.caption
|
||
msgid "<||"
|
||
msgstr "<||"
|
||
|
||
#: tfrmviewer.btnredeye.hint
|
||
msgid "Red Eyes"
|
||
msgstr "Червоні очі"
|
||
|
||
#: tfrmviewer.btnresize.hint
|
||
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
|
||
msgid "Resize"
|
||
msgstr "Змінити розмір"
|
||
|
||
#: tfrmviewer.btnundo.hint
|
||
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Вернути"
|
||
|
||
#: tfrmviewer.caption
|
||
msgctxt "tfrmviewer.caption"
|
||
msgid "Viewer"
|
||
msgstr "Переглядач"
|
||
|
||
#: tfrmviewer.cbslideshow.caption
|
||
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Слайд-шоу"
|
||
|
||
#: tfrmviewer.comboboxpaint.text
|
||
msgid "Pen"
|
||
msgstr "Ручка"
|
||
|
||
#: tfrmviewer.comboboxwidth.text
|
||
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmviewer.gboxhightlight.caption
|
||
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
||
msgid "Highlight"
|
||
msgstr "Підсвітити"
|
||
|
||
#: tfrmviewer.gboxpaint.caption
|
||
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
||
msgid "Paint"
|
||
msgstr "Малювати"
|
||
|
||
#: tfrmviewer.gboxslideshow.caption
|
||
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Слайд-шоу"
|
||
|
||
#: tfrmviewer.gboxview.caption
|
||
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Перегляд"
|
||
|
||
#: tfrmviewer.lblhightlight.caption
|
||
msgid "0x0"
|
||
msgstr "0x0"
|
||
|
||
#: tfrmviewer.miabout.caption
|
||
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "Про програму..."
|
||
|
||
#: tfrmviewer.midiv1.caption
|
||
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv2.caption
|
||
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv3.caption
|
||
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv4.caption
|
||
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv5.caption
|
||
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miedit.caption
|
||
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Редагування"
|
||
|
||
#: tfrmviewer.miencoding.caption
|
||
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Код&ування"
|
||
|
||
#: tfrmviewer.mifile.caption
|
||
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmviewer.miimage.caption
|
||
msgid "&Image"
|
||
msgstr "&Малюнок"
|
||
|
||
#: tfrmviewer.miprint.caption
|
||
msgid "Print..."
|
||
msgstr "Друк..."
|
||
|
||
#: tfrmviewer.mirotate.caption
|
||
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
|
||
msgid "Rotate"
|
||
msgstr "Обертати"
|
||
|
||
#: tfrmviewer.miscreenshot.caption
|
||
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
||
msgid "Screenshot"
|
||
msgstr "Скріншот"
|
||
|
||
#: tfrmviewer.miseparator.caption
|
||
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miview.caption
|
||
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
||
msgid "&View"
|
||
msgstr "&Перегляд"
|
||
|
||
#: tfrmviewer.pmiselectall.caption
|
||
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Виділити &все"
|
||
|
||
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Якщо файл існує"
|
||
|
||
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Якщо файл існує"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
||
#, fuzzy
|
||
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Копіювати &дату/час"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
||
msgid "Work in background (separate connection)"
|
||
msgstr "Працювати у фоні (окреме з’єднання)"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Якщо файл існує"
|
||
|
||
#: ulng.msgtrytolocatecrcfile
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "This file cannot be found and could help to validate final combination of files:\n"
|
||
#| "%s\n"
|
||
#| "\n"
|
||
#| "Could you make it available and press \"OK\" when ready,\n"
|
||
#| "or press \"CANCEL\" to continue without it?\n"
|
||
msgid ""
|
||
"This file cannot be found and could help to validate final combination of files:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Could you make it available and press \"OK\" when ready,\n"
|
||
"or press \"CANCEL\" to continue without it?\n"
|
||
msgstr ""
|
||
"Цей файл не може бути знайдений проте може допомогти, щоб перевірити остаточну комбінацію файлів:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Чи не могли б ви зробити його доступним і натиснути \"Гаразд \", коли будете готові, \n"
|
||
"або натиснути \"Скасувати \", щоб продовжити без нього? \n"
|
||
|
||
#: ulng.rscancelfilter
|
||
msgid "Cancel Quick Filter"
|
||
msgstr "Скасувати швидкий фільтр"
|
||
|
||
#: ulng.rscanceloperation
|
||
msgid "Cancel Current Operation"
|
||
msgstr "Скасувати поточну операцію"
|
||
|
||
#: ulng.rscaptionforaskingfilename
|
||
msgid "Enter filename, with extension, for dropped text"
|
||
msgstr "Введіть ім’я файла з розширенням для перетягнутого тексту"
|
||
|
||
#: ulng.rscaptionfortextformattoimport
|
||
msgid "Text format to import"
|
||
msgstr "Формат тексту до імпорту"
|
||
|
||
#: ulng.rschecksumverifybroken
|
||
msgid "Broken:"
|
||
msgstr "Пошкоджені:"
|
||
|
||
#: ulng.rschecksumverifygeneral
|
||
msgid "General:"
|
||
msgstr "Загальні:"
|
||
|
||
#: ulng.rschecksumverifymissing
|
||
msgid "Missing:"
|
||
msgstr "Відсутні:"
|
||
|
||
#: ulng.rschecksumverifyreaderror
|
||
msgid "Read error:"
|
||
msgstr "Помилок читання:"
|
||
|
||
#: ulng.rschecksumverifysuccess
|
||
msgid "Success:"
|
||
msgstr "Успішно:"
|
||
|
||
#: ulng.rschecksumverifytext
|
||
msgid "Enter checksum and select algorithm:"
|
||
msgstr "Введіть контрольну суму і виберіть алгоритм:"
|
||
|
||
#: ulng.rschecksumverifytitle
|
||
msgid "Verify checksum"
|
||
msgstr "Перевірити контрольну суму"
|
||
|
||
#: ulng.rschecksumverifytotal
|
||
msgid "Total:"
|
||
msgstr "Всього:"
|
||
|
||
#: ulng.rsclearfiltersornot
|
||
msgid "Do you want to clear filters for this new search?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
||
msgid "Clipboard doesn't contain any valid toolbar data."
|
||
msgstr "Буфер обміну не містить допустимих даних панелі інструментів."
|
||
|
||
#: ulng.rscmdcategorylistinorder
|
||
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
||
msgstr "Все;Активна панель;Ліва панель;Права панель;Файлові операції;Конфігурація;Мережа;Різне;Паралельний порт;Принтер;Відмітки;Безпека;Буфер обміну;FTP;Навігація;Довідка;Вікно;Командний рядок;Інструменти;Вигляд;Користувач;Вкладки;Сортування;Звіт"
|
||
|
||
#: ulng.rscmdkindofsort
|
||
msgid "Legacy sorted;A-Z sorted"
|
||
msgstr "Класичне сортування;А-Я сортування"
|
||
|
||
#: ulng.rscolattr
|
||
msgid "Attr"
|
||
msgstr "Атриб"
|
||
|
||
#: ulng.rscoldate
|
||
msgctxt "ulng.rscoldate"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: ulng.rscolext
|
||
msgid "Ext"
|
||
msgstr "Розш"
|
||
|
||
#: ulng.rscolname
|
||
msgctxt "ulng.rscolname"
|
||
msgid "Name"
|
||
msgstr "Ім'я"
|
||
|
||
#: ulng.rscolsize
|
||
msgctxt "ulng.rscolsize"
|
||
msgid "Size"
|
||
msgstr "Розмір"
|
||
|
||
#: ulng.rsconfcolalign
|
||
msgid "Align"
|
||
msgstr "Вирівн"
|
||
|
||
#: ulng.rsconfcolcaption
|
||
msgid "Caption"
|
||
msgstr "Заголовок"
|
||
|
||
#: ulng.rsconfcoldelete
|
||
msgctxt "ulng.rsconfcoldelete"
|
||
msgid "Delete"
|
||
msgstr "Видалити"
|
||
|
||
#: ulng.rsconfcolfieldcont
|
||
msgid "Field contents"
|
||
msgstr "Вміст поля даних"
|
||
|
||
#: ulng.rsconfcolmove
|
||
msgctxt "ulng.rsconfcolmove"
|
||
msgid "Move"
|
||
msgstr "Перемістити"
|
||
|
||
#: ulng.rsconfcolwidth
|
||
msgctxt "ulng.rsconfcolwidth"
|
||
msgid "Width"
|
||
msgstr "Ширина"
|
||
|
||
#: ulng.rsconfcustheader
|
||
msgid "Customize column"
|
||
msgstr "Налаштування колонки"
|
||
|
||
#: ulng.rsconfigurationfileassociation
|
||
msgid "Configure file association"
|
||
msgstr "Налаштування асоціацій з файлами"
|
||
|
||
#: ulng.rsconfirmexecution
|
||
msgid "Confirming command line and parameters"
|
||
msgstr "Підтвердження командного рядка і параметрів"
|
||
|
||
#: ulng.rscopynametemplate
|
||
msgid "Copy (%d) %s"
|
||
msgstr "Копіювати (%d) %s"
|
||
|
||
#: ulng.rsdefaultimporteddctoolbarhint
|
||
msgid "Imported DC toolbar"
|
||
msgstr "Імпортована панель інструментів DC"
|
||
|
||
#: ulng.rsdefaultimportedtctoolbarhint
|
||
msgid "Imported TC toolbar"
|
||
msgstr "Імпортована панель інструментів ТC"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtext
|
||
#, fuzzy
|
||
msgid "_DroppedText"
|
||
msgstr "_DroppedText"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
||
#, fuzzy
|
||
msgid "_DroppedHTMLtext"
|
||
msgstr "_DroppedHTMLtext"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
||
#, fuzzy
|
||
msgid "_DroppedRichtext"
|
||
msgstr "_DroppedRichtext"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
||
#, fuzzy
|
||
msgid "_DroppedSimpleText"
|
||
msgstr "_DroppedSimpleText"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
||
#, fuzzy
|
||
msgid "_DroppedUnicodeUTF16text"
|
||
msgstr "_DroppedUnicodeUTF16text"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
||
#, fuzzy
|
||
msgid "_DroppedUnicodeUTF8text"
|
||
msgstr "_DroppedUnicodeUTF8text"
|
||
|
||
#: ulng.rsdiffadds
|
||
msgid " Adds: "
|
||
msgstr "Додано:"
|
||
|
||
#: ulng.rsdiffdeletes
|
||
msgid " Deletes: "
|
||
msgstr "Видалено:"
|
||
|
||
#: ulng.rsdifffilesidentical
|
||
msgid "The two files are identical!"
|
||
msgstr "Ці два файли ідентичні!"
|
||
|
||
#: ulng.rsdiffmatches
|
||
msgid " Matches: "
|
||
msgstr "Співпадінь:"
|
||
|
||
#: ulng.rsdiffmodifies
|
||
msgid " Modifies: "
|
||
msgstr "Змінено:"
|
||
|
||
#: ulng.rsdlgbuttonabort
|
||
msgid "Ab&ort"
|
||
msgstr "П&ерервати"
|
||
|
||
#: ulng.rsdlgbuttonall
|
||
msgctxt "ulng.rsdlgbuttonall"
|
||
msgid "A&ll"
|
||
msgstr "В&се"
|
||
|
||
#: ulng.rsdlgbuttonappend
|
||
msgid "A&ppend"
|
||
msgstr "&Додати"
|
||
|
||
#: ulng.rsdlgbuttonautorenamesource
|
||
msgid "A&uto-rename source files"
|
||
msgstr "Авто-перейменування вихідних файлів"
|
||
|
||
#: ulng.rsdlgbuttoncancel
|
||
msgctxt "ulng.rsdlgbuttoncancel"
|
||
msgid "&Cancel"
|
||
msgstr "&Скасувати"
|
||
|
||
#: ulng.rsdlgbuttoncontinue
|
||
msgid "&Continue"
|
||
msgstr "Продов&жити"
|
||
|
||
#: ulng.rsdlgbuttoncopyinto
|
||
#, fuzzy
|
||
#| msgid "Copy &Into"
|
||
msgid "&Merge"
|
||
msgstr "&Копіювати в"
|
||
|
||
#: ulng.rsdlgbuttoncopyintoall
|
||
#, fuzzy
|
||
#| msgid "Copy Into &All"
|
||
msgid "Mer&ge All"
|
||
msgstr "Копіюв&ати у всі"
|
||
|
||
#: ulng.rsdlgbuttonexitprogram
|
||
msgid "E&xit program"
|
||
msgstr "В&ихід з програми"
|
||
|
||
#: ulng.rsdlgbuttonignore
|
||
msgid "Ig&nore"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdlgbuttonignoreall
|
||
msgid "I&gnore All"
|
||
msgstr "Пропуст&ити все"
|
||
|
||
#: ulng.rsdlgbuttonno
|
||
msgid "&No"
|
||
msgstr "&Ні"
|
||
|
||
#: ulng.rsdlgbuttonnone
|
||
msgid "Non&e"
|
||
msgstr "&Жодного"
|
||
|
||
#: ulng.rsdlgbuttonok
|
||
msgctxt "ulng.rsdlgbuttonok"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: ulng.rsdlgbuttonother
|
||
msgid "Ot&her"
|
||
msgstr "Ін&ший"
|
||
|
||
#: ulng.rsdlgbuttonoverwrite
|
||
msgid "&Overwrite"
|
||
msgstr "&Перезаписати"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteall
|
||
msgid "Overwrite &All"
|
||
msgstr "Пере&записати все"
|
||
|
||
#: ulng.rsdlgbuttonoverwritelarger
|
||
msgid "Overwrite All &Larger"
|
||
msgstr "Перезаписати всі &великі"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteolder
|
||
msgid "Overwrite All Ol&der"
|
||
msgstr "Замінити всі ста&рі"
|
||
|
||
#: ulng.rsdlgbuttonoverwritesmaller
|
||
msgid "Overwrite All S&maller"
|
||
msgstr "Перезаписати всі &маленькі"
|
||
|
||
#: ulng.rsdlgbuttonrename
|
||
msgctxt "ulng.rsdlgbuttonrename"
|
||
msgid "R&ename"
|
||
msgstr "Пере&йменувати"
|
||
|
||
#: ulng.rsdlgbuttonresume
|
||
msgid "&Resume"
|
||
msgstr "&Підсумок"
|
||
|
||
#: ulng.rsdlgbuttonretry
|
||
msgid "Re&try"
|
||
msgstr "Повтор&ити"
|
||
|
||
#: ulng.rsdlgbuttonskip
|
||
msgid "&Skip"
|
||
msgstr "Пр&опустити"
|
||
|
||
#: ulng.rsdlgbuttonskipall
|
||
msgid "S&kip All"
|
||
msgstr "Проп&устити все"
|
||
|
||
#: ulng.rsdlgbuttonyes
|
||
msgid "&Yes"
|
||
msgstr "&Так"
|
||
|
||
#: ulng.rsdlgcp
|
||
msgctxt "ulng.rsdlgcp"
|
||
msgid "Copy file(s)"
|
||
msgstr "Копіювання файлу(ів)"
|
||
|
||
#: ulng.rsdlgmv
|
||
msgctxt "ulng.rsdlgmv"
|
||
msgid "Move file(s)"
|
||
msgstr "Переміщення файлу(ів)"
|
||
|
||
#: ulng.rsdlgoppause
|
||
msgctxt "ulng.rsdlgoppause"
|
||
msgid "Pau&se"
|
||
msgstr "Пау&за"
|
||
|
||
#: ulng.rsdlgopstart
|
||
msgctxt "ulng.rsdlgopstart"
|
||
msgid "&Start"
|
||
msgstr "&Старт"
|
||
|
||
#: ulng.rsdlgqueue
|
||
msgctxt "ulng.rsdlgqueue"
|
||
msgid "Queue"
|
||
msgstr "Черга"
|
||
|
||
#: ulng.rsdlgspeed
|
||
msgid "Speed %s/s"
|
||
msgstr "Швидкість %s/s"
|
||
|
||
#: ulng.rsdlgspeedtime
|
||
msgid "Speed %s/s, time remaining %s"
|
||
msgstr "Швидкість %s/с, залишилось часу %s"
|
||
|
||
#: ulng.rsdraganddroptextformat
|
||
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdrivenolabel
|
||
msgid "<no label>"
|
||
msgstr "<no label>"
|
||
|
||
#: ulng.rsdrivenomedia
|
||
msgid "<no media>"
|
||
msgstr "<no media>"
|
||
|
||
#: ulng.rseditabouttext
|
||
msgid "Internal Editor of Double Commander."
|
||
msgstr "Внутрішній редактор Double Commander."
|
||
|
||
#: ulng.rseditgotolinequery
|
||
msgid "Goto line:"
|
||
msgstr "Перейти до рядка:"
|
||
|
||
#: ulng.rseditgotolinetitle
|
||
msgctxt "ulng.rseditgotolinetitle"
|
||
msgid "Goto Line"
|
||
msgstr "Перехід до рядка"
|
||
|
||
#: ulng.rseditnewfile
|
||
msgid "new.txt"
|
||
msgstr "Новий.txt"
|
||
|
||
#: ulng.rseditnewfilename
|
||
msgid "Filename:"
|
||
msgstr "Ім'я файлу:"
|
||
|
||
#: ulng.rseditnewopen
|
||
msgid "Open file"
|
||
msgstr "Відкрити файл"
|
||
|
||
#: ulng.rseditsearchback
|
||
msgid "&Backward"
|
||
msgstr "&Назад"
|
||
|
||
#: ulng.rseditsearchcaption
|
||
msgctxt "ulng.rseditsearchcaption"
|
||
msgid "Search"
|
||
msgstr "Пошук"
|
||
|
||
#: ulng.rseditsearchfrw
|
||
msgid "&Forward"
|
||
msgstr "&Вперед"
|
||
|
||
#: ulng.rseditsearchreplace
|
||
msgctxt "ulng.rseditsearchreplace"
|
||
msgid "Replace"
|
||
msgstr "Замінити"
|
||
|
||
#: ulng.rseditwithexternaleditor
|
||
msgid "with external editor"
|
||
msgstr "із зовнішнім редактором"
|
||
|
||
#: ulng.rseditwithinternaleditor
|
||
msgid "with internal editor"
|
||
msgstr "з внутрішнім редактором"
|
||
|
||
#: ulng.rsexecuteviashell
|
||
msgctxt "ulng.rsexecuteviashell"
|
||
msgid "Execute via shell"
|
||
msgstr "Виконати через оболонку"
|
||
|
||
#: ulng.rsexecuteviaterminalclose
|
||
msgctxt "ulng.rsexecuteviaterminalclose"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Виконати через термінал і закрити"
|
||
|
||
#: ulng.rsexecuteviaterminalstayopen
|
||
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Виконати через термінал і лишити відкритим"
|
||
|
||
#: ulng.rsfavtabspanelsideselection
|
||
msgid "Left;Right;Active;Inactive;Both;None"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfavtabssavedirhistory
|
||
msgid "No;Yes"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfilenameexportedtcbarprefix
|
||
msgid "Exported_from_DC"
|
||
msgstr "Експортувати_з_DC"
|
||
|
||
#: ulng.rsfileopdirectoryexistsoptions
|
||
#, fuzzy
|
||
#| msgid "Ask;Overwrite;Copy into;Skip"
|
||
msgid "Ask;Merge;Skip"
|
||
msgstr "Запитати;Замінити;Копіювати в; Пропустити"
|
||
|
||
#: ulng.rsfileopfileexistsoptions
|
||
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
||
msgstr "Запитати;Замінити;Замінити старі;Пропустити"
|
||
|
||
#: ulng.rsfileopsetpropertyerroroptions
|
||
msgctxt "ulng.rsfileopsetpropertyerroroptions"
|
||
msgid "Ask;Don't set anymore;Ignore errors"
|
||
msgstr "Запитати;Не встановлювати більше;Ігнорувати помилки"
|
||
|
||
#: ulng.rsfilterstatus
|
||
msgid "FILTER"
|
||
msgstr "Фільтр"
|
||
|
||
#: ulng.rsfinddefinetemplate
|
||
msgid "Define template"
|
||
msgstr "Визначення шаблону"
|
||
|
||
#: ulng.rsfinddepth
|
||
msgid "%s level(s)"
|
||
msgstr "%s рівень(і)"
|
||
|
||
#: ulng.rsfinddepthall
|
||
msgid "all (unlimited depth)"
|
||
msgstr "Всюди (необмежена глибина)"
|
||
|
||
#: ulng.rsfinddepthcurdir
|
||
msgid "current dir only"
|
||
msgstr "Тільки поточному каталогозі"
|
||
|
||
#: ulng.rsfinddirnoex
|
||
msgid "Directory %s does not exist!"
|
||
msgstr "Каталог %s не існує!"
|
||
|
||
#: ulng.rsfindfound
|
||
msgctxt "ulng.rsfindfound"
|
||
msgid "Found: %d"
|
||
msgstr "Знайдено: %d"
|
||
|
||
#: ulng.rsfindsavetemplatecaption
|
||
msgid "Save search template"
|
||
msgstr "Зберегти шаблон пошуку"
|
||
|
||
#: ulng.rsfindsavetemplatetitle
|
||
msgid "Template name:"
|
||
msgstr "Ім'я шаблону"
|
||
|
||
#: ulng.rsfindscanned
|
||
msgctxt "ulng.rsfindscanned"
|
||
msgid "Scanned: %d"
|
||
msgstr "Проглянуто: %d"
|
||
|
||
#: ulng.rsfindscanning
|
||
msgid "Scanning"
|
||
msgstr "Сканування"
|
||
|
||
#: ulng.rsfindsearchfiles
|
||
msgctxt "ulng.rsfindsearchfiles"
|
||
msgid "Find files"
|
||
msgstr "Пошук файлів"
|
||
|
||
#: ulng.rsfindtimeofscan
|
||
msgid "Time of scan: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsfindwherebeg
|
||
msgid "Begin at"
|
||
msgstr "Починати з"
|
||
|
||
#: ulng.rsfreemsg
|
||
msgid "Free %s from %s bytes"
|
||
msgstr "Вільно %s з %s байт"
|
||
|
||
#: ulng.rsfreemsgshort
|
||
msgid "%s bytes free"
|
||
msgstr "%s байт вільно"
|
||
|
||
#: ulng.rsfuncatime
|
||
msgid "Access date/time"
|
||
msgstr "Дата/Час доступу"
|
||
|
||
#: ulng.rsfuncattr
|
||
msgctxt "ulng.rsfuncattr"
|
||
msgid "Attributes"
|
||
msgstr "Атрибути"
|
||
|
||
#: ulng.rsfunccomment
|
||
msgctxt "ulng.rsfunccomment"
|
||
msgid "Comment"
|
||
msgstr "Коментар"
|
||
|
||
#: ulng.rsfunccompressedsize
|
||
msgid "Compressed size"
|
||
msgstr "Стиснутий розмір"
|
||
|
||
#: ulng.rsfuncctime
|
||
msgid "Creation date/time"
|
||
msgstr "Дата/Час створення"
|
||
|
||
#: ulng.rsfuncext
|
||
msgid "Extension"
|
||
msgstr "Розширення"
|
||
|
||
#: ulng.rsfuncgroup
|
||
msgctxt "ulng.rsfuncgroup"
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: ulng.rsfunchtime
|
||
msgid "Change date/time"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfunclinkto
|
||
msgid "Link to"
|
||
msgstr "Посилання на"
|
||
|
||
#: ulng.rsfuncmtime
|
||
msgid "Modification date/time"
|
||
msgstr "Дата/Час зміни"
|
||
|
||
#: ulng.rsfuncname
|
||
msgctxt "ulng.rsfuncname"
|
||
msgid "Name"
|
||
msgstr "Ім'я"
|
||
|
||
#: ulng.rsfuncnamenoext
|
||
msgid "Name without extension"
|
||
msgstr "Ім’я без розширення"
|
||
|
||
#: ulng.rsfuncowner
|
||
msgctxt "ulng.rsfuncowner"
|
||
msgid "Owner"
|
||
msgstr "Власник"
|
||
|
||
#: ulng.rsfuncpath
|
||
msgctxt "ulng.rsfuncpath"
|
||
msgid "Path"
|
||
msgstr "Шлях"
|
||
|
||
#: ulng.rsfuncsize
|
||
msgctxt "ulng.rsfuncsize"
|
||
msgid "Size"
|
||
msgstr "Розмір"
|
||
|
||
#: ulng.rsfunctype
|
||
msgid "Type"
|
||
msgstr "Тип"
|
||
|
||
#: ulng.rsharderrcreate
|
||
msgid "Error creating hardlink."
|
||
msgstr "Помилка створення жорсткого посилання."
|
||
|
||
#: ulng.rshotdirforcesortingorderchoices
|
||
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotdirwarningabortrestorebackup
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
||
#| "\n"
|
||
#| "Are you sure you want to proceed?\n"
|
||
msgid ""
|
||
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
||
"\n"
|
||
"Are you sure you want to proceed?\n"
|
||
msgstr ""
|
||
"Увага! При відновленні файлу .hotlist з резервної копії, буде стерто існуючий список.\n"
|
||
"\n"
|
||
"Ви впевнені, що хочете продовжити?\n"
|
||
|
||
#: ulng.rshotkeycategorycopymovedialog
|
||
msgid "Copy/Move Dialog"
|
||
msgstr "Вікно Копіювання/Переміщення"
|
||
|
||
#: ulng.rshotkeycategorydiffer
|
||
msgctxt "ulng.rshotkeycategorydiffer"
|
||
msgid "Differ"
|
||
msgstr "Порівнювач"
|
||
|
||
#: ulng.rshotkeycategoryeditcommentdialog
|
||
msgid "Edit Comment Dialog"
|
||
msgstr "Діалог редагування коментаря"
|
||
|
||
#: ulng.rshotkeycategoryeditor
|
||
#, fuzzy
|
||
msgctxt "ulng.rshotkeycategoryeditor"
|
||
msgid "Editor"
|
||
msgstr "Редактор"
|
||
|
||
#: ulng.rshotkeycategoryfindfiles
|
||
#, fuzzy
|
||
msgctxt "ulng.rshotkeycategoryfindfiles"
|
||
msgid "Find files"
|
||
msgstr "Пошук файлів"
|
||
|
||
#: ulng.rshotkeycategorymain
|
||
msgid "Main"
|
||
msgstr "Основний"
|
||
|
||
#: ulng.rshotkeycategoryviewer
|
||
msgctxt "ulng.rshotkeycategoryviewer"
|
||
msgid "Viewer"
|
||
msgstr "Переглядач"
|
||
|
||
#: ulng.rshotkeyfilealreadyexists
|
||
msgid ""
|
||
"A setup with that name already exists.\n"
|
||
"Do you want to overwrite it?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfileconfirmdefault
|
||
msgid "Are you sure you want to restore default?"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfileconfirmerasure
|
||
msgid "Are you sure you want to erase setup \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilecopyof
|
||
msgid "Copy of %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfileinputnewname
|
||
msgid "Input your new name"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilemustkeepone
|
||
msgid "You must keep at least one shortcut file."
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilenewname
|
||
msgid "New name"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilesavemodified
|
||
msgid ""
|
||
"\"%s\" setup has been modified.\n"
|
||
"Do you want to save it now?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeynoscenter
|
||
msgid "No shortcut with \"ENTER\""
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeysortorder
|
||
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsimporttoolbarproblem
|
||
msgid "Cannot find reference to default bar file"
|
||
msgstr "Не вдається знати файл типової панелі інструментів"
|
||
|
||
#: ulng.rslistoffindfileswindows
|
||
msgid "List of \"Find files\" windows"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmarkminus
|
||
msgid "Unselect mask"
|
||
msgstr "Маска зняття вибору"
|
||
|
||
#: ulng.rsmarkplus
|
||
msgid "Select mask"
|
||
msgstr "Маска вибору"
|
||
|
||
#: ulng.rsmaskinput
|
||
msgid "Input mask:"
|
||
msgstr "Вкажіть маску (роздільник - ';'):"
|
||
|
||
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
||
msgid "A columns view with that name already exists."
|
||
msgstr "Набір колонок з таким іменем вже існує."
|
||
|
||
#: ulng.rsmenuconfigurecolumnssavetochange
|
||
#, fuzzy
|
||
#| msgid "To change current editing columns view, either SAVE, COPY or DELETE current editing one"
|
||
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
||
msgstr "Для зміни поточного редагування набору колонок, або збереження, копійювання чи видалення одного"
|
||
|
||
#: ulng.rsmenuconfigurecustomcolumns
|
||
msgid "Configure custom columns"
|
||
msgstr "Налаштувати набір колонок"
|
||
|
||
#: ulng.rsmenuconfigureentercustomcolumnname
|
||
msgid "Enter new custom columns name"
|
||
msgstr "Введіть нове ім’я набору колонок"
|
||
|
||
#: ulng.rsmnuactions
|
||
msgctxt "ulng.rsmnuactions"
|
||
msgid "Actions"
|
||
msgstr "Команди"
|
||
|
||
#: ulng.rsmnucopynetnamestoclip
|
||
msgid "Copy names with UNC path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnudisconnectnetworkdrive
|
||
msgid "Disconnect Network Drive..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnuedit
|
||
msgctxt "ulng.rsmnuedit"
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: ulng.rsmnueject
|
||
msgid "Eject"
|
||
msgstr "Витягнути"
|
||
|
||
#: ulng.rsmnuextracthere
|
||
msgid "Extract here..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnumapnetworkdrive
|
||
msgid "Map Network Drive..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnumount
|
||
msgid "Mount"
|
||
msgstr "Монтувати"
|
||
|
||
#: ulng.rsmnunew
|
||
msgctxt "ulng.rsmnunew"
|
||
msgid "New"
|
||
msgstr "Створити"
|
||
|
||
#: ulng.rsmnunomedia
|
||
msgid "No media available"
|
||
msgstr "Немає доступних носіїв"
|
||
|
||
#: ulng.rsmnuopen
|
||
msgctxt "ulng.rsmnuopen"
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: ulng.rsmnuopenwith
|
||
msgid "Open with"
|
||
msgstr "Відкрити з допомогою..."
|
||
|
||
#: ulng.rsmnuopenwithother
|
||
msgctxt "ulng.rsmnuopenwithother"
|
||
msgid "Other..."
|
||
msgstr "Інше..."
|
||
|
||
#: ulng.rsmnupackhere
|
||
msgid "Pack here..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnusortby
|
||
msgid "Sort by"
|
||
msgstr "Сортувати за"
|
||
|
||
#: ulng.rsmnuumount
|
||
msgid "Unmount"
|
||
msgstr "Розмонтувати"
|
||
|
||
#: ulng.rsmnuview
|
||
msgctxt "ulng.rsmnuview"
|
||
msgid "View"
|
||
msgstr "Перегляд"
|
||
|
||
#: ulng.rsmsgaccount
|
||
msgid "Account:"
|
||
msgstr "Обліковий запис:"
|
||
|
||
#: ulng.rsmsgarchivercustomparams
|
||
msgid "Additional parameters for archiver command-line:"
|
||
msgstr "Додаткові параметри для командного рядка архіватора:"
|
||
|
||
#: ulng.rsmsgaskquoteornot
|
||
msgid "Do you want to enclose between quotes?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgbadcrc32
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Bad CRC32 for resulting file:\n"
|
||
#| "\"%s\"\n"
|
||
#| "\n"
|
||
#| "Do you want to keep the resulting corrupted file anyway?\n"
|
||
msgid ""
|
||
"Bad CRC32 for resulting file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Do you want to keep the resulting corrupted file anyway?\n"
|
||
msgstr ""
|
||
"Не збігається контрольна сума для файлу:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Бажаєте зберегти пошкоджений файл в будь-якому разі?\n"
|
||
|
||
#: ulng.rsmsgcannotcopymoveitself
|
||
msgid "You can not copy/move a file \"%s\" to itself!"
|
||
msgstr "Ви не можете скопіювати/перемістити файл \"%s\" в самого себе!"
|
||
|
||
#: ulng.rsmsgcannotdeletedirectory
|
||
msgid "Cannot delete directory %s"
|
||
msgstr "Не вдається видалити каталог %s"
|
||
|
||
#: ulng.rsmsgcannotoverwritedirectory
|
||
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgchdirfailed
|
||
msgid "ChDir to [%s] failed!"
|
||
msgstr "Перехід в каталог [%s] не вдався!"
|
||
|
||
#: ulng.rsmsgcloseallinactivetabs
|
||
msgid "Remove all inactive tabs?"
|
||
msgstr "Видалити всі неактивні вкладки?"
|
||
|
||
#: ulng.rsmsgcloselockedtab
|
||
msgid "This tab (%s) is locked! Close anyway?"
|
||
msgstr "Закладка (%s) заблокована. Закрити?"
|
||
|
||
#: ulng.rsmsgconfirmquit
|
||
msgid "Are you sure you want to quit?"
|
||
msgstr "Ви впевнені, що хочете вийти?"
|
||
|
||
#: ulng.rsmsgcopybackward
|
||
msgid "The file %s has changed. Do you want to copy it backward?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgcouldnotcopybackward
|
||
msgid "Could not copy backward - do you want to keep the changed file?"
|
||
msgstr "Не вдалося скопіювати назад - бажаєте зберегти змінений файл?"
|
||
|
||
#: ulng.rsmsgcpfldr
|
||
msgid "Copy %d selected files/directories?"
|
||
msgstr "Копіювати %d обраних файлів/каталогів?"
|
||
|
||
#: ulng.rsmsgcpsel
|
||
msgid "Copy selected \"%s\"?"
|
||
msgstr "Копіювати виділене \"%s\"?"
|
||
|
||
#: ulng.rsmsgcreateanewfiletype
|
||
msgid "< Create a new file type \"%s files\" >"
|
||
msgstr "< Створення нового типу файла \"%s files\" >"
|
||
|
||
#: ulng.rsmsgdctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a DC Toolbar file"
|
||
msgstr "Введіть розташування і ім'я файлу, куди зберегти файл панелі інструментів"
|
||
|
||
#: ulng.rsmsgdefaultcustomactionname
|
||
msgid "Custom action"
|
||
msgstr "Дії користувача"
|
||
|
||
#: ulng.rsmsgdeletepartiallycopied
|
||
msgid "Delete the partially copied file ?"
|
||
msgstr "Видалити частково скопійований файл?"
|
||
|
||
#: ulng.rsmsgdelfldr
|
||
msgid "Delete %d selected files/directories?"
|
||
msgstr "Видалити %d обраних файлів/каталогів?"
|
||
|
||
#: ulng.rsmsgdelfldrt
|
||
msgid "Delete %d selected files/directories into trash can?"
|
||
msgstr "Видалити %d обраних файлів/каталогів у смітник?"
|
||
|
||
#: ulng.rsmsgdelsel
|
||
msgid "Delete selected \"%s\"?"
|
||
msgstr "Видалити вибрані \"%s\"?"
|
||
|
||
#: ulng.rsmsgdelselt
|
||
msgid "Delete selected \"%s\" into trash can?"
|
||
msgstr "Видалити вибрані \"%s\" в смітник"
|
||
|
||
#: ulng.rsmsgdeltotrashforce
|
||
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
||
msgstr "Неможливо видалити \"%s\" у смітник! Видалити назавжди?"
|
||
|
||
#: ulng.rsmsgdisknotavail
|
||
msgid "Disk is not available"
|
||
msgstr "Диск не доступний"
|
||
|
||
#: ulng.rsmsgentercustomaction
|
||
msgid "Enter custom action name:"
|
||
msgstr "Введіть ім’я дії користувача:"
|
||
|
||
#: ulng.rsmsgenterfileext
|
||
msgid "Enter file extension:"
|
||
msgstr "Введіть розширення файла:"
|
||
|
||
#: ulng.rsmsgentername
|
||
msgid "Enter name:"
|
||
msgstr "Введіть ім'я:"
|
||
|
||
#: ulng.rsmsgenternewfiletypename
|
||
msgid "Enter name of new file type to create for extension \"%s\""
|
||
msgstr "Введіть ім'я нового типу файла, щоб створити розширення для \"%s\""
|
||
|
||
#: ulng.rsmsgerrbadarchive
|
||
msgid "CRC error in archive data"
|
||
msgstr "Контрольна сума не співпадає, архів пошкоджено."
|
||
|
||
#: ulng.rsmsgerrbaddata
|
||
msgid "Data is bad"
|
||
msgstr "Дані пошкоджено"
|
||
|
||
#: ulng.rsmsgerrcannotconnect
|
||
msgid "Can not connect to server: \"%s\""
|
||
msgstr "Неможливо з'єднатися з серевером: \"%s\""
|
||
|
||
#: ulng.rsmsgerrcannotcopyfile
|
||
msgid "Cannot copy file %s to %s"
|
||
msgstr "Помилка при копіюванні файлу %s в %s"
|
||
|
||
#: ulng.rsmsgerrcreatefiledirectoryexists
|
||
msgid "There already exists a directory named \"%s\"."
|
||
msgstr "Там вже існує каталог з ім'ям \"%s\"."
|
||
|
||
#: ulng.rsmsgerrdatenotsupported
|
||
msgid "Date %s is not supported"
|
||
msgstr "Дата %s не підтримується"
|
||
|
||
#: ulng.rsmsgerrdirexists
|
||
msgid "Directory %s exists!"
|
||
msgstr "Каталог %s існує!"
|
||
|
||
#: ulng.rsmsgerreaborted
|
||
msgid "Function aborted by user"
|
||
msgstr "Припинено користувачем"
|
||
|
||
#: ulng.rsmsgerreclose
|
||
msgid "Error closing file"
|
||
msgstr "Не можу закрити файл"
|
||
|
||
#: ulng.rsmsgerrecreate
|
||
msgid "Cannot create file"
|
||
msgstr "Не можу створити файл"
|
||
|
||
#: ulng.rsmsgerrendarchive
|
||
msgid "No more files in archive"
|
||
msgstr "В архіві немає більше файлів"
|
||
|
||
#: ulng.rsmsgerreopen
|
||
msgid "Cannot open existing file"
|
||
msgstr "Не можу відкрити існуючий файл"
|
||
|
||
#: ulng.rsmsgerreread
|
||
msgid "Error reading from file"
|
||
msgstr "Помилка читання з файлу"
|
||
|
||
#: ulng.rsmsgerrewrite
|
||
msgid "Error writing to file"
|
||
msgstr "Помилка запису в файл"
|
||
|
||
#: ulng.rsmsgerrforcedir
|
||
msgid "Can not create directory %s!"
|
||
msgstr "Не можу створити каталог %s!"
|
||
|
||
#: ulng.rsmsgerrinvalidlink
|
||
msgid "Invalid link"
|
||
msgstr "Некоректне посилання"
|
||
|
||
#: ulng.rsmsgerrnofiles
|
||
msgid "No files found"
|
||
msgstr "Файли не знайдено"
|
||
|
||
#: ulng.rsmsgerrnomemory
|
||
msgid "Not enough memory"
|
||
msgstr "Недостатньо пам'яті"
|
||
|
||
#: ulng.rsmsgerrnotsupported
|
||
msgid "Function not supported!"
|
||
msgstr "Функція не підтримується!"
|
||
|
||
#: ulng.rsmsgerrorincontextmenucommand
|
||
msgid "Error in context menu command"
|
||
msgstr "Помилка в команді контекстного меню"
|
||
|
||
#: ulng.rsmsgerrorloadingconfiguration
|
||
msgid "Error when loading configuration"
|
||
msgstr "Помилка при завантаженні конфігурації"
|
||
|
||
#: ulng.rsmsgerrregexpsyntax
|
||
msgid "Syntax error in regular expression!"
|
||
msgstr "Синтаксична помилка в регулярному виразі!"
|
||
|
||
#: ulng.rsmsgerrrename
|
||
msgid "Cannot rename file %s to %s"
|
||
msgstr "Неможливо перейменувати файл з %s в %s"
|
||
|
||
#: ulng.rsmsgerrsaveassociation
|
||
msgid "Can not save association!"
|
||
msgstr "Не вдається зберегти асоціацію!"
|
||
|
||
#: ulng.rsmsgerrsavefile
|
||
msgid "Cannot save file"
|
||
msgstr "Неможливо зберегти файл"
|
||
|
||
#: ulng.rsmsgerrsetattribute
|
||
msgid "Can not set attributes for \"%s\""
|
||
msgstr "Неможливо встановити атрибути для \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetdatetime
|
||
msgid "Can not set date/time for \"%s\""
|
||
msgstr "Неможливо встановити дату/час для \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetownership
|
||
msgid "Can not set owner/group for \"%s\""
|
||
msgstr "Не вдається встановити права/групу для \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetpermissions
|
||
msgid "Can not set permissions for \"%s\""
|
||
msgstr "Не вдається встановити права для \"%s\""
|
||
|
||
#: ulng.rsmsgerrsmallbuf
|
||
msgid "Buffer too small"
|
||
msgstr "Буфер переповнено"
|
||
|
||
#: ulng.rsmsgerrtoomanyfiles
|
||
msgid "Too many files to pack"
|
||
msgstr "Надто багато файлів для запакування"
|
||
|
||
#: ulng.rsmsgerrunknownformat
|
||
msgid "Archive format unknown"
|
||
msgstr "Архів пошкоджено або має невідомий формат"
|
||
|
||
#: ulng.rsmsgfavoritetabsdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsdraghereentry
|
||
msgid "Drag here other entries"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsentername
|
||
msgid "Enter a name this Favorite Tabs entry"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsenternametitle
|
||
msgid "Saving a new Favorite Tabs entry"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
||
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsextramode
|
||
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
||
msgid "Number of file(s) imported successfully: %d on %d"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
||
msgid "Legacy tabs imported"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsimporttitle
|
||
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
||
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabssimplemode
|
||
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabssubmenuname
|
||
#, fuzzy
|
||
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Назва підменю"
|
||
|
||
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
||
msgid "This will load the Favorite Tabs: \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavortietabssaveoverexisting
|
||
msgid "Save current tabs over existing Favorite Tabs entry"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfilechangedsave
|
||
msgid "File %s changed, save?"
|
||
msgstr "Файл %s змінено, зберегти?"
|
||
|
||
#: ulng.rsmsgfileexistsfileinfo
|
||
msgid "%s bytes, %s"
|
||
msgstr "%s байт, %s"
|
||
|
||
#: ulng.rsmsgfileexistsoverwrite
|
||
msgid "Overwrite:"
|
||
msgstr "Перезаписати:"
|
||
|
||
#: ulng.rsmsgfileexistsrwrt
|
||
msgid "File %s exists, overwrite?"
|
||
msgstr "Файл %s існує, перезаписати?"
|
||
|
||
#: ulng.rsmsgfileexistswithfile
|
||
msgid "With file:"
|
||
msgstr "З файлу:"
|
||
|
||
#: ulng.rsmsgfilenotfound
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Не знайдено файл \"%s\"."
|
||
|
||
#: ulng.rsmsgfileoperationsactive
|
||
msgid "File operations active"
|
||
msgstr "Активні операції з файлами"
|
||
|
||
#: ulng.rsmsgfileoperationsactivelong
|
||
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
||
msgstr "Деякі операції з файлами ще не завершені. Закриття Double Commander може призвести до втрати даних."
|
||
|
||
#: ulng.rsmsgfilepathovermaxpath
|
||
msgid ""
|
||
"The target name length (%d) is more than %d characters!\n"
|
||
"%s\n"
|
||
"Most programs will not be able to access a file/directory with such a long name!\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfilereadonly
|
||
#, fuzzy
|
||
#| msgid "File %s is marked as read-only. Delete it?"
|
||
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
||
msgstr "Файл %s помічений як доступний лише для читання. Видалити?"
|
||
|
||
#: ulng.rsmsgfilesizetoobig
|
||
msgid "The file size of \"%s\" is too big for destination file system!"
|
||
msgstr "Розмір файлу \"%s\" є занадто великим для цільової файлової системи!"
|
||
|
||
#: ulng.rsmsgfolderexistsrwrt
|
||
#, fuzzy
|
||
#| msgid "Folder %s exists, overwrite?"
|
||
msgid "Folder %s exists, merge?"
|
||
msgstr "Тека %s існує, перезаписати?"
|
||
|
||
#: ulng.rsmsgfollowsymlink
|
||
msgid "Follow symlink \"%s\"?"
|
||
msgstr "Прямувати за посиланням \"%s\"?"
|
||
|
||
#: ulng.rsmsgfortextformattoimport
|
||
msgid "Select the text format to import"
|
||
msgstr "Виберіть текстовий формат для імпорту"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectories
|
||
msgid "Add %d selected dirs"
|
||
msgstr "Додати %d виділених тек"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectory
|
||
msgid "Add selected dir: "
|
||
msgstr "Додати виділений каталог:"
|
||
|
||
#: ulng.rsmsghotdiraddthisdirectory
|
||
msgid "Add current dir: "
|
||
msgstr "Додати поточний каталог:"
|
||
|
||
#: ulng.rsmsghotdircommandname
|
||
msgid "Do command"
|
||
msgstr "Виконати каманду"
|
||
|
||
#: ulng.rsmsghotdircommandsample
|
||
msgid "cm_somthing"
|
||
msgstr "cm_somthing"
|
||
|
||
#: ulng.rsmsghotdirconfighotlist
|
||
msgctxt "ulng.rsmsghotdirconfighotlist"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Налаштування обраних каталогів"
|
||
|
||
#: ulng.rsmsghotdirdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
||
msgstr "Ви впевнені, що хочете видалити всі записи зі списку Обраних каталогів? (Шляху назад не буде!)"
|
||
|
||
#: ulng.rsmsghotdirdemocommand
|
||
msgid "This will execute the following command:"
|
||
msgstr "Це виконає наступну команду:"
|
||
|
||
#: ulng.rsmsghotdirdemoname
|
||
msgid "This is hot dir named "
|
||
msgstr "Це Вибраний каталог по імені"
|
||
|
||
#: ulng.rsmsghotdirdemopath
|
||
msgid "This will change active frame to the following path:"
|
||
msgstr "Це змінить активну панель на наступний шлях:"
|
||
|
||
#: ulng.rsmsghotdirdemotarget
|
||
msgid "And inactive frame would change to the following path:"
|
||
msgstr "І змінить неактивну панель на наступний шлях:"
|
||
|
||
#: ulng.rsmsghotdirerrorbackuping
|
||
msgid "Error backuping entries..."
|
||
msgstr "Помилка резервного копіювання..."
|
||
|
||
#: ulng.rsmsghotdirerrorexporting
|
||
msgid "Error exporting entries..."
|
||
msgstr "Помилка експорту об’єктів..."
|
||
|
||
#: ulng.rsmsghotdirexportall
|
||
msgid "Export all!"
|
||
msgstr "Експортувати все!"
|
||
|
||
#: ulng.rsmsghotdirexporthotlist
|
||
msgid "Export Directory Hotlist - Select the entries you want to export"
|
||
msgstr "Експорт обраних каталогів - Виділіть об’єкти для експорту"
|
||
|
||
#: ulng.rsmsghotdirexportsel
|
||
msgid "Export selected"
|
||
msgstr "Експотрувати виділене"
|
||
|
||
#: ulng.rsmsghotdirimportall
|
||
msgctxt "ulng.rsmsghotdirimportall"
|
||
msgid "Import all!"
|
||
msgstr "Імпортувати все!"
|
||
|
||
#: ulng.rsmsghotdirimporthotlist
|
||
msgid "Import Directory Hotlist - Select the entries you want to import"
|
||
msgstr "Імпорт обраних каталогів - Виділіть об’єкти для експорту"
|
||
|
||
#: ulng.rsmsghotdirimportsel
|
||
msgctxt "ulng.rsmsghotdirimportsel"
|
||
msgid "Import selected"
|
||
msgstr "Імпортувати виділене"
|
||
|
||
#: ulng.rsmsghotdirjustpath
|
||
msgctxt "ulng.rsmsghotdirjustpath"
|
||
msgid "Path"
|
||
msgstr "Шлях"
|
||
|
||
#: ulng.rsmsghotdirlocatehotlistfile
|
||
msgid "Locate \".hotlist\" file to import"
|
||
msgstr "Знайдіть файл \".hotlist\" для імпорту"
|
||
|
||
#: ulng.rsmsghotdirname
|
||
msgid "Hotdir name"
|
||
msgstr "Ім’я обраних каталогів"
|
||
|
||
#: ulng.rsmsghotdirnbnewentries
|
||
msgid "Number of new entries: %d"
|
||
msgstr "Кількість нових елементів: %d"
|
||
|
||
#: ulng.rsmsghotdirnothingtoexport
|
||
msgid "Nothing selected to export!"
|
||
msgstr "Нічого не вибрано для експорта!"
|
||
|
||
#: ulng.rsmsghotdirpath
|
||
msgid "Hotdir path"
|
||
msgstr "Шлях до Обраних каталогів"
|
||
|
||
#: ulng.rsmsghotdirreaddselecteddirectory
|
||
msgid "Re-Add selected dir: "
|
||
msgstr "Передодати обраний каталог:"
|
||
|
||
#: ulng.rsmsghotdirreaddthisdirectory
|
||
msgid "Re-Add current dir: "
|
||
msgstr "Передодати поточний каталог:"
|
||
|
||
#: ulng.rsmsghotdirrestorewhat
|
||
msgid "Enter location and filename of Directory Hotlist to restore"
|
||
msgstr "Введіть розташування і ім'я файлу Обраних каталогів для відновлення"
|
||
|
||
#: ulng.rsmsghotdirsimplecommand
|
||
msgctxt "ulng.rsmsghotdirsimplecommand"
|
||
msgid "Command:"
|
||
msgstr "Команди:"
|
||
|
||
#: ulng.rsmsghotdirsimpleendofmenu
|
||
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
||
msgid "(end of sub menu)"
|
||
msgstr "(кінець підменю)"
|
||
|
||
#: ulng.rsmsghotdirsimplemenu
|
||
msgctxt "ulng.rsmsghotdirsimplemenu"
|
||
msgid "Menu name:"
|
||
msgstr "Назва меню:"
|
||
|
||
#: ulng.rsmsghotdirsimplename
|
||
msgctxt "ulng.rsmsghotdirsimplename"
|
||
msgid "Name:"
|
||
msgstr "Назва:"
|
||
|
||
#: ulng.rsmsghotdirsimpleseparator
|
||
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
||
msgid "(separator)"
|
||
msgstr "(роздільник)"
|
||
|
||
#: ulng.rsmsghotdirsubmenuname
|
||
msgctxt "ulng.rsmsghotdirsubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Назва підменю"
|
||
|
||
#: ulng.rsmsghotdirtarget
|
||
msgid "Hotdir target"
|
||
msgstr "Обрані каталоги у призначенні"
|
||
|
||
#: ulng.rsmsghotdirtiporderpath
|
||
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Визначте, як має бути відсортована активна панель після зміни каталога "
|
||
|
||
#: ulng.rsmsghotdirtipordertarget
|
||
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Визначте, як має бути відсортована НЕактивна панель після зміни каталога "
|
||
|
||
#: ulng.rsmsghotdirtipspecialdirbut
|
||
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
||
msgstr "Деякі функції, щоб вибрати відповідний шлях - відносний, абсолютний, спеціальні папки Windows, тощо."
|
||
|
||
#: ulng.rsmsghotdirtotalbackuped
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Total entries saved: %d\n"
|
||
#| "\n"
|
||
#| "Backup filename: %s\n"
|
||
msgid ""
|
||
"Total entries saved: %d\n"
|
||
"\n"
|
||
"Backup filename: %s\n"
|
||
msgstr ""
|
||
"Всього об’єктів збережено: %d\n"
|
||
"\n"
|
||
"Ім’я резервного файла: %s\n"
|
||
|
||
#: ulng.rsmsghotdirtotalexported
|
||
msgid "Total entries exported: "
|
||
msgstr "Всього записів експортовано:"
|
||
|
||
#: ulng.rsmsghotdirwhattodelete
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Do you want to delete all elements inside the sub-menu [%s]?\n"
|
||
#| "Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
||
msgid ""
|
||
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
||
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
||
msgstr ""
|
||
"Ви хочете видалити всі елементи всередині підменю [%s]?\n"
|
||
"Відповідь НІ видалить тільки роздільники і залишить елементи всередині підменю.\n"
|
||
|
||
#: ulng.rsmsghotdirwheretosave
|
||
msgid "Enter location and filename where to save a Directory Hotlist file"
|
||
msgstr "Введіть розташування і ім’я файла, куди зберегти файл Обраних каталогів"
|
||
|
||
#: ulng.rsmsgincorrectfilelength
|
||
msgid "Incorrect resulting filelength for file : \"%s\""
|
||
msgstr "Невірна довжина файла : \"%s\""
|
||
|
||
#: ulng.rsmsginsertnextdisk
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Please insert next disk or something similar.\n"
|
||
#| "\n"
|
||
#| "It is to allow writing this file:\n"
|
||
#| "\"%s\"\n"
|
||
#| "\n"
|
||
#| "Number of bytes still to write: %d\n"
|
||
msgid ""
|
||
"Please insert next disk or something similar.\n"
|
||
"\n"
|
||
"It is to allow writing this file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Number of bytes still to write: %d\n"
|
||
msgstr ""
|
||
"Будь ласка, вставте наступний диск чи щось подібне.\n"
|
||
"\n"
|
||
"Це дозволить запис цього файла:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Кількість вільних байт для запису:%d\n"
|
||
|
||
#: ulng.rsmsginvalidcommandline
|
||
msgid "Error in command line"
|
||
msgstr "Помилка в командному рядку"
|
||
|
||
#: ulng.rsmsginvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Некоректне ім’я файла"
|
||
|
||
#: ulng.rsmsginvalidformatofconfigurationfile
|
||
msgid "Invalid format of configuration file"
|
||
msgstr "Неправильний формат файла конфігурації"
|
||
|
||
#: ulng.rsmsginvalidpath
|
||
msgid "Invalid path"
|
||
msgstr "Некоректний шлях"
|
||
|
||
#: ulng.rsmsginvalidpathlong
|
||
msgid "Path %s contains forbidden characters."
|
||
msgstr "Шлях %s містить недопустимі символи."
|
||
|
||
#: ulng.rsmsginvalidplugin
|
||
msgid "This is not a valid plugin!"
|
||
msgstr "Цей плагін недопустимий!"
|
||
|
||
#: ulng.rsmsginvalidpluginarchitecture
|
||
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
||
msgstr "Цей плагін створений для Double Commander %s. %s не може працювати з Double Commander %s!"
|
||
|
||
#: ulng.rsmsginvalidquoting
|
||
msgid "Invalid quoting"
|
||
msgstr "Недопустиме значення в лапках"
|
||
|
||
#: ulng.rsmsginvalidselection
|
||
msgid "Invalid selection."
|
||
msgstr "Некоректне виділення."
|
||
|
||
#: ulng.rsmsgloadingfilelist
|
||
msgid "Loading file list..."
|
||
msgstr "Завантаження списку файлів..."
|
||
|
||
#: ulng.rsmsglocatetcconfiguation
|
||
msgid "Locate TC configuration file (wincmd.ini)"
|
||
msgstr "Знайдіть файл конфігурації TC (wincmd.ini)"
|
||
|
||
#: ulng.rsmsglocatetcexecutable
|
||
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
||
msgstr "Знадіть виконуваний файл ТС (totalcmd.exe or totalcmd64.exe)"
|
||
|
||
#: ulng.rsmsglogcopy
|
||
msgid "Copy file %s"
|
||
msgstr "Копіювання файлу %s"
|
||
|
||
#: ulng.rsmsglogdelete
|
||
msgid "Delete file %s"
|
||
msgstr "Видалення файлу %s"
|
||
|
||
#: ulng.rsmsglogerror
|
||
msgid "Error: "
|
||
msgstr "Помилка: "
|
||
|
||
#: ulng.rsmsglogextcmdlaunch
|
||
msgid "Launch external"
|
||
msgstr "Зовнішній запуск"
|
||
|
||
#: ulng.rsmsglogextcmdresult
|
||
msgid "Result external"
|
||
msgstr "Зовнішній результат"
|
||
|
||
#: ulng.rsmsglogextract
|
||
msgid "Extract file %s"
|
||
msgstr "Розпакування файлу %s"
|
||
|
||
#: ulng.rsmsgloginfo
|
||
msgid "Info: "
|
||
msgstr "Інформація: "
|
||
|
||
#: ulng.rsmsgloglink
|
||
msgid "Create link %s"
|
||
msgstr "Створення посилання %s"
|
||
|
||
#: ulng.rsmsglogmkdir
|
||
msgid "Create directory %s"
|
||
msgstr "Створення каталогу %s"
|
||
|
||
#: ulng.rsmsglogmove
|
||
msgid "Move file %s"
|
||
msgstr "Переміщення файлу %s"
|
||
|
||
#: ulng.rsmsglogpack
|
||
msgid "Pack to file %s"
|
||
msgstr "Упакування в файл %s"
|
||
|
||
#: ulng.rsmsglogrmdir
|
||
msgid "Remove directory %s"
|
||
msgstr "Видалення каталогу %s"
|
||
|
||
#: ulng.rsmsglogsuccess
|
||
msgid "Done: "
|
||
msgstr "Виконано: "
|
||
|
||
#: ulng.rsmsglogsymlink
|
||
msgid "Create symlink %s"
|
||
msgstr "Створення символьного посилання %s"
|
||
|
||
#: ulng.rsmsglogtest
|
||
msgid "Test file integrity %s"
|
||
msgstr "Перевірка цілістності файлу %s"
|
||
|
||
#: ulng.rsmsglogwipe
|
||
msgid "Wipe file %s"
|
||
msgstr "Знищення файлу %s"
|
||
|
||
#: ulng.rsmsglogwipedir
|
||
msgid "Wipe directory %s"
|
||
msgstr "Знищення каталогу %s"
|
||
|
||
#: ulng.rsmsgmasterpassword
|
||
msgid "Master Password"
|
||
msgstr "Суперпароль"
|
||
|
||
#: ulng.rsmsgmasterpasswordenter
|
||
msgid "Please enter the master password:"
|
||
msgstr "Будь ласка, введіть суперпароль:"
|
||
|
||
#: ulng.rsmsgnewfile
|
||
msgid "New file"
|
||
msgstr "Новий файл"
|
||
|
||
#: ulng.rsmsgnextvolunpack
|
||
msgid "Next volume will be unpacked"
|
||
msgstr "Наступний том буде розпаковано"
|
||
|
||
#: ulng.rsmsgnofiles
|
||
msgid "No files"
|
||
msgstr "Файли відсутні"
|
||
|
||
#: ulng.rsmsgnofilesselected
|
||
msgid "No files selected."
|
||
msgstr "Немає виділених файлів."
|
||
|
||
#: ulng.rsmsgnofreespacecont
|
||
msgid "No enough free space on target drive, Continue?"
|
||
msgstr "Недостатньо місця на отримувачі. Продовжити?"
|
||
|
||
#: ulng.rsmsgnofreespaceretry
|
||
msgid "No enough free space on target drive, Retry?"
|
||
msgstr "Недостатньо місця на отримувачі. Повторити?"
|
||
|
||
#: ulng.rsmsgnotdelete
|
||
msgid "Can not delete file %s"
|
||
msgstr "Не можу стерти файл %s"
|
||
|
||
#: ulng.rsmsgnotimplemented
|
||
msgid "Not implemented."
|
||
msgstr "Не реалізовано"
|
||
|
||
#: ulng.rsmsgpanelpreview
|
||
msgctxt "ulng.rsmsgpanelpreview"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Нижче попередній перегляд. Ви можете переміщати курсор і вибрати файли, щоб отримати фактичний вигляд різних налаштувань."
|
||
|
||
#: ulng.rsmsgpassword
|
||
msgid "Password:"
|
||
msgstr "Пароль:"
|
||
|
||
#: ulng.rsmsgpassworddiff
|
||
msgid "Passwords are different!"
|
||
msgstr "Паролі відрізняються!"
|
||
|
||
#: ulng.rsmsgpasswordenter
|
||
msgid "Please enter the password:"
|
||
msgstr "Будь ласка, введіть пароль:"
|
||
|
||
#: ulng.rsmsgpasswordfirewall
|
||
msgid "Password (Firewall):"
|
||
msgstr "Пароль (Фаєрвол):"
|
||
|
||
#: ulng.rsmsgpasswordverify
|
||
msgid "Please re-enter the password for verification:"
|
||
msgstr "Будь ласка, ще раз введіть пароль для перевірки:"
|
||
|
||
#: ulng.rsmsgpopuphotdelete
|
||
msgid "&Delete %s"
|
||
msgstr "Видалити %s"
|
||
|
||
#: ulng.rsmsgpresetalreadyexists
|
||
msgid "Preset \"%s\" already exists. Overwrite?"
|
||
msgstr "Шаблон \"%s\" вже існує. Перезаписати?"
|
||
|
||
#: ulng.rsmsgproblemexecutingcommand
|
||
msgid "Problem executing command (%s)"
|
||
msgstr "Проблема виконання команди (%s)"
|
||
|
||
#: ulng.rsmsgpromptaskingfilename
|
||
msgid "Filename for dropped text:"
|
||
msgstr "Ім’я файла для перетягнутого тексту:"
|
||
|
||
#: ulng.rsmsgprovidethisfile
|
||
msgid "Please, make this file available. Retry?"
|
||
msgstr "Будь ласка, переконайтеся у доступності файла. Спробувати ще раз?"
|
||
|
||
#: ulng.rsmsgrenamefavtabs
|
||
msgid "Enter new friendly name for this Favorite Tabs"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgrenamefavtabsmenu
|
||
msgid "Enter new name for this menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgrenfldr
|
||
msgid "Rename/move %d selected files/directories?"
|
||
msgstr "Перейменувати/перемістити %d вибраних файлів/каталогів?"
|
||
|
||
#: ulng.rsmsgrensel
|
||
msgid "Rename/move selected \"%s\"?"
|
||
msgstr "Перейменувати/перемістити вибраний \"%s\"?"
|
||
|
||
#: ulng.rsmsgrestartforapplychanges
|
||
msgid "Please, restart Double Commander in order to apply changes"
|
||
msgstr "Будь ласка, перезапустіть Double Commander для того щоб зміни вступили в дію"
|
||
|
||
#: ulng.rsmsgsekectfiletype
|
||
msgid "Select to which file type to add extension \"%s\""
|
||
msgstr "Виберіть тип файлу до якого треба додати розширення \"%s\""
|
||
|
||
#: ulng.rsmsgselectedinfo
|
||
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
||
msgstr "Виділено: %s з %s, файлів: %d з %d, папок: %d з %d"
|
||
|
||
#: ulng.rsmsgselectexecutablefile
|
||
msgid "Select executable file for"
|
||
msgstr "Виберіть виконуваний файл"
|
||
|
||
#: ulng.rsmsgselectonlychecksumfiles
|
||
msgid "Please select only checksum files!"
|
||
msgstr "Виберіть лише файли контрольних сум!"
|
||
|
||
#: ulng.rsmsgsellocnextvol
|
||
msgid "Please select location of next volume"
|
||
msgstr "Вкажіть шлях до наступного тому"
|
||
|
||
#: ulng.rsmsgsetvolumelabel
|
||
msgid "Set volume label"
|
||
msgstr "Встановити мітку диску"
|
||
|
||
#: ulng.rsmsgspecialdir
|
||
msgid "Special Dirs"
|
||
msgstr "Спеціальні теки"
|
||
|
||
#: ulng.rsmsgspecialdiraddacti
|
||
msgid "Add path from active frame"
|
||
msgstr "Додати шлях від активного фрейма"
|
||
|
||
#: ulng.rsmsgspecialdiraddnonacti
|
||
msgid "Add path from inactive frame"
|
||
msgstr "Додати шлях від неактивного фрейма"
|
||
|
||
#: ulng.rsmsgspecialdirbrowssel
|
||
msgid "Browse and use selected path"
|
||
msgstr "Перейти і використати обраний шлях"
|
||
|
||
#: ulng.rsmsgspecialdirenvvar
|
||
msgid "Use environment variable..."
|
||
msgstr "Використовуйте змінну оточення..."
|
||
|
||
#: ulng.rsmsgspecialdirgotodc
|
||
msgid "Go to Double Commander special path..."
|
||
msgstr "Перейти до спеціальної теки DC..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoenvvar
|
||
msgid "Go to environment variable..."
|
||
msgstr "Перейти в змінну оточення..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoother
|
||
msgid "Go to other Windows special folder..."
|
||
msgstr "пеерйти у інші спеціальні папки Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirgototc
|
||
msgid "Go to Windows special folder (TC)..."
|
||
msgstr "Перейти у спеціальні теки Windows (ТС)..."
|
||
|
||
#: ulng.rsmsgspecialdirmakereltohotdir
|
||
msgid "Make relative to hotdir path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirmkabso
|
||
msgid "Make path absolute"
|
||
msgstr "Зробити шлях відносним"
|
||
|
||
#: ulng.rsmsgspecialdirmkdcrel
|
||
msgid "Make relative to Double Commander special path..."
|
||
msgstr "Зробити відносний шлях до спеціальної папки DC..."
|
||
|
||
#: ulng.rsmsgspecialdirmkenvrel
|
||
msgid "Make relative to environment variable..."
|
||
msgstr "Зробити відносний шлях до змінної оточення..."
|
||
|
||
#: ulng.rsmsgspecialdirmktctel
|
||
msgid "Make relative to Windows special folder (TC)..."
|
||
msgstr "Зробити відносний шлях до спеціальної теки (ТС)..."
|
||
|
||
#: ulng.rsmsgspecialdirmkwnrel
|
||
msgid "Make relative to other Windows special folder..."
|
||
msgstr "Зробити відносний шлях до спеціальної теки Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusedc
|
||
msgid "Use Double Commander special path..."
|
||
msgstr "Використовувати спеціальні шляхи DC..."
|
||
|
||
#: ulng.rsmsgspecialdirusehotdir
|
||
msgid "Use hotdir path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdiruseother
|
||
msgid "Use other Windows special folder..."
|
||
msgstr "Використовувати іншу спеціальну папку Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusetc
|
||
msgid "Use Windows special folder (TC)..."
|
||
msgstr "Використовувати спеціальну теку Windows (ТС)..."
|
||
|
||
#: ulng.rsmsgtabforopeninginnewtab
|
||
msgid "This tab (%s) is locked! Open directory in another tab?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtabrenamecaption
|
||
msgid "Rename tab"
|
||
msgstr "Перейменування вкладки"
|
||
|
||
#: ulng.rsmsgtabrenameprompt
|
||
msgid "New tab name:"
|
||
msgstr "Нове ім’я вкладки"
|
||
|
||
#: ulng.rsmsgtargetdir
|
||
msgid "Target path:"
|
||
msgstr "Шлях призначення:"
|
||
|
||
#: ulng.rsmsgtcconfignotfound
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Error! Cannot find the TC configuration file:\n"
|
||
#| "%s\n"
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration file:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Помилка! Відсутній файл конфігурації ТС:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcexecutablenotfound
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Error! Cannot find the TC configuration executable:\n"
|
||
#| "%s\n"
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration executable:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Помилка! Відсутній виконуваний файл ТС:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcisrunning
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Error! TC is still running but it should be closed for this operation.\n"
|
||
#| "Close it and press OK or press CANCEL to abort.\n"
|
||
msgid ""
|
||
"Error! TC is still running but it should be closed for this operation.\n"
|
||
"Close it and press OK or press CANCEL to abort.\n"
|
||
msgstr ""
|
||
"Помилка! ТС має бути закритий для цієї операції.\n"
|
||
"Закрийте його і натисніть Гаразд або натисніть Скасувати.\n"
|
||
|
||
#: ulng.rsmsgtctoolbarnotfound
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
||
#| "%s\n"
|
||
msgid ""
|
||
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Помилка! Відсутня необхідна тека для Панелі інструментів ТС:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a TC Toolbar file"
|
||
msgstr "Введіть розташування і ім'я файлу, куди зберегти файл панелі інструментів ТС"
|
||
|
||
#: ulng.rsmsgthisisnowinclipboard
|
||
msgid "\"%s\" is now in the clipboard"
|
||
msgstr "\"%s\" тепер в буфері обміну"
|
||
|
||
#: ulng.rsmsgtitleextnotinfiletype
|
||
msgid "Extension of selected file is not in any recognized file types"
|
||
msgstr "Розширення вибраного файлу немає у визнаних типах файлів"
|
||
|
||
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
||
msgid "Locate \".toolbar\" file to import"
|
||
msgstr "Знайдіть файл \".toolbar\" для імпорту"
|
||
|
||
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
||
msgid "Locate \".BAR\" file to import"
|
||
msgstr "Знайдіть файл \".BAR\" для імпорту"
|
||
|
||
#: ulng.rsmsgtoolbarrestorewhat
|
||
msgid "Enter location and filename of Toolbar to restore"
|
||
msgstr "Введіть розташування і ім'я файла Панелі інструментів для відновлення"
|
||
|
||
#: ulng.rsmsgtoolbarsaved
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "Saved!\n"
|
||
#| "Toolbar filename: %s\n"
|
||
msgid ""
|
||
"Saved!\n"
|
||
"Toolbar filename: %s\n"
|
||
msgstr ""
|
||
"Збережено!\n"
|
||
"Назва панелі інструментів: %s\n"
|
||
|
||
#: ulng.rsmsgtoomanyfilesselected
|
||
msgid "Too many files selected."
|
||
msgstr "Виділено надто багато файлів."
|
||
|
||
#: ulng.rsmsgundeterminednumberoffile
|
||
msgid "Undetermined"
|
||
msgstr "Невизначений"
|
||
|
||
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
||
msgid "ERROR: Unexpected Tree View Menu usage!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgurl
|
||
msgid "URL:"
|
||
msgstr "URL:"
|
||
|
||
#: ulng.rsmsguserdidnotsetextension
|
||
msgid "<NO EXT>"
|
||
msgstr "<NO EXT>"
|
||
|
||
#: ulng.rsmsguserdidnotsetname
|
||
msgid "<NO NAME>"
|
||
msgstr "<NO EXT>"
|
||
|
||
#: ulng.rsmsgusername
|
||
msgid "User name:"
|
||
msgstr "Ім'я користувача:"
|
||
|
||
#: ulng.rsmsgusernamefirewall
|
||
msgid "User name (Firewall):"
|
||
msgstr "Ім'я користувача (Фаєрвол):"
|
||
|
||
#: ulng.rsmsgvolumelabel
|
||
msgid "Volume label:"
|
||
msgstr "Мітка диску:"
|
||
|
||
#: ulng.rsmsgvolumesizeenter
|
||
msgid "Please enter the volume size:"
|
||
msgstr "Будь ласка, введіть розмір тому:"
|
||
|
||
#: ulng.rsmsgwipefldr
|
||
msgid "Wipe %d selected files/directories?"
|
||
msgstr "Стерти %d обраних файлів/каталогів?"
|
||
|
||
#: ulng.rsmsgwipesel
|
||
msgid "Wipe selected \"%s\"?"
|
||
msgstr "Стерти обраний \"%s\"?"
|
||
|
||
#: ulng.rsmsgwithactionwith
|
||
msgid "with"
|
||
msgstr "з"
|
||
|
||
#: ulng.rsmulrenfilenamestylelist
|
||
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
||
msgstr "Без змін;ПРОПИСНІ;рядкові;З Прописної;Кожне Слово З Прописної;"
|
||
|
||
#: ulng.rsmulrenwronglinesnumber
|
||
msgid "File contains wrong number of lines: %d, should be %d!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsnewsearchclearfilteroptions
|
||
msgid "Keep;Clear;Prompt"
|
||
msgstr ""
|
||
|
||
#: ulng.rsnoequivalentinternalcommand
|
||
msgid "No internal equivalent command"
|
||
msgstr ""
|
||
|
||
#: ulng.rsnofindfileswindowyet
|
||
msgid "Sorry, no \"Find files\" window yet..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsnootherfindfileswindowtoclose
|
||
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperaborted
|
||
msgid "Aborted"
|
||
msgstr "Перервано"
|
||
|
||
#: ulng.rsopercalculatingchecksum
|
||
msgid "Calculating checksum"
|
||
msgstr "Розрахунок контрольної суми"
|
||
|
||
#: ulng.rsopercalculatingchecksumin
|
||
msgid "Calculating checksum in \"%s\""
|
||
msgstr "Розрахунок контрольної суми в \"%s\""
|
||
|
||
#: ulng.rsopercalculatingchecksumof
|
||
msgid "Calculating checksum of \"%s\""
|
||
msgstr "Розрахунок контрольної суми \"%s\""
|
||
|
||
#: ulng.rsopercalculatingstatictics
|
||
msgctxt "ulng.rsopercalculatingstatictics"
|
||
msgid "Calculating"
|
||
msgstr "Підрахунок"
|
||
|
||
#: ulng.rsopercalculatingstatisticsin
|
||
msgid "Calculating \"%s\""
|
||
msgstr "Розрахунок \"%s\""
|
||
|
||
#: ulng.rsopercombining
|
||
msgid "Joining"
|
||
msgstr "З’єднання"
|
||
|
||
#: ulng.rsopercombiningfromto
|
||
msgid "Joining files in \"%s\" to \"%s\""
|
||
msgstr "Додавання файлів in \"%s\" to \"%s\""
|
||
|
||
#: ulng.rsopercopying
|
||
msgid "Copying"
|
||
msgstr "Копіювання"
|
||
|
||
#: ulng.rsopercopyingfromto
|
||
msgid "Copying from \"%s\" to \"%s\""
|
||
msgstr "Копіювання з \"%s\" до \"%s\""
|
||
|
||
#: ulng.rsopercopyingsomethingto
|
||
msgid "Copying \"%s\" to \"%s\""
|
||
msgstr "Копіювання \"%s\" до \"%s\""
|
||
|
||
#: ulng.rsopercreatingdirectory
|
||
msgid "Creating directory"
|
||
msgstr "Створення каталогу"
|
||
|
||
#: ulng.rsopercreatingsomedirectory
|
||
msgid "Creating directory \"%s\""
|
||
msgstr "Створення каталогу \"%s\""
|
||
|
||
#: ulng.rsoperdeleting
|
||
msgctxt "ulng.rsoperdeleting"
|
||
msgid "Deleting"
|
||
msgstr "Видалення"
|
||
|
||
#: ulng.rsoperdeletingin
|
||
msgid "Deleting in \"%s\""
|
||
msgstr "Видалення в \"%s\""
|
||
|
||
#: ulng.rsoperdeletingsomething
|
||
msgid "Deleting \"%s\""
|
||
msgstr "Видалення \"%s\""
|
||
|
||
#: ulng.rsoperexecuting
|
||
msgid "Executing"
|
||
msgstr "Розпакування"
|
||
|
||
#: ulng.rsoperexecutingsomething
|
||
msgid "Executing \"%s\""
|
||
msgstr "Виконання \"%s\""
|
||
|
||
#: ulng.rsoperextracting
|
||
msgid "Extracting"
|
||
msgstr "Розпакування"
|
||
|
||
#: ulng.rsoperextractingfromto
|
||
msgid "Extracting from \"%s\" to \"%s\""
|
||
msgstr "Видобування з \"%s\" до \"%s\""
|
||
|
||
#: ulng.rsoperfinished
|
||
msgid "Finished"
|
||
msgstr "Завершено"
|
||
|
||
#: ulng.rsoperlisting
|
||
msgid "Listing"
|
||
msgstr "Створення списку"
|
||
|
||
#: ulng.rsoperlistingin
|
||
#, fuzzy
|
||
msgid "Listing \"%s\""
|
||
msgstr "Складання списку \"%s\""
|
||
|
||
#: ulng.rsopermoving
|
||
msgid "Moving"
|
||
msgstr "Переміщення"
|
||
|
||
#: ulng.rsopermovingfromto
|
||
msgid "Moving from \"%s\" to \"%s\""
|
||
msgstr "Переміщення з \"%s\" до \"%s\""
|
||
|
||
#: ulng.rsopermovingsomethingto
|
||
msgid "Moving \"%s\" to \"%s\""
|
||
msgstr "Переміщення \"%s\" до \"%s\""
|
||
|
||
#: ulng.rsopernotstarted
|
||
msgid "Not started"
|
||
msgstr "Не запущено"
|
||
|
||
#: ulng.rsoperpacking
|
||
msgid "Packing"
|
||
msgstr "Упакування"
|
||
|
||
#: ulng.rsoperpackingfromto
|
||
msgid "Packing from \"%s\" to \"%s\""
|
||
msgstr "Упакування з \"%s\" до \"%s\""
|
||
|
||
#: ulng.rsoperpackingsomethingto
|
||
msgid "Packing \"%s\" to \"%s\""
|
||
msgstr "Упакування \"%s\" до \"%s\""
|
||
|
||
#: ulng.rsoperpaused
|
||
msgid "Paused"
|
||
msgstr "Призупинено"
|
||
|
||
#: ulng.rsoperpausing
|
||
msgid "Pausing"
|
||
msgstr "Призупинення"
|
||
|
||
#: ulng.rsoperrunning
|
||
msgid "Running"
|
||
msgstr "Виконується"
|
||
|
||
#: ulng.rsopersettingproperty
|
||
msgid "Setting property"
|
||
msgstr "Встановлення властивостей"
|
||
|
||
#: ulng.rsopersettingpropertyin
|
||
msgid "Setting property in \"%s\""
|
||
msgstr "Встановлення властивостей в \"%s\""
|
||
|
||
#: ulng.rsopersettingpropertyof
|
||
msgid "Setting property of \"%s\""
|
||
msgstr "Встановлення властивостей на \"%s\""
|
||
|
||
#: ulng.rsopersplitting
|
||
msgid "Splitting"
|
||
msgstr "Розрізання"
|
||
|
||
#: ulng.rsopersplittingfromto
|
||
msgid "Splitting \"%s\" to \"%s\""
|
||
msgstr "Розрізання \"%s\" до \"%s\""
|
||
|
||
#: ulng.rsoperstarting
|
||
msgid "Starting"
|
||
msgstr "Запускається"
|
||
|
||
#: ulng.rsoperstopped
|
||
msgid "Stopped"
|
||
msgstr "Зупинено"
|
||
|
||
#: ulng.rsoperstopping
|
||
msgid "Stopping"
|
||
msgstr "Зупиняється"
|
||
|
||
#: ulng.rsopertesting
|
||
msgid "Testing"
|
||
msgstr "Тестування"
|
||
|
||
#: ulng.rsopertestingin
|
||
msgid "Testing in \"%s\""
|
||
msgstr "Тестування в \"%s\""
|
||
|
||
#: ulng.rsopertestingsomething
|
||
msgid "Testing \"%s\""
|
||
msgstr "Тестування \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksum
|
||
msgid "Verifying checksum"
|
||
msgstr "Перевірка контрольної суми"
|
||
|
||
#: ulng.rsoperverifyingchecksumin
|
||
msgid "Verifying checksum in \"%s\""
|
||
msgstr "Перевірка контрольної суми в \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksumof
|
||
msgid "Verifying checksum of \"%s\""
|
||
msgstr "Перевірка контрольної суми \"%s\""
|
||
|
||
#: ulng.rsoperwaitingforconnection
|
||
msgid "Waiting for access to file source"
|
||
msgstr "Очікування доступу до джерела"
|
||
|
||
#: ulng.rsoperwaitingforfeedback
|
||
msgid "Waiting for user response"
|
||
msgstr "Очікування відповіді від користувача"
|
||
|
||
#: ulng.rsoperwiping
|
||
msgid "Wiping"
|
||
msgstr "Стирання"
|
||
|
||
#: ulng.rsoperwipingin
|
||
msgid "Wiping in \"%s\""
|
||
msgstr "Стирання в \"%s\""
|
||
|
||
#: ulng.rsoperwipingsomething
|
||
msgid "Wiping \"%s\""
|
||
msgstr "Стирання \"%s\""
|
||
|
||
#: ulng.rsoperworking
|
||
msgid "Working"
|
||
msgstr "Опрацювання"
|
||
|
||
#: ulng.rsoptaddfrommainpanel
|
||
msgid "Add at beginning;Add at the end;Smart add"
|
||
msgstr "Додати на початку;Додати в кінці;Розумне додавання"
|
||
|
||
#: ulng.rsoptarchivedelete
|
||
msgctxt "ulng.rsoptarchivedelete"
|
||
msgid "Delete:"
|
||
msgstr "Видалити:"
|
||
|
||
#: ulng.rsoptarchiveextractwithoutpath
|
||
msgid "Extract without path:"
|
||
msgstr "Розпакувати без шляхів:"
|
||
|
||
#: ulng.rsoptarchiveformmode
|
||
msgid "Format parsing mode:"
|
||
msgstr "Синтаксичний аналіз:"
|
||
|
||
#: ulng.rsoptarchiveid
|
||
msgctxt "ulng.rsoptarchiveid"
|
||
msgid "ID:"
|
||
msgstr "ID:"
|
||
|
||
#: ulng.rsoptarchiveidpos
|
||
msgctxt "ulng.rsoptarchiveidpos"
|
||
msgid "ID Position:"
|
||
msgstr "Позиція ID:"
|
||
|
||
#: ulng.rsoptarchiveidseekrange
|
||
msgctxt "ulng.rsoptarchiveidseekrange"
|
||
msgid "ID Seek Range:"
|
||
msgstr "Діапазон пошуку ID:"
|
||
|
||
#: ulng.rsoptarchiveparam
|
||
msgid "Parameter"
|
||
msgstr "Параметр"
|
||
|
||
#: ulng.rsoptarchivepasswordquery
|
||
msgid "Password query string:"
|
||
msgstr "Рядок запиту пароля:"
|
||
|
||
#: ulng.rsoptarchiveselfextract
|
||
msgctxt "ulng.rsoptarchiveselfextract"
|
||
msgid "Create self extracting archive:"
|
||
msgstr "Створити саморозпаковуваний архів:"
|
||
|
||
#: ulng.rsoptarchivetest
|
||
msgctxt "ulng.rsoptarchivetest"
|
||
msgid "Test:"
|
||
msgstr "Перевірити:"
|
||
|
||
#: ulng.rsoptarchivetypename
|
||
msgid "Archive type name:"
|
||
msgstr "Тип архіву:"
|
||
|
||
#: ulng.rsoptarchivevalue
|
||
msgctxt "ulng.rsoptarchivevalue"
|
||
msgid "Value"
|
||
msgstr "Значення"
|
||
|
||
#: ulng.rsoptassocpluginwith
|
||
msgid "Associate plugin \"%s\" with:"
|
||
msgstr "Асоціювати плагін \"%s\" з:"
|
||
|
||
#: ulng.rsoptautosizecolumn
|
||
msgid "First;Last;"
|
||
msgstr "Першої колонки;Останньої колонки;"
|
||
|
||
#: ulng.rsoptconfigsortorder
|
||
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
||
msgstr "Класичне типове сортування;У алфавітному порядку (мова в першу чергу)"
|
||
|
||
#: ulng.rsoptdifferframeposition
|
||
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
||
msgstr "Активна панель зліва, неактивна панель зправа (класично);Ліва панель - зліва, права зправа"
|
||
|
||
#: ulng.rsoptdisable
|
||
msgid "Disable"
|
||
msgstr "Вимкнути"
|
||
|
||
#: ulng.rsoptenable
|
||
msgctxt "ulng.rsoptenable"
|
||
msgid "Enable"
|
||
msgstr "Увімкнути"
|
||
|
||
#: ulng.rsoptenterext
|
||
msgid "Enter extension"
|
||
msgstr "Введіть розширення"
|
||
|
||
#: ulng.rsoptfavoritetabswheretoaddinlist
|
||
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptfileoperationsprogresskind
|
||
msgid "separate window;minimized separate window;operations panel"
|
||
msgstr "в окремому вікні; мінімізувати в окремому вікні; панель операції"
|
||
|
||
#: ulng.rsoptfilesizeformat
|
||
msgid "float;B;K;M;G"
|
||
msgstr "Плаваючий;Б;KБ;MБ;ГБ"
|
||
|
||
#: ulng.rsopthotkeysadddeleteshortcutlong
|
||
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
||
msgstr "Буде зареєстровано гар.клавішу %s для cm_Delete , таким чином вона буде використана для реверсінгу налаштування."
|
||
|
||
#: ulng.rsopthotkeysaddhotkey
|
||
msgid "Add hotkey for %s"
|
||
msgstr "Додати гар.кл. для %s"
|
||
|
||
#: ulng.rsopthotkeysaddshortcutbutton
|
||
msgid "Add shortcut"
|
||
msgstr "Додати гар.клавішу"
|
||
|
||
#: ulng.rsopthotkeyscannotsetshortcut
|
||
msgid "Cannot set shortcut"
|
||
msgstr "Не можливо встановити ярлик"
|
||
|
||
#: ulng.rsopthotkeyschangeshortcut
|
||
msgid "Change shortcut"
|
||
msgstr "Змінити ярлик"
|
||
|
||
#: ulng.rsopthotkeyscommand
|
||
msgctxt "ulng.rsopthotkeyscommand"
|
||
msgid "Command"
|
||
msgstr "Команди"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
||
#, fuzzy
|
||
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
||
msgstr "Ярлик %s для cm_Delete має параметр, який перекриває ці налаштування. Змінити цей параметр, щоб використовувати глобальні налаштування?"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
||
#, fuzzy
|
||
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
||
msgstr "Параметр ярлика %s для cm_Delete повинен бути змінений відповідно до контекстного %s. Змінити його?"
|
||
|
||
#: ulng.rsopthotkeysdescription
|
||
msgctxt "ulng.rsopthotkeysdescription"
|
||
msgid "Description"
|
||
msgstr "Опис"
|
||
|
||
#: ulng.rsopthotkeysedithotkey
|
||
msgid "Edit hotkey for %s"
|
||
msgstr "Змінити гар.клавішу для %s"
|
||
|
||
#: ulng.rsopthotkeysfixparameter
|
||
msgid "Fix parameter"
|
||
msgstr "Зафіксувати параметр"
|
||
|
||
#: ulng.rsopthotkeyshotkey
|
||
msgctxt "ulng.rsopthotkeyshotkey"
|
||
msgid "Hotkey"
|
||
msgstr "Гаряча клавіша"
|
||
|
||
#: ulng.rsopthotkeyshotkeys
|
||
msgctxt "ulng.rsopthotkeyshotkeys"
|
||
msgid "Hotkeys"
|
||
msgstr "Гарячі клавіші"
|
||
|
||
#: ulng.rsopthotkeysnohotkey
|
||
msgid "<none>"
|
||
msgstr "<none>"
|
||
|
||
#: ulng.rsopthotkeysparameters
|
||
msgctxt "ulng.rsopthotkeysparameters"
|
||
msgid "Parameters"
|
||
msgstr "Параметри"
|
||
|
||
#: ulng.rsopthotkeyssetdeleteshortcut
|
||
msgid "Set shortcut to delete file"
|
||
msgstr "Встановити ярлик для видалення файлу"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
||
#, fuzzy
|
||
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
||
msgstr "Для цього налаштування роботи з ярликом %s, ярлику %s повинен бути присвоєний cm_Delete, але це вже присвоєно для %s. Змінити це?"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
||
#, fuzzy
|
||
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
||
msgstr "Ярлик %s для cm_Delete є ярликом послідовності для якого не може бути призначена гар.кл. з інв. Shift. Цей параметр не буде працювати."
|
||
|
||
#: ulng.rsopthotkeysshortcutused
|
||
msgid "Shortcut in use"
|
||
msgstr "Гаряча клавіша вже використовується"
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext1
|
||
#, fuzzy,badformat
|
||
#| msgid "Shortcut %s is already used for %s."
|
||
msgid "Shortcut %s is already used."
|
||
msgstr "Гаряча клавіша %s вже використовується для %s."
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext2
|
||
msgid "Change it to %s?"
|
||
msgstr "Змінити на %s?"
|
||
|
||
#: ulng.rsopthotkeysusedby
|
||
msgid "used for %s in %s"
|
||
msgstr "використовується для %s в %s"
|
||
|
||
#: ulng.rsopthotkeysusedwithdifferentparams
|
||
#, fuzzy
|
||
msgid "used for this command but with different parameters"
|
||
msgstr "використовувати для цієї команди, але з різними параметрами"
|
||
|
||
#: ulng.rsoptionseditorarchivers
|
||
msgctxt "ulng.rsoptionseditorarchivers"
|
||
msgid "Archivers"
|
||
msgstr "Архіватори"
|
||
|
||
#: ulng.rsoptionseditorautorefresh
|
||
msgctxt "ulng.rsoptionseditorautorefresh"
|
||
msgid "Auto refresh"
|
||
msgstr "Автооновлення"
|
||
|
||
#: ulng.rsoptionseditorbehavior
|
||
msgctxt "ulng.rsoptionseditorbehavior"
|
||
msgid "Behaviors"
|
||
msgstr "Поведінка"
|
||
|
||
#: ulng.rsoptionseditorbriefview
|
||
msgctxt "ulng.rsoptionseditorbriefview"
|
||
msgid "Brief"
|
||
msgstr "Короткий"
|
||
|
||
#: ulng.rsoptionseditorcolors
|
||
msgctxt "ulng.rsoptionseditorcolors"
|
||
msgid "Colors"
|
||
msgstr "Кольори"
|
||
|
||
#: ulng.rsoptionseditorcolumnsview
|
||
msgctxt "ulng.rsoptionseditorcolumnsview"
|
||
msgid "Columns"
|
||
msgstr "Колонки"
|
||
|
||
#: ulng.rsoptionseditorconfiguration
|
||
msgctxt "ulng.rsoptionseditorconfiguration"
|
||
msgid "Configuration"
|
||
msgstr "Конфігурація"
|
||
|
||
#: ulng.rsoptionseditorcustomcolumns
|
||
msgid "Custom columns"
|
||
msgstr "Набір колонок"
|
||
|
||
#: ulng.rsoptionseditordirectoryhotlist
|
||
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Вибрані каталоги"
|
||
|
||
#: ulng.rsoptionseditordraganddrop
|
||
msgid "Drag & drop"
|
||
msgstr "Перетягування"
|
||
|
||
#: ulng.rsoptionseditordriveslistbutton
|
||
msgid "Drives list button"
|
||
msgstr "Кнопки дисків"
|
||
|
||
#: ulng.rsoptionseditorfavoritetabs
|
||
msgid "Favorite Tabs"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptionseditorfileassicextra
|
||
msgid "File associations extra"
|
||
msgstr "Додаткові асоціації файлу"
|
||
|
||
#: ulng.rsoptionseditorfileassoc
|
||
msgctxt "ulng.rsoptionseditorfileassoc"
|
||
msgid "File associations"
|
||
msgstr "Асоціації з файлами"
|
||
|
||
#: ulng.rsoptionseditorfilenewfiletypes
|
||
#, fuzzy
|
||
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
||
msgid "New"
|
||
msgstr "Створити"
|
||
|
||
#: ulng.rsoptionseditorfileoperations
|
||
msgctxt "ulng.rsoptionseditorfileoperations"
|
||
msgid "File operations"
|
||
msgstr "Операції з файлами"
|
||
|
||
#: ulng.rsoptionseditorfilepanels
|
||
msgctxt "ulng.rsoptionseditorfilepanels"
|
||
msgid "File panels"
|
||
msgstr "Файлові панелі"
|
||
|
||
#: ulng.rsoptionseditorfilesearch
|
||
#, fuzzy
|
||
msgctxt "ulng.rsoptionseditorfilesearch"
|
||
msgid "File search"
|
||
msgstr "Пошук файлів"
|
||
|
||
#: ulng.rsoptionseditorfilesviews
|
||
msgid "Files views"
|
||
msgstr "Перегляд файлів"
|
||
|
||
#: ulng.rsoptionseditorfiletypes
|
||
msgctxt "ulng.rsoptionseditorfiletypes"
|
||
msgid "File types"
|
||
msgstr "Типи файлів"
|
||
|
||
#: ulng.rsoptionseditorfoldertabs
|
||
msgctxt "ulng.rsoptionseditorfoldertabs"
|
||
msgid "Folder tabs"
|
||
msgstr "Вкладки тек"
|
||
|
||
#: ulng.rsoptionseditorfoldertabsextra
|
||
msgid "Folder tabs extra"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptionseditorfonts
|
||
msgctxt "ulng.rsoptionseditorfonts"
|
||
msgid "Fonts"
|
||
msgstr "Шрифти"
|
||
|
||
#: ulng.rsoptionseditorhighlighters
|
||
msgid "Highlighters"
|
||
msgstr "Підсвітка"
|
||
|
||
#: ulng.rsoptionseditorhotkeys
|
||
msgctxt "ulng.rsoptionseditorhotkeys"
|
||
msgid "Hot keys"
|
||
msgstr "Гарячі клавіші"
|
||
|
||
#: ulng.rsoptionseditoricons
|
||
msgctxt "ulng.rsoptionseditoricons"
|
||
msgid "Icons"
|
||
msgstr "Іконки"
|
||
|
||
#: ulng.rsoptionseditorignorelist
|
||
msgctxt "ulng.rsoptionseditorignorelist"
|
||
msgid "Ignore list"
|
||
msgstr "Чорний список"
|
||
|
||
#: ulng.rsoptionseditorkeyboard
|
||
msgid "Keys"
|
||
msgstr "Клавіатура"
|
||
|
||
#: ulng.rsoptionseditorlanguage
|
||
msgctxt "ulng.rsoptionseditorlanguage"
|
||
msgid "Language"
|
||
msgstr "Мова"
|
||
|
||
#: ulng.rsoptionseditorlayout
|
||
msgctxt "ulng.rsoptionseditorlayout"
|
||
msgid "Layout"
|
||
msgstr "Вигляд вікна"
|
||
|
||
#: ulng.rsoptionseditorlog
|
||
msgctxt "ulng.rsoptionseditorlog"
|
||
msgid "Log"
|
||
msgstr "Звіт"
|
||
|
||
#: ulng.rsoptionseditormiscellaneous
|
||
msgctxt "ulng.rsoptionseditormiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Різне"
|
||
|
||
#: ulng.rsoptionseditormouse
|
||
msgid "Mouse"
|
||
msgstr "Миша"
|
||
|
||
#: ulng.rsoptionseditoroptionschanged
|
||
msgid ""
|
||
"Options have changed in \"%s\"\n"
|
||
"\n"
|
||
"Do you want to save modifications?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptionseditorplugins
|
||
msgctxt "ulng.rsoptionseditorplugins"
|
||
msgid "Plugins"
|
||
msgstr "Плагіни"
|
||
|
||
#: ulng.rsoptionseditorquicksearch
|
||
msgctxt "ulng.rsoptionseditorquicksearch"
|
||
msgid "Quick search/filter"
|
||
msgstr "Швидкий пошук/фільтр"
|
||
|
||
#: ulng.rsoptionseditorterminal
|
||
msgctxt "ulng.rsoptionseditorterminal"
|
||
msgid "Terminal"
|
||
msgstr "Термінал"
|
||
|
||
#: ulng.rsoptionseditortoolbar
|
||
msgid "Toolbar"
|
||
msgstr "Панель інструментів"
|
||
|
||
#: ulng.rsoptionseditortools
|
||
msgctxt "ulng.rsoptionseditortools"
|
||
msgid "Tools"
|
||
msgstr "Інструменти"
|
||
|
||
#: ulng.rsoptionseditortooltips
|
||
msgctxt "ulng.rsoptionseditortooltips"
|
||
msgid "Tooltips"
|
||
msgstr "Підказки"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenu
|
||
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
||
msgid "Tree View Menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptionseditortreeviewmenucolors
|
||
msgid "Tree View Menu Colors"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptletters
|
||
msgid "None;Command Line;Quick Search;Quick Filter"
|
||
msgstr "Немає;Командний рядок;Швидкий пошук;Швидкий фільтр"
|
||
|
||
#: ulng.rsoptmouseselectionbutton
|
||
msgid "Left button;Right button;"
|
||
msgstr "Ліва кнопка;Права кнопка;"
|
||
|
||
#: ulng.rsoptnewfilesposition
|
||
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
||
msgstr "з початку списку файлів; після каталогів (якщо каталоги сортуються перед файлами); за сортуванням; в кінці списку файлів"
|
||
|
||
#: ulng.rsoptpluginalreadyassigned
|
||
msgid "Plugin %s is already assigned for the following extensions:"
|
||
msgstr "Плагін %s вже призначено для наступних розширень:"
|
||
|
||
#: ulng.rsoptpluginsactive
|
||
msgctxt "ulng.rsoptpluginsactive"
|
||
msgid "Active"
|
||
msgstr "Активний"
|
||
|
||
#: ulng.rsoptpluginsfilename
|
||
msgctxt "ulng.rsoptpluginsfilename"
|
||
msgid "File name"
|
||
msgstr "Ім'я файлу"
|
||
|
||
#: ulng.rsoptpluginsname
|
||
msgctxt "ulng.rsoptpluginsname"
|
||
msgid "Name"
|
||
msgstr "Ім'я"
|
||
|
||
#: ulng.rsoptpluginsregisteredfor
|
||
msgctxt "ulng.rsoptpluginsregisteredfor"
|
||
msgid "Registered for"
|
||
msgstr "Асоціації з"
|
||
|
||
#: ulng.rsoptsearchcase
|
||
msgid "&Sensitive;&Insensitive"
|
||
msgstr "&Чутливий;&Не чутливий"
|
||
|
||
#: ulng.rsoptsearchitems
|
||
msgid "&Files;Di&rectories;Files a&nd Directories"
|
||
msgstr "&Файли;&Каталоги;Файли &і каталоги"
|
||
|
||
#: ulng.rsoptsearchopt
|
||
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
||
msgstr "&Приховати панель фільтру якщо не у фокусі; Зберігайте налаштування модифікацій до наступної сесії"
|
||
|
||
#: ulng.rsoptsortcasesens
|
||
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
||
msgstr "не чутливі до регістру; залежно від налаштувань локалі (aAbBcC); спочатку верхній а потім нижній регістр (ABCabc)"
|
||
|
||
#: ulng.rsoptsortfoldermode
|
||
msgid "sort by name and show first;sort like files and show first;sort like files"
|
||
msgstr "сортувати по імені і показувати першими; сортувати як файли і показувати першими; сортувати як файли"
|
||
|
||
#: ulng.rsoptsortmethod
|
||
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
||
msgstr "За абеткою, з урахуванням наголосів; Природне сортування: по алфавіту і цифрах"
|
||
|
||
#: ulng.rsopttabsposition
|
||
msgid "Top;Bottom;"
|
||
msgstr "Зверху;Знизу"
|
||
|
||
#: ulng.rsopttoolbarbuttontype
|
||
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
||
msgstr "&Роздільник;&Внутрішні команди;&Зовнішні команди;&Меню"
|
||
|
||
#: ulng.rsopttypeofduplicatedrename
|
||
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
||
msgstr "Класичний DC - Copy (x) filename.ext;Windows - filename (x).ext;Інший - filename(x).ext"
|
||
|
||
#: ulng.rsoptupdatedfilesposition
|
||
msgid "don't change position;use the same setting as for new files;to sorted position"
|
||
msgstr "не змінювати положення; використовувати ті ж налаштування, як для нових файлів; сортувати по позиції"
|
||
|
||
#: ulng.rspropscontains
|
||
msgid "Files: %d, folders: %d"
|
||
msgstr "Файлів: %d, папок: %d"
|
||
|
||
#: ulng.rspropserrchmod
|
||
msgid "Can not change access rights for \"%s\""
|
||
msgstr "Не можу змінити права доступу для \"%s\""
|
||
|
||
#: ulng.rspropserrchown
|
||
msgid "Can not change owner for \"%s\""
|
||
msgstr "Не можу змінити власника для \"%s\""
|
||
|
||
#: ulng.rspropsfile
|
||
msgctxt "ulng.rspropsfile"
|
||
msgid "File"
|
||
msgstr "Файл"
|
||
|
||
#: ulng.rspropsfolder
|
||
msgctxt "ulng.rspropsfolder"
|
||
msgid "Directory"
|
||
msgstr "Каталог"
|
||
|
||
#: ulng.rspropsnmdpipe
|
||
msgid "Named pipe"
|
||
msgstr "Іменований канал"
|
||
|
||
#: ulng.rspropssocket
|
||
msgid "Socket"
|
||
msgstr "Сокет"
|
||
|
||
#: ulng.rspropsspblkdev
|
||
msgid "Special block device"
|
||
msgstr "Особливий блочний пристрій"
|
||
|
||
#: ulng.rspropsspchrdev
|
||
msgid "Special character device"
|
||
msgstr "Особливий символьний пристрій"
|
||
|
||
#: ulng.rspropssymlink
|
||
msgid "Symbolic link"
|
||
msgstr "Символьне посилання"
|
||
|
||
#: ulng.rspropsunknowntype
|
||
msgid "Unknown type"
|
||
msgstr "Невідомий тип"
|
||
|
||
#: ulng.rssearchresult
|
||
msgid "Search result"
|
||
msgstr "Результати пошуку"
|
||
|
||
#: ulng.rssearchstatus
|
||
msgid "SEARCH"
|
||
msgstr "Пошук"
|
||
|
||
#: ulng.rssearchtemplateunnamed
|
||
msgid "<unnamed template>"
|
||
msgstr "<безіменний шаблон>"
|
||
|
||
#: ulng.rssearchwithdsxplugininprogress
|
||
msgid ""
|
||
"A file search using DSX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rssearchwithwdxplugininprogress
|
||
msgid ""
|
||
"A file search using WDX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsselectdir
|
||
msgid "Select a directory"
|
||
msgstr "Виберіть каталог"
|
||
|
||
#: ulng.rsselectyoufindfileswindow
|
||
msgid "Select your window"
|
||
msgstr ""
|
||
|
||
#: ulng.rsshowhelpfor
|
||
msgid "&Show help for %s"
|
||
msgstr "Пока&зати довідку для %s"
|
||
|
||
#: ulng.rssimplewordall
|
||
msgctxt "ulng.rssimplewordall"
|
||
msgid "All"
|
||
msgstr "Всім"
|
||
|
||
#: ulng.rssimplewordcategory
|
||
msgctxt "ulng.rssimplewordcategory"
|
||
msgid "Category"
|
||
msgstr "Категорії"
|
||
|
||
#: ulng.rssimplewordcolumnsingular
|
||
msgid "Column"
|
||
msgstr "Колонка"
|
||
|
||
#: ulng.rssimplewordcommand
|
||
msgctxt "ulng.rssimplewordcommand"
|
||
msgid "Command"
|
||
msgstr "Команди"
|
||
|
||
#: ulng.rssimplewordfilename
|
||
msgid "Filename"
|
||
msgstr "Ім’я"
|
||
|
||
#: ulng.rssimplewordfiles
|
||
msgid "files"
|
||
msgstr "файли"
|
||
|
||
#: ulng.rssimplewordletter
|
||
msgid "Letter"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordparameter
|
||
msgid "Param"
|
||
msgstr "Параметр"
|
||
|
||
#: ulng.rssimplewordresult
|
||
msgid "Result"
|
||
msgstr "Результат"
|
||
|
||
#: ulng.rssimplewordworkdir
|
||
msgid "WorkDir"
|
||
msgstr "РобТека"
|
||
|
||
#: ulng.rssizeunitbytes
|
||
msgid "Bytes"
|
||
msgstr "Байти"
|
||
|
||
#: ulng.rssizeunitgbytes
|
||
msgctxt "ulng.rssizeunitgbytes"
|
||
msgid "Gigabytes"
|
||
msgstr "Гігабайти"
|
||
|
||
#: ulng.rssizeunitkbytes
|
||
msgctxt "ulng.rssizeunitkbytes"
|
||
msgid "Kilobytes"
|
||
msgstr "Кілобайти"
|
||
|
||
#: ulng.rssizeunitmbytes
|
||
msgctxt "ulng.rssizeunitmbytes"
|
||
msgid "Megabytes"
|
||
msgstr "Мегабайти"
|
||
|
||
#: ulng.rssizeunittbytes
|
||
msgid "Terabytes"
|
||
msgstr "Терабайти"
|
||
|
||
#: ulng.rsspacemsg
|
||
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
||
msgstr "Файлів: %d, Каталогів: %d, Розмір: %s (%s байт)"
|
||
|
||
#: ulng.rsspliterrdirectory
|
||
msgid "Unable to create target directory!"
|
||
msgstr "Не можу створити каталог призначення!"
|
||
|
||
#: ulng.rsspliterrfilesize
|
||
msgid "Incorrect file size format!"
|
||
msgstr "Невірний формат розміру файла!"
|
||
|
||
#: ulng.rsspliterrsplitfile
|
||
msgid "Unable to split the file!"
|
||
msgstr "Не можу розрізати файл!"
|
||
|
||
#: ulng.rssplitmsgmanyparts
|
||
msgid "The number of parts is more than 100! Continue?"
|
||
msgstr "Кількість частин більше 100! Продовжити?"
|
||
|
||
#: ulng.rssplitpredefinedsizes
|
||
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
msgstr ""
|
||
|
||
#: ulng.rssplitseldir
|
||
msgid "Select directory:"
|
||
msgstr "Виберіть каталог:"
|
||
|
||
#: ulng.rsstraccents
|
||
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstraccentsstripped
|
||
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewjustpreview
|
||
msgid "Just preview"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewothers
|
||
msgid "Others"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewsearchingletters
|
||
msgid "OU"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewsidenote
|
||
msgid "Side note"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched1
|
||
msgid "Flat"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched2
|
||
msgid "Limited"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched3
|
||
msgid "Simple"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched1
|
||
msgid "Fabulous"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched2
|
||
msgid "Marvelous"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched3
|
||
msgid "Tremendous"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosedirhistory
|
||
msgid "Choose your directory from Dir History"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosefavoritetabs
|
||
msgid "Choose you Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
||
msgid "Choose your command from Command Line History"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosefrommainmenu
|
||
msgid "Choose your action from Main Menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosefromtoolbar
|
||
msgid "Choose your action from Maintool bar"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosehotdirectory
|
||
msgid "Choose your directory from Hot Directory:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchooseviewhistory
|
||
msgid "Choose your directory from File View History"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchooseyourfileordir
|
||
msgid "Choose your file or your directory"
|
||
msgstr ""
|
||
|
||
#: ulng.rssymerrcreate
|
||
msgid "Error creating symlink."
|
||
msgstr "Помилка створення симв. посилання."
|
||
|
||
#: ulng.rssyndefaulttext
|
||
msgctxt "ulng.rssyndefaulttext"
|
||
msgid "Default text"
|
||
msgstr "Типовий текст"
|
||
|
||
#: ulng.rssynlangplaintext
|
||
msgctxt "ulng.rssynlangplaintext"
|
||
msgid "Plain text"
|
||
msgstr "Простий текст"
|
||
|
||
#: ulng.rstabsactionondoubleclickchoices
|
||
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rstimeunitday
|
||
msgctxt "ulng.rstimeunitday"
|
||
msgid "Day(s)"
|
||
msgstr "Днів"
|
||
|
||
#: ulng.rstimeunithour
|
||
msgid "Hour(s)"
|
||
msgstr "Годин(а)"
|
||
|
||
#: ulng.rstimeunitminute
|
||
msgid "Minute(s)"
|
||
msgstr "Хвилин(а)"
|
||
|
||
#: ulng.rstimeunitmonth
|
||
msgid "Month(s)"
|
||
msgstr "Місяців"
|
||
|
||
#: ulng.rstimeunitsecond
|
||
msgid "Second(s)"
|
||
msgstr "Секунд(а)"
|
||
|
||
#: ulng.rstimeunitweek
|
||
msgid "Week(s)"
|
||
msgstr "Тижнів"
|
||
|
||
#: ulng.rstimeunityear
|
||
msgid "Year(s)"
|
||
msgstr "Років"
|
||
|
||
#: ulng.rstitlerenamefavtabs
|
||
msgid "Rename Favorite Tabs"
|
||
msgstr ""
|
||
|
||
#: ulng.rstitlerenamefavtabsmenu
|
||
msgid "Rename Favorite Tabs sub-menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rstooldiffer
|
||
msgctxt "ulng.rstooldiffer"
|
||
msgid "Differ"
|
||
msgstr "Порівнювач"
|
||
|
||
#: ulng.rstooleditor
|
||
msgctxt "ulng.rstooleditor"
|
||
msgid "Editor"
|
||
msgstr "Редактор"
|
||
|
||
#: ulng.rstoolerroropeningdiffer
|
||
msgid "Error opening differ"
|
||
msgstr "Помилка відкриття порівнювача"
|
||
|
||
#: ulng.rstoolerroropeningeditor
|
||
msgid "Error opening editor"
|
||
msgstr "Помилка відкриття редактора"
|
||
|
||
#: ulng.rstoolerroropeningterminal
|
||
msgid "Error opening terminal"
|
||
msgstr "Помилка відкриття терміналу"
|
||
|
||
#: ulng.rstoolerroropeningviewer
|
||
msgid "Error opening viewer"
|
||
msgstr "Помилка відкриття переглядача"
|
||
|
||
#: ulng.rstoolterminal
|
||
msgctxt "ulng.rstoolterminal"
|
||
msgid "Terminal"
|
||
msgstr "Термінал"
|
||
|
||
#: ulng.rstoolviewer
|
||
msgctxt "ulng.rstoolviewer"
|
||
msgid "Viewer"
|
||
msgstr "Переглядач"
|
||
|
||
#: ulng.rsunhandledexceptionmessage
|
||
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
||
msgstr "При помилці зверніться до розробників. У листі опишіть помилку, вкажіть при яких діях вона виникла і вкладіть цей файл:%s. Натисніть %s щоб продовжити чи %s щоб перервати роботу."
|
||
|
||
#: ulng.rsvarbothpanelactivetoinactive
|
||
msgid "Both panels, from active to inactive"
|
||
msgstr "Обидві панелі, з активної в неактивну"
|
||
|
||
#: ulng.rsvarbothpanellefttoright
|
||
msgid "Both panels, from left to right"
|
||
msgstr "Обидві панелі, з лівої в праву"
|
||
|
||
#: ulng.rsvarcurrentpath
|
||
msgid "Path of panel"
|
||
msgstr "Шлях до панелі"
|
||
|
||
#: ulng.rsvarencloseelement
|
||
msgid "Enclose each name in brackets or what you want"
|
||
msgstr "Заключіть кожне ім’я у дужки чи у щось інше"
|
||
|
||
#: ulng.rsvarfilenamenoext
|
||
msgid "Just filename, no extension"
|
||
msgstr "Тільки ім’я, без розширення"
|
||
|
||
#: ulng.rsvarfullpath
|
||
msgid "Complete filename (path+filename)"
|
||
msgstr "Повне ім'я файлу (шлях + ім'я файлу)"
|
||
|
||
#: ulng.rsvarhelpwith
|
||
msgid "Help with \"%\" variables"
|
||
msgstr "Допомога зі змінними \"%\""
|
||
|
||
#: ulng.rsvarinputparam
|
||
#, fuzzy
|
||
msgid "Will request request user to enter a parameter with a default suggested value"
|
||
msgstr "Буде пропонувати користувачу ввести необхідне значення параметра (типово)"
|
||
|
||
#: ulng.rsvarleftpanel
|
||
msgid "Left panel"
|
||
msgstr "Ліва панель"
|
||
|
||
#: ulng.rsvarlistfilename
|
||
msgid "Temporary filename of list of filenames"
|
||
msgstr "Тимчасове ім'я списку імен файлів"
|
||
|
||
#: ulng.rsvarlistfullfilename
|
||
msgid "Temporary filename of list of complete filenames (path+filename)"
|
||
msgstr "Тимчасове ім'я списку повних імен файлів (шлях + ім'я файлу)"
|
||
|
||
#: ulng.rsvarlistinutf16
|
||
msgid "Filenames in list in UTF-16 with BOM"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistinutf16quoted
|
||
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistinutf8
|
||
msgid "Filenames in list in UTF-8"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistinutf8quoted
|
||
msgid "Filenames in list in UTF-8, inside double quotes"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistrelativefilename
|
||
msgid "Temporary filename of list of filenames with relative path"
|
||
msgstr "Тимчасове ім'я списку імен файлів з відносними шляхами"
|
||
|
||
#: ulng.rsvaronlyextension
|
||
msgid "Only file extension"
|
||
msgstr "Тільки розширення файлу"
|
||
|
||
#: ulng.rsvaronlyfilename
|
||
msgid "Only filename"
|
||
msgstr "Тільки ім’я файлу"
|
||
|
||
#: ulng.rsvarotherexamples
|
||
msgid "Other example of what's possible"
|
||
msgstr "Інший приклад можливостей"
|
||
|
||
#: ulng.rsvarpath
|
||
msgid "Path, with ending delimiter"
|
||
msgstr "Шлях з роздільником в кінці"
|
||
|
||
#: ulng.rsvarpercentchangetopound
|
||
#, fuzzy
|
||
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
||
msgstr "Звідси і до кінця рядка, індикатор відсотків змінної знак - \"#\""
|
||
|
||
#: ulng.rsvarpercentsign
|
||
msgid "Return the percent sign"
|
||
msgstr "Повернути знак відсотків"
|
||
|
||
#: ulng.rsvarpoundchangetopercent
|
||
#, fuzzy
|
||
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
||
msgstr "Звідси до кінця рядка, індикатор відсотків змінної повертається знак - \"%\""
|
||
|
||
#: ulng.rsvarprependelement
|
||
#, fuzzy
|
||
msgid "Prepend each name with \"-a \" or what you want"
|
||
msgstr "Попередньо очікуйте кожне ім’я з \"-a \" чи чого хочете"
|
||
|
||
#: ulng.rsvarpromptuserforparam
|
||
msgid "%[Prompt user for param;Default value proposed]"
|
||
msgstr "%[Запитувати користувача;Пропонувати типове значення]"
|
||
|
||
#: ulng.rsvarrelativepathandfilename
|
||
msgid "Filename with relative path"
|
||
msgstr "Ім’я файлу з відносним шляхом"
|
||
|
||
#: ulng.rsvarrightpanel
|
||
msgid "Right panel"
|
||
msgstr "Права панель"
|
||
|
||
#: ulng.rsvarsecondelementrightpanel
|
||
msgid "Full path of second selected file in right panel"
|
||
msgstr "Повний шлях другого вибраного файлу в правій панелі"
|
||
|
||
#: ulng.rsvarshowcommandprior
|
||
msgid "Show command prior execute"
|
||
msgstr "Показати команду до виконання"
|
||
|
||
#: ulng.rsvarsimplemessage
|
||
msgid "%[Simple message]"
|
||
msgstr "%[Просте повідомлення]"
|
||
|
||
#: ulng.rsvarsimpleshowmessage
|
||
msgid "Will show a simple message"
|
||
msgstr "Покаже просте повідомлення"
|
||
|
||
#: ulng.rsvarsourcepanel
|
||
msgid "Active panel (source)"
|
||
msgstr "Активна панель (джерело)"
|
||
|
||
#: ulng.rsvartargetpanel
|
||
msgid "Inactive panel (target)"
|
||
msgstr "Неактивна панель (ціль)"
|
||
|
||
#: ulng.rsvarwillbequoted
|
||
msgid "Filenames will be quoted from here (default)"
|
||
msgstr "Імена файлів будуть братися у лапки тут (типово)"
|
||
|
||
#: ulng.rsvarwilldointerminal
|
||
msgid "Command will be done in terminal, remaining opened at the end"
|
||
msgstr "Команда буде виконана в терміналі, залишаючись відкритою в кінці"
|
||
|
||
#: ulng.rsvarwillhaveendingdelimiter
|
||
msgid "Paths will have ending delimiter"
|
||
msgstr "Шлях буде завершуватися роздільником"
|
||
|
||
#: ulng.rsvarwillnotbequoted
|
||
msgid "Filenames will not be quoted from here"
|
||
msgstr "Імена файлів не будуть братися тут у лапки"
|
||
|
||
#: ulng.rsvarwillnotdointerminal
|
||
msgid "Command will be done in terminal, closed at the end"
|
||
msgstr "Команда буде виконана в терміналі, закритому в кінці"
|
||
|
||
#: ulng.rsvarwillnothaveendingdelimiter
|
||
msgid "Paths will not have ending delimiter (default)"
|
||
msgstr "Шлях не буде завершуватися роздільником (типово)"
|
||
|
||
#: ulng.rsvfsnetwork
|
||
msgctxt "ulng.rsvfsnetwork"
|
||
msgid "Network"
|
||
msgstr "Мережа"
|
||
|
||
#: ulng.rsviewabouttext
|
||
msgid "Internal Viewer of Double Commander."
|
||
msgstr "Внутрішній переглядач Double Commander."
|
||
|
||
#: ulng.rsviewbadquality
|
||
msgid "Bad Quality"
|
||
msgstr ""
|
||
|
||
#: ulng.rsviewencoding
|
||
msgctxt "ulng.rsviewencoding"
|
||
msgid "Encoding"
|
||
msgstr "Кодування"
|
||
|
||
#: ulng.rsviewimagetype
|
||
msgid "Image Type"
|
||
msgstr ""
|
||
|
||
#: ulng.rsviewnewsize
|
||
#, fuzzy
|
||
msgctxt "ulng.rsviewnewsize"
|
||
msgid "New Size"
|
||
msgstr "Новий розмір"
|
||
|
||
#: ulng.rsviewnotfound
|
||
msgid "%s not found!"
|
||
msgstr "%s не знайдено!"
|
||
|
||
#: ulng.rsviewwithexternalviewer
|
||
msgid "with external viewer"
|
||
msgstr "у зовнішньому переглядачі"
|
||
|
||
#: ulng.rsviewwithinternalviewer
|
||
msgid "with internal viewer"
|
||
msgstr "у внутрішньому переглядачі"
|
||
|
||
#: ulng.rsxreplacements
|
||
msgid "Number of replacement: %d"
|
||
msgstr "Кількість замін: %d"
|
||
|
||
#: ulng.rszeroreplacement
|
||
msgid "No replacement took place."
|
||
msgstr "Заміна не відбулася."
|
||
|