mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-21 09:58:13 +00:00
ADD: Enable hints to be displayed in internal viewer for the whole window. When we're moving mouse over some controls on top of preview panel, these existing and translated hints will now be displayed.
13093 lines
329 KiB
Text
13093 lines
329 KiB
Text
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
|
|
"Report-Msgid-Bugs-To: \n"
|
|
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
|
|
"PO-Revision-Date: 2015-01-06 17:20+0100\n"
|
|
"Last-Translator: Саша Петровић <salepetronije@gmail.com>\n"
|
|
"Language-Team: srpski <xfce4@xfce4.org>\n"
|
|
"Language: sr\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
|
|
"X-Generator: Poedit 1.5.4\n"
|
|
"X-Language: sr_RS\n"
|
|
"X-Native-Language: srpski\n"
|
|
|
|
#: fsyncdirsdlg.rscomparingpercent
|
|
msgid "Comparing... %d%% (ESC to cancel)"
|
|
msgstr "Upoređujem... %d%% (ESC za otkazivanje)"
|
|
|
|
#: fsyncdirsdlg.rsdeleteright
|
|
msgid "Right: Delete %d file(s)"
|
|
msgstr ""
|
|
|
|
#: fsyncdirsdlg.rsfilesfound
|
|
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
|
msgstr "Pronađeno je datoteka: %d (istovetnih: %d, različitih: %d, jedinstvenih levo: %d, jedinstvenih desno: %d)"
|
|
|
|
#: fsyncdirsdlg.rslefttorightcopy
|
|
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
|
msgstr "Sa leva na desno: Umnoži %d datoteka, ukupne veličine %d bajta"
|
|
|
|
#: fsyncdirsdlg.rsrighttoleftcopy
|
|
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
|
msgstr "Sa desna na levo: Umnoži %d datoteka, ukupne veličine %d bajta"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
|
msgid "Choose template..."
|
|
msgstr "Izaberite obrazac..."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
|
msgid "C&heck free space"
|
|
msgstr "P&roveri slobodan prostor"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
|
msgid "Cop&y attributes"
|
|
msgstr "Umnoži& svojstva"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
|
msgid "Copy o&wnership"
|
|
msgstr "Umnoži v&lasništvo"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
|
msgid "Copy &permissions"
|
|
msgstr ""
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
|
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
|
msgid "Copy d&ate/time"
|
|
msgstr "Umnoži v&reme i datum"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
|
msgid "Correct lin&ks"
|
|
msgstr "Ispravi v&eze"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
|
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
|
|
msgid "Drop readonly fla&g"
|
|
msgstr "Poništi osobinu samo za &čitanje"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
|
msgid "E&xclude empty directories"
|
|
msgstr "I&zuzmi prazne fascikle"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
|
msgid "Fo&llow links"
|
|
msgstr "S&ledi veze"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
|
msgid "&Reserve space"
|
|
msgstr "&Čuvaj slobodan prostor"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
|
msgid "&Verify"
|
|
msgstr ""
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
|
msgid "What to do when cannot set file time, attributes, etc."
|
|
msgstr "Šta činiti kada se ne mogu podesiti vreme, svojstva, itd."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
|
msgid "Use file template"
|
|
msgstr "Koristi obrazac datoteke"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
|
msgid "When dir&ectory exists"
|
|
msgstr "Kada &fascikla postoji"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When &file exists"
|
|
msgstr "Kada &datoteka postoji"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
|
msgid "When ca&nnot set property"
|
|
msgstr "Kada se ne& mogu postaviti osobine"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
|
msgid "<no template>"
|
|
msgstr "<nema obrasca>"
|
|
|
|
#: tfrmabout.btnclose.caption
|
|
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Zatvori"
|
|
|
|
#: tfrmabout.btncopytoclipboard.caption
|
|
msgid "Copy to clipboard"
|
|
msgstr "Umnoži u ostavu isečaka"
|
|
|
|
#: tfrmabout.caption
|
|
msgctxt "TFRMABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "O programu"
|
|
|
|
#: tfrmabout.lblbuild.caption
|
|
msgctxt "tfrmabout.lblbuild.caption"
|
|
msgid "Build"
|
|
msgstr "Izgrađen"
|
|
|
|
#: tfrmabout.lblfreepascalver.caption
|
|
msgctxt "tfrmabout.lblfreepascalver.caption"
|
|
msgid "Free Pascal"
|
|
msgstr "Slobodni Paskal"
|
|
|
|
#: tfrmabout.lblhomepage.caption
|
|
msgid "Home Page:"
|
|
msgstr "Početna stranica:"
|
|
|
|
#: tfrmabout.lblhomepageaddress.caption
|
|
msgid "http://doublecmd.sourceforge.net"
|
|
msgstr "http://doublecmd.sourceforge.net"
|
|
|
|
#: tfrmabout.lbllazarusver.caption
|
|
msgctxt "tfrmabout.lbllazarusver.caption"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: tfrmabout.lblrevision.caption
|
|
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
|
|
msgid "Revision"
|
|
msgstr "Prepravka"
|
|
|
|
#: tfrmabout.lbltitle.caption
|
|
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmabout.lblversion.caption
|
|
msgctxt "tfrmabout.lblversion.caption"
|
|
msgid "Version"
|
|
msgstr "Izdanje"
|
|
|
|
#: tfrmattributesedit.btncancel.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmattributesedit.btnok.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmattributesedit.btnreset.caption
|
|
msgid "&Reset"
|
|
msgstr "&Poništi"
|
|
|
|
#: tfrmattributesedit.caption
|
|
msgid "Choose attributes"
|
|
msgstr "Izaberite svojstva"
|
|
|
|
#: tfrmattributesedit.cbarchive.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
|
|
msgid "&Archive"
|
|
msgstr "&Ostava"
|
|
|
|
#: tfrmattributesedit.cbcompressed.caption
|
|
msgid "Co&mpressed"
|
|
msgstr "Sa&žmano"
|
|
|
|
#: tfrmattributesedit.cbdirectory.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
|
|
msgid "&Directory"
|
|
msgstr "&Fascikla"
|
|
|
|
#: tfrmattributesedit.cbencrypted.caption
|
|
msgid "&Encrypted"
|
|
msgstr "&Šifrovano"
|
|
|
|
#: tfrmattributesedit.cbhidden.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
|
|
msgid "&Hidden"
|
|
msgstr "&Skriveno"
|
|
|
|
#: tfrmattributesedit.cbreadonly.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
|
|
msgid "Read o&nly"
|
|
msgstr "Samo za &čitanje"
|
|
|
|
#: tfrmattributesedit.cbsgid.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmattributesedit.cbsparse.caption
|
|
msgid "S&parse"
|
|
msgstr "P&roređeno"
|
|
|
|
#: tfrmattributesedit.cbsticky.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Lepljivo"
|
|
|
|
#: tfrmattributesedit.cbsuid.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmattributesedit.cbsymlink.caption
|
|
msgid "&Symlink"
|
|
msgstr "&Simbolička veza"
|
|
|
|
#: tfrmattributesedit.cbsystem.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
|
|
msgid "S&ystem"
|
|
msgstr "S&istem"
|
|
|
|
#: tfrmattributesedit.cbtemporary.caption
|
|
msgid "&Temporary"
|
|
msgstr "&Privremeno"
|
|
|
|
#: tfrmattributesedit.gbntfsattributes.caption
|
|
msgid "NTFS attributes"
|
|
msgstr "Svojstva NTFS "
|
|
|
|
#: tfrmattributesedit.gbwingeneral.caption
|
|
msgid "General attributes"
|
|
msgstr "Opšta svojstva"
|
|
|
|
#: tfrmattributesedit.lblattrbitsstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bita:"
|
|
|
|
#: tfrmattributesedit.lblattrgroupstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Udruženje"
|
|
|
|
#: tfrmattributesedit.lblattrotherstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Ostalo"
|
|
|
|
#: tfrmattributesedit.lblattrownerstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Vlasnik"
|
|
|
|
#: tfrmattributesedit.lblexec.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Izvrši"
|
|
|
|
#: tfrmattributesedit.lblread.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Čitaj"
|
|
|
|
#: tfrmattributesedit.lbltextattrs.caption
|
|
msgid "As te&xt:"
|
|
msgstr "Kao t&ekst:"
|
|
|
|
#: tfrmattributesedit.lblwrite.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Piši"
|
|
|
|
#: tfrmbenchmark.caption
|
|
msgid "Benchmark"
|
|
msgstr ""
|
|
|
|
#: tfrmbenchmark.lblbenchmarksize.caption
|
|
msgid "Benchmark data size: %d MB"
|
|
msgstr ""
|
|
|
|
#: tfrmbenchmark.stgresult.columns[0].title.caption
|
|
msgid "Hash"
|
|
msgstr ""
|
|
|
|
#: tfrmbenchmark.stgresult.columns[1].title.caption
|
|
msgid "Time (ms)"
|
|
msgstr ""
|
|
|
|
#: tfrmbenchmark.stgresult.columns[2].title.caption
|
|
msgid "Speed (MB/s)"
|
|
msgstr ""
|
|
|
|
#: tfrmchecksumcalc.caption
|
|
#, fuzzy
|
|
#| msgid "Calculate check sum..."
|
|
msgctxt "TFRMCHECKSUMCALC.CAPTION"
|
|
msgid "Calculate checksum..."
|
|
msgstr "Izračunaj zbirnu proveru"
|
|
|
|
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
|
msgid "Open checksum file after job is completed"
|
|
msgstr ""
|
|
|
|
#: tfrmchecksumcalc.cbseparatefile.caption
|
|
msgid "C&reate separate checksum file for each file"
|
|
msgstr "&Obrazuj posebnu datoteku zbirne provere za svaku datoteku"
|
|
|
|
#: tfrmchecksumcalc.lblsaveto.caption
|
|
#, fuzzy
|
|
#| msgid "&Save check sum file(s) to:"
|
|
msgid "&Save checksum file(s) to:"
|
|
msgstr "&Sačuvaj zbirnu(e) proveru(e) u:"
|
|
|
|
#: tfrmchecksumverify.btnclose.caption
|
|
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Zatvori"
|
|
|
|
#: tfrmchecksumverify.caption
|
|
#, fuzzy
|
|
#| msgid "Verify check sum..."
|
|
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
|
|
msgid "Verify checksum..."
|
|
msgstr "Zbirna provera..."
|
|
|
|
#: tfrmconnectionmanager.btnadd.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "D&odaj"
|
|
|
|
#: tfrmconnectionmanager.btncancel.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "Otk&aži"
|
|
|
|
#: tfrmconnectionmanager.btnconnect.caption
|
|
msgid "C&onnect"
|
|
msgstr "Po&veži se"
|
|
|
|
#: tfrmconnectionmanager.btndelete.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Izbriši"
|
|
|
|
#: tfrmconnectionmanager.btnedit.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Uredi"
|
|
|
|
#: tfrmconnectionmanager.caption
|
|
msgid "Connection manager"
|
|
msgstr "Upravnik veza"
|
|
|
|
#: tfrmconnectionmanager.gbconnectto.caption
|
|
msgid "Connect to:"
|
|
msgstr "Poveži se na:"
|
|
|
|
#: tfrmcopydlg.btnaddtoqueue.caption
|
|
msgid "A&dd To Queue"
|
|
msgstr "&Dodaj u zakazano"
|
|
|
|
#: tfrmcopydlg.btncancel.caption
|
|
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmcopydlg.btnoptions.caption
|
|
msgid "O&ptions"
|
|
msgstr "&Mogućnosti"
|
|
|
|
#: tfrmcopydlg.btnsaveoptions.caption
|
|
msgid "Sa&ve these options as default"
|
|
msgstr "Sačuvaj ove mogućnosti kao podrazumevane"
|
|
|
|
#: tfrmcopydlg.caption
|
|
msgctxt "TFRMCOPYDLG.CAPTION"
|
|
msgid "Copy file(s)"
|
|
msgstr "Umnoži datoteku(e)"
|
|
|
|
#: tfrmcopydlg.mnunewqueue.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmcopydlg.mnunewqueue.caption"
|
|
msgid "New queue"
|
|
msgstr "Novo zakazivanje"
|
|
|
|
#: tfrmcopydlg.mnuqueue1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmcopydlg.mnuqueue1.caption"
|
|
msgid "Queue 1"
|
|
msgstr "Zakazano 1"
|
|
|
|
#: tfrmcopydlg.mnuqueue2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmcopydlg.mnuqueue2.caption"
|
|
msgid "Queue 2"
|
|
msgstr "Zakazano 2"
|
|
|
|
#: tfrmcopydlg.mnuqueue3.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmcopydlg.mnuqueue3.caption"
|
|
msgid "Queue 3"
|
|
msgstr "Zakazano 3"
|
|
|
|
#: tfrmcopydlg.mnuqueue4.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmcopydlg.mnuqueue4.caption"
|
|
msgid "Queue 4"
|
|
msgstr "Zakazano 4"
|
|
|
|
#: tfrmcopydlg.mnuqueue5.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmcopydlg.mnuqueue5.caption"
|
|
msgid "Queue 5"
|
|
msgstr "Zakazano 5"
|
|
|
|
#: tfrmdescredit.actsavedescription.caption
|
|
msgid "Save Description"
|
|
msgstr "Sačuvaj opis"
|
|
|
|
#: tfrmdescredit.btncancel.caption
|
|
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmdescredit.btnok.caption
|
|
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmdescredit.caption
|
|
msgid "File/folder comment"
|
|
msgstr "Napomena datoteke/fascikle"
|
|
|
|
#: tfrmdescredit.lbleditcommentfor.caption
|
|
msgid "E&dit comment for:"
|
|
msgstr "Uredi& napomenu za:"
|
|
|
|
#: tfrmdescredit.lblencoding.caption
|
|
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
|
|
msgid "&Encoding:"
|
|
msgstr "&Šifrovanje:"
|
|
|
|
#: tfrmdescredit.lblfilename.caption
|
|
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmdiffer.actabout.caption
|
|
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "O programu"
|
|
|
|
#: tfrmdiffer.actautocompare.caption
|
|
msgid "Auto Compare"
|
|
msgstr "Samostalno upoređivanje"
|
|
|
|
#: tfrmdiffer.actbinarycompare.caption
|
|
msgid "Binary Mode"
|
|
msgstr "Binarno"
|
|
|
|
#: tfrmdiffer.actcancelcompare.caption
|
|
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Otkaži"
|
|
|
|
#: tfrmdiffer.actcancelcompare.hint
|
|
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
|
msgid "Cancel"
|
|
msgstr "Otkaži"
|
|
|
|
#: tfrmdiffer.actcopylefttoright.caption
|
|
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
|
|
msgid "Copy Block Right"
|
|
msgstr "Umnoži skup desno"
|
|
|
|
#: tfrmdiffer.actcopylefttoright.hint
|
|
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
|
msgid "Copy Block Right"
|
|
msgstr "Umnoži skup desno"
|
|
|
|
#: tfrmdiffer.actcopyrighttoleft.caption
|
|
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
|
|
msgid "Copy Block Left"
|
|
msgstr "Umnoži skup levo"
|
|
|
|
#: tfrmdiffer.actcopyrighttoleft.hint
|
|
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
|
msgid "Copy Block Left"
|
|
msgstr "Umnoži skup levo"
|
|
|
|
#: tfrmdiffer.acteditcopy.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmdiffer.acteditcut.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Iseci"
|
|
|
|
#: tfrmdiffer.acteditdelete.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Izbriši"
|
|
|
|
#: tfrmdiffer.acteditpaste.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Nalepi"
|
|
|
|
#: tfrmdiffer.acteditredo.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
|
|
msgid "Redo"
|
|
msgstr "Ponovi"
|
|
|
|
#: tfrmdiffer.acteditselectall.caption
|
|
msgid "Select &All"
|
|
msgstr "Označi &sve"
|
|
|
|
#: tfrmdiffer.acteditundo.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
|
|
msgid "Undo"
|
|
msgstr "Poništi"
|
|
|
|
#: tfrmdiffer.actexit.caption
|
|
msgctxt "TFRMDIFFER.ACTEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Izlaz"
|
|
|
|
#: tfrmdiffer.actfirstdifference.caption
|
|
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION"
|
|
msgid "First Difference"
|
|
msgstr "Prva razlika"
|
|
|
|
#: tfrmdiffer.actfirstdifference.hint
|
|
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
|
|
msgid "First Difference"
|
|
msgstr "Prva razlika"
|
|
|
|
#: tfrmdiffer.actignorecase.caption
|
|
msgid "Ignore Case"
|
|
msgstr "Zanemari veličinu slova"
|
|
|
|
#: tfrmdiffer.actignorewhitespace.caption
|
|
msgid "Ignore Blanks"
|
|
msgstr "Zanemari praznine"
|
|
|
|
#: tfrmdiffer.actkeepscrolling.caption
|
|
msgid "Keep Scrolling"
|
|
msgstr "Nastavi klizanje"
|
|
|
|
#: tfrmdiffer.actlastdifference.caption
|
|
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION"
|
|
msgid "Last Difference"
|
|
msgstr "Poslednja razlika"
|
|
|
|
#: tfrmdiffer.actlastdifference.hint
|
|
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
|
|
msgid "Last Difference"
|
|
msgstr "Poslednja razlika"
|
|
|
|
#: tfrmdiffer.actlinedifferences.caption
|
|
msgid "Line Differences"
|
|
msgstr "Razlika linija"
|
|
|
|
#: tfrmdiffer.actnextdifference.caption
|
|
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION"
|
|
msgid "Next Difference"
|
|
msgstr "Sledeća razlika"
|
|
|
|
#: tfrmdiffer.actnextdifference.hint
|
|
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
|
|
msgid "Next Difference"
|
|
msgstr "Sledeća razlika"
|
|
|
|
#: tfrmdiffer.actopenleft.caption
|
|
msgid "Open Left..."
|
|
msgstr "Otvori levo..."
|
|
|
|
#: tfrmdiffer.actopenright.caption
|
|
msgid "Open Right..."
|
|
msgstr "Otvori desno..."
|
|
|
|
#: tfrmdiffer.actpaintbackground.caption
|
|
msgid "Paint Background"
|
|
msgstr "Oboji pozadinu"
|
|
|
|
#: tfrmdiffer.actprevdifference.caption
|
|
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION"
|
|
msgid "Previous Difference"
|
|
msgstr "Prethodna razlika"
|
|
|
|
#: tfrmdiffer.actprevdifference.hint
|
|
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
|
|
msgid "Previous Difference"
|
|
msgstr "Prethodna razlika"
|
|
|
|
#: tfrmdiffer.actreload.caption
|
|
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
|
|
msgid "&Reload"
|
|
msgstr "&Učitaj ponovo"
|
|
|
|
#: tfrmdiffer.actreload.hint
|
|
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
|
|
msgid "Reload"
|
|
msgstr "Ponovo učitaj"
|
|
|
|
#: tfrmdiffer.actsave.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
|
|
msgid "Save"
|
|
msgstr "Sačuvaj"
|
|
|
|
#: tfrmdiffer.actsave.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
|
msgid "Save"
|
|
msgstr "Sačuvaj"
|
|
|
|
#: tfrmdiffer.actsaveas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
|
|
msgid "Save as..."
|
|
msgstr "Sačuvaj kao..."
|
|
|
|
#: tfrmdiffer.actsaveas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
|
msgid "Save as..."
|
|
msgstr "Sačuvaj kao..."
|
|
|
|
#: tfrmdiffer.actsaveleft.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
|
|
msgid "Save Left"
|
|
msgstr "Sačuvaj levo"
|
|
|
|
#: tfrmdiffer.actsaveleft.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
|
msgid "Save Left"
|
|
msgstr "Sačuvaj levo"
|
|
|
|
#: tfrmdiffer.actsaveleftas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
|
|
msgid "Save Left As..."
|
|
msgstr "Sačuvaj levo kao..."
|
|
|
|
#: tfrmdiffer.actsaveleftas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
|
msgid "Save Left As..."
|
|
msgstr "Sačuvaj levo kao..."
|
|
|
|
#: tfrmdiffer.actsaveright.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
|
|
msgid "Save Right"
|
|
msgstr "Sačuvaj desno"
|
|
|
|
#: tfrmdiffer.actsaveright.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
|
msgid "Save Right"
|
|
msgstr "Sačuvaj desno"
|
|
|
|
#: tfrmdiffer.actsaverightas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
|
|
msgid "Save Right As..."
|
|
msgstr "Sačuvaj desno kao..."
|
|
|
|
#: tfrmdiffer.actsaverightas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
|
msgid "Save Right As..."
|
|
msgstr "Sačuvaj desno kao..."
|
|
|
|
#: tfrmdiffer.actstartcompare.caption
|
|
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
|
|
msgid "Compare"
|
|
msgstr "Uporedi"
|
|
|
|
#: tfrmdiffer.actstartcompare.hint
|
|
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
|
msgid "Compare"
|
|
msgstr "Uporedi"
|
|
|
|
#: tfrmdiffer.btnleftencoding.hint
|
|
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
|
|
msgid "Encoding"
|
|
msgstr "Šifrovanje"
|
|
|
|
#: tfrmdiffer.btnrightencoding.hint
|
|
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
|
msgid "Encoding"
|
|
msgstr "Šifrovanje"
|
|
|
|
#: tfrmdiffer.caption
|
|
msgctxt "TFRMDIFFER.CAPTION"
|
|
msgid "Compare files"
|
|
msgstr "Uporedi datoteke"
|
|
|
|
#: tfrmdiffer.midivider1.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider10.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider2.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider3.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider4.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider5.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider6.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider7.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider8.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider9.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.miencodingleft.caption
|
|
msgid "&Left"
|
|
msgstr "&Levo"
|
|
|
|
#: tfrmdiffer.miencodingright.caption
|
|
msgid "&Right"
|
|
msgstr "&Desno"
|
|
|
|
#: tfrmdiffer.miseparator1.caption
|
|
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.miseparator2.caption
|
|
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.mnuactions.caption
|
|
msgid "&Actions"
|
|
msgstr "&Radnje"
|
|
|
|
#: tfrmdiffer.mnuedit.caption
|
|
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Uredi"
|
|
|
|
#: tfrmdiffer.mnuencoding.caption
|
|
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
|
|
msgid "En&coding"
|
|
msgstr "Ši&frovanje"
|
|
|
|
#: tfrmdiffer.mnufile.caption
|
|
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
|
|
msgid "&File"
|
|
msgstr "&Datoteka"
|
|
|
|
#: tfrmdiffer.mnuoptions.caption
|
|
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
|
|
msgid "&Options"
|
|
msgstr "&Mogućnosti"
|
|
|
|
#: tfrmedithotkey.btnaddshortcut.hint
|
|
msgid "Add new shortcut to sequence"
|
|
msgstr "Dodaj novu prečicu nizu"
|
|
|
|
#: tfrmedithotkey.btncancel.caption
|
|
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Odustani"
|
|
|
|
#: tfrmedithotkey.btnok.caption
|
|
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmedithotkey.btnremoveshortcut.hint
|
|
msgid "Remove last shortcut from sequence"
|
|
msgstr "Ukloni poslednju prečicu iz niza"
|
|
|
|
#: tfrmedithotkey.btnselectfromlist.hint
|
|
msgid "Select shortcut from list of remaining free available keys"
|
|
msgstr ""
|
|
|
|
#: tfrmedithotkey.cghkcontrols.caption
|
|
msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION"
|
|
msgid "Only for these controls"
|
|
msgstr "Samo za sledeća poklapanja"
|
|
|
|
#: tfrmedithotkey.lblparameters.caption
|
|
msgid "&Parameters (each in a separate line):"
|
|
msgstr "&Odrednice (svaka u posebnoj liniji):"
|
|
|
|
#: tfrmedithotkey.lblshortcuts.caption
|
|
msgid "Shortcuts:"
|
|
msgstr "Prečice:"
|
|
|
|
#: tfrmeditor.actabout.caption
|
|
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "O programu"
|
|
|
|
#: tfrmeditor.actabout.hint
|
|
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
|
|
msgid "About"
|
|
msgstr "O radnji"
|
|
|
|
#: tfrmeditor.actconfhigh.caption
|
|
msgid "&Configuration"
|
|
msgstr "&Postavke"
|
|
|
|
#: tfrmeditor.actconfhigh.hint
|
|
msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT"
|
|
msgid "Configuration"
|
|
msgstr "Postavke"
|
|
|
|
#: tfrmeditor.acteditcopy.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmeditor.acteditcopy.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
|
|
msgid "Copy"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmeditor.acteditcut.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Iseci"
|
|
|
|
#: tfrmeditor.acteditcut.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
|
|
msgid "Cut"
|
|
msgstr "Iseci"
|
|
|
|
#: tfrmeditor.acteditdelete.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Obriši"
|
|
|
|
#: tfrmeditor.acteditdelete.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
|
|
msgid "Delete"
|
|
msgstr "Obriši"
|
|
|
|
#: tfrmeditor.acteditfind.caption
|
|
#, fuzzy
|
|
#| msgid "&Find "
|
|
msgctxt "tfrmeditor.acteditfind.caption"
|
|
msgid "&Find"
|
|
msgstr "&Pronađi"
|
|
|
|
#: tfrmeditor.acteditfind.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITFIND.HINT"
|
|
msgid "Find"
|
|
msgstr "Pronađi"
|
|
|
|
#: tfrmeditor.acteditfindnext.caption
|
|
msgctxt "tfrmeditor.acteditfindnext.caption"
|
|
msgid "Find next"
|
|
msgstr "Nađi sledeće"
|
|
|
|
#: tfrmeditor.acteditfindnext.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
|
|
msgid "Find next"
|
|
msgstr "Nađi sledeće"
|
|
|
|
#: tfrmeditor.acteditfindprevious.caption
|
|
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
|
msgid "Find previous"
|
|
msgstr ""
|
|
|
|
#: tfrmeditor.acteditgotoline.caption
|
|
msgctxt "tfrmeditor.acteditgotoline.caption"
|
|
msgid "Goto Line..."
|
|
msgstr "Idi na liniju..."
|
|
|
|
#: tfrmeditor.acteditlineendcr.caption
|
|
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
|
msgid "Mac (CR)"
|
|
msgstr "Mek (CR)"
|
|
|
|
#: tfrmeditor.acteditlineendcr.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
|
|
msgid "Mac (CR)"
|
|
msgstr "Mek (CR)"
|
|
|
|
#: tfrmeditor.acteditlineendcrlf.caption
|
|
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
|
msgid "Windows (CRLF)"
|
|
msgstr "Windows (CRLF)"
|
|
|
|
#: tfrmeditor.acteditlineendcrlf.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
|
|
msgid "Windows (CRLF)"
|
|
msgstr "Windows (CRLF)"
|
|
|
|
#: tfrmeditor.acteditlineendlf.caption
|
|
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
|
msgid "Unix (LF)"
|
|
msgstr "Uniks (LF)"
|
|
|
|
#: tfrmeditor.acteditlineendlf.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
|
|
msgid "Unix (LF)"
|
|
msgstr "Uniks (LF)"
|
|
|
|
#: tfrmeditor.acteditpaste.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Prilepi"
|
|
|
|
#: tfrmeditor.acteditpaste.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
|
|
msgid "Paste"
|
|
msgstr "Prilepi"
|
|
|
|
#: tfrmeditor.acteditredo.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
|
msgid "Redo"
|
|
msgstr "Ponovi"
|
|
|
|
#: tfrmeditor.acteditredo.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
|
|
msgid "Redo"
|
|
msgstr "Ponovi"
|
|
|
|
#: tfrmeditor.acteditrplc.caption
|
|
msgid "&Replace"
|
|
msgstr "&Zameni"
|
|
|
|
#: tfrmeditor.acteditrplc.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT"
|
|
msgid "Replace"
|
|
msgstr "Zameni"
|
|
|
|
#: tfrmeditor.acteditselectall.caption
|
|
msgid "Select&All"
|
|
msgstr "Označi &sve"
|
|
|
|
#: tfrmeditor.acteditselectall.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT"
|
|
msgid "Select All"
|
|
msgstr "Označi sve"
|
|
|
|
#: tfrmeditor.acteditundo.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
|
msgid "Undo"
|
|
msgstr "Opozovi"
|
|
|
|
#: tfrmeditor.acteditundo.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
|
|
msgid "Undo"
|
|
msgstr "Opozovi"
|
|
|
|
#: tfrmeditor.actfileclose.caption
|
|
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Zatvori"
|
|
|
|
#: tfrmeditor.actfileclose.hint
|
|
msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT"
|
|
msgid "Close"
|
|
msgstr "Zatvori"
|
|
|
|
#: tfrmeditor.actfileexit.caption
|
|
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Izađi"
|
|
|
|
#: tfrmeditor.actfileexit.hint
|
|
msgctxt "tfrmeditor.actfileexit.hint"
|
|
msgid "Exit"
|
|
msgstr "Napusti"
|
|
|
|
#: tfrmeditor.actfilenew.caption
|
|
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
|
|
msgid "&New"
|
|
msgstr "&Novo"
|
|
|
|
#: tfrmeditor.actfilenew.hint
|
|
msgctxt "TFRMEDITOR.ACTFILENEW.HINT"
|
|
msgid "New"
|
|
msgstr "Novo"
|
|
|
|
#: tfrmeditor.actfileopen.caption
|
|
msgid "&Open"
|
|
msgstr "&Otvori"
|
|
|
|
#: tfrmeditor.actfileopen.hint
|
|
msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT"
|
|
msgid "Open"
|
|
msgstr "Otvori"
|
|
|
|
#: tfrmeditor.actfilereload.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmeditor.actfilereload.caption"
|
|
msgid "Reload"
|
|
msgstr "Učitaj ponovo"
|
|
|
|
#: tfrmeditor.actfilesave.caption
|
|
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
|
|
msgid "&Save"
|
|
msgstr "&Sačuvaj"
|
|
|
|
#: tfrmeditor.actfilesave.hint
|
|
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
|
|
msgid "Save"
|
|
msgstr "Sačuvaj"
|
|
|
|
#: tfrmeditor.actfilesaveas.caption
|
|
#, fuzzy
|
|
#| msgid "Save &As.."
|
|
msgid "Save &As..."
|
|
msgstr "Sačuvaj &kao..."
|
|
|
|
#: tfrmeditor.actfilesaveas.hint
|
|
msgid "Save As"
|
|
msgstr "Sačuvaj kao"
|
|
|
|
#: tfrmeditor.actsaveall.caption
|
|
msgid "Sa&ve All"
|
|
msgstr "Sač&uvaj sve"
|
|
|
|
#: tfrmeditor.actsaveall.hint
|
|
msgid "Save All"
|
|
msgstr "_Sačuvaj sve"
|
|
|
|
#: tfrmeditor.caption
|
|
msgctxt "TFRMEDITOR.CAPTION"
|
|
msgid "Editor"
|
|
msgstr "Uređivač"
|
|
|
|
#: tfrmeditor.help1.caption
|
|
msgctxt "TFRMEDITOR.HELP1.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "Po&moć"
|
|
|
|
#: tfrmeditor.miedit.caption
|
|
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Uredi"
|
|
|
|
#: tfrmeditor.miencoding.caption
|
|
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
|
msgid "En&coding"
|
|
msgstr "Ši&frovanje"
|
|
|
|
#: tfrmeditor.miencodingin.caption
|
|
msgid "Open as"
|
|
msgstr "Otvori kao"
|
|
|
|
#: tfrmeditor.miencodingout.caption
|
|
msgctxt "tfrmeditor.miencodingout.caption"
|
|
msgid "Save as"
|
|
msgstr "Sačuvaj kao"
|
|
|
|
#: tfrmeditor.mifile.caption
|
|
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
|
msgid "&File"
|
|
msgstr "&Datoteka"
|
|
|
|
#: tfrmeditor.mihighlight.caption
|
|
msgid "Syntax highlight"
|
|
msgstr "Isticanje sintakse"
|
|
|
|
#: tfrmeditor.milineendtype.caption
|
|
msgid "End Of Line"
|
|
msgstr "Završetak linije"
|
|
|
|
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
|
|
msgid "C&ase sensitivity"
|
|
msgstr "O&setljivo na veličinu slova"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
|
|
msgid "S&earch from caret"
|
|
msgstr "&Traži od umetnutog znaka"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
|
|
msgid "&Regular expressions"
|
|
msgstr "&Regularni izrazi"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
|
|
msgid "Selected &text only"
|
|
msgstr "Samo označeni tekst&"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
|
|
msgid "&Whole words only"
|
|
msgstr "&Samo cele reči"
|
|
|
|
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
|
|
msgid "Option"
|
|
msgstr "&Mogućnosti"
|
|
|
|
#: tfrmeditsearchreplace.lblreplacewith.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
|
|
msgid "&Replace with:"
|
|
msgstr "&Zameni sa:"
|
|
|
|
#: tfrmeditsearchreplace.lblsearchfor.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
|
|
msgid "&Search for:"
|
|
msgstr "&Traži:"
|
|
|
|
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
|
|
msgid "Direction"
|
|
msgstr "Smer"
|
|
|
|
#: tfrmextractdlg.caption
|
|
msgctxt "TFRMEXTRACTDLG.CAPTION"
|
|
msgid "Unpack files"
|
|
msgstr "Raspakuj datoteke"
|
|
|
|
#: tfrmextractdlg.cbextractpath.caption
|
|
msgid "&Unpack path names if stored with files"
|
|
msgstr "&Raspakuj imena putanje ako su sačuvana u datotekama"
|
|
|
|
#: tfrmextractdlg.cbfilemask.text
|
|
msgctxt "tfrmextractdlg.cbfilemask.text"
|
|
msgid "*.*"
|
|
msgstr "*.*"
|
|
|
|
#: tfrmextractdlg.cbinseparatefolder.caption
|
|
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
|
msgstr "Raspakuj svaku od arhiva u &posebnu podfasciklu (po imenima arhiva)"
|
|
|
|
#: tfrmextractdlg.cboverwrite.caption
|
|
msgid "O&verwrite existing files"
|
|
msgstr "P&repiši postojeće datoteke"
|
|
|
|
#: tfrmextractdlg.lblextractto.caption
|
|
msgid "To the &directory:"
|
|
msgstr "U &fasciklu:"
|
|
|
|
#: tfrmextractdlg.lblfilemask.caption
|
|
msgid "&Extract files matching file mask:"
|
|
msgstr "&Izvuci datoteke na osnovu poklapanja:"
|
|
|
|
#: tfrmextractdlg.lblpassword.caption
|
|
msgid "&Password for encrypted files:"
|
|
msgstr "&Lozinka za šifrovane datoteke:"
|
|
|
|
#: tfrmfileexecuteyourself.btnclose.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Zatvori"
|
|
|
|
#: tfrmfileexecuteyourself.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
|
|
msgid "Wait..."
|
|
msgstr "Sačekajte..."
|
|
|
|
#: tfrmfileexecuteyourself.lblfilename.caption
|
|
msgid "File name:"
|
|
msgstr "Ime datoteke:"
|
|
|
|
#: tfrmfileexecuteyourself.lblfrompath.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
|
|
msgid "From:"
|
|
msgstr "Iz:"
|
|
|
|
#: tfrmfileexecuteyourself.lblprompt.caption
|
|
msgid "Click on Close when the temporary file can be deleted!"
|
|
msgstr "Kliknite na „Zatvori“ ako se privremena datoteka ne može izbrisati. "
|
|
|
|
#: tfrmfileop.btncancel.caption
|
|
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "Otkaži"
|
|
|
|
#: tfrmfileop.btnminimizetopanel.caption
|
|
msgid "&To panel"
|
|
msgstr "&Na površ"
|
|
|
|
#: tfrmfileop.btnviewoperations.caption
|
|
msgid "&View all"
|
|
msgstr "&Pregledaj sve"
|
|
|
|
#: tfrmfileop.lblcurrentoperation.caption
|
|
msgid "Current operation:"
|
|
msgstr "&Trenutna radnja:"
|
|
|
|
#: tfrmfileop.lblfrom.caption
|
|
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
|
msgid "From:"
|
|
msgstr "Iz:"
|
|
|
|
#: tfrmfileop.lblto.caption
|
|
msgid "To:"
|
|
msgstr "Ka:"
|
|
|
|
#: tfrmfileproperties.btnclose.caption
|
|
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Zatvori"
|
|
|
|
#: tfrmfileproperties.btnsetproperties.caption
|
|
msgid "&Set properties"
|
|
msgstr "&Podesite svojstva"
|
|
|
|
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
|
msgid "Set to &all selected files"
|
|
msgstr "Dodeli svim odabranim datotekama"
|
|
|
|
#: tfrmfileproperties.btnskipfile.caption
|
|
msgid "Ski&p this file"
|
|
msgstr "Preskoči& ovu datoteku "
|
|
|
|
#: tfrmfileproperties.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CAPTION"
|
|
msgid "Properties"
|
|
msgstr "Svojstva"
|
|
|
|
#: tfrmfileproperties.cbsgid.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmfileproperties.cbsticky.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Lepljivo"
|
|
|
|
#: tfrmfileproperties.cbsuid.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmfileproperties.chkexecutable.caption
|
|
msgid "Allow &executing file as program"
|
|
msgstr ""
|
|
|
|
#: tfrmfileproperties.gbowner.caption
|
|
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Vlasnik"
|
|
|
|
#: tfrmfileproperties.lblattrbitsstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bita:"
|
|
|
|
#: tfrmfileproperties.lblattrgroupstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Udruženje"
|
|
|
|
#: tfrmfileproperties.lblattrotherstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Drugo"
|
|
|
|
#: tfrmfileproperties.lblattrownerstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Vlasnik"
|
|
|
|
#: tfrmfileproperties.lblattrtext.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
|
msgid "-----------"
|
|
msgstr "-----------"
|
|
|
|
#: tfrmfileproperties.lblattrtextstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
|
msgid "Text:"
|
|
msgstr "Tekst:"
|
|
|
|
#: tfrmfileproperties.lblcontains.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblcontainsstr.caption
|
|
msgid "Contains:"
|
|
msgstr "Sadrži:"
|
|
|
|
#: tfrmfileproperties.lblexec.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Izvrši"
|
|
|
|
#: tfrmfileproperties.lblexecutable.caption
|
|
msgid "Execute:"
|
|
msgstr ""
|
|
|
|
#: tfrmfileproperties.lblfile.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Ime datoteke"
|
|
|
|
#: tfrmfileproperties.lblfilename.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblfilestr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Ime datoteke"
|
|
|
|
#: tfrmfileproperties.lblfolder.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblfolderstr.caption
|
|
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
|
msgid "Path:"
|
|
msgstr "Putanja:"
|
|
|
|
#: tfrmfileproperties.lblgroupstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
|
|
msgid "&Group"
|
|
msgstr "&Udruženje"
|
|
|
|
#: tfrmfileproperties.lbllastaccess.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllastaccessstr.caption
|
|
msgid "Last access:"
|
|
msgstr "Poslednji pristup:"
|
|
|
|
#: tfrmfileproperties.lbllastmodif.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllastmodifstr.caption
|
|
msgid "Last modification:"
|
|
msgstr "Poslednja izmena:"
|
|
|
|
#: tfrmfileproperties.lbllaststchange.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllaststchangestr.caption
|
|
msgid "Last status change:"
|
|
msgstr "Poslednja izmena stanja:"
|
|
|
|
#: tfrmfileproperties.lbloctal.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
|
|
msgid "Octal:"
|
|
msgstr "Oktalno:"
|
|
|
|
#: tfrmfileproperties.lblownerstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
|
|
msgid "O&wner"
|
|
msgstr "Vlasnik&"
|
|
|
|
#: tfrmfileproperties.lblread.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Čitanje"
|
|
|
|
#: tfrmfileproperties.lblsize.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblsizestr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
|
|
msgid "Size:"
|
|
msgstr "Veličina:"
|
|
|
|
#: tfrmfileproperties.lblsymlink.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblsymlinkstr.caption
|
|
msgid "Symlink to:"
|
|
msgstr "Veza ka:"
|
|
|
|
#: tfrmfileproperties.lbltype.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbltypestr.caption
|
|
msgid "Type:"
|
|
msgstr "Vrsta:"
|
|
|
|
#: tfrmfileproperties.lblwrite.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Pisanje"
|
|
|
|
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
|
msgid "Name"
|
|
msgstr "Ime"
|
|
|
|
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
|
msgid "Value"
|
|
msgstr "Vrednost"
|
|
|
|
#: tfrmfileproperties.tsattributes.caption
|
|
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Svojstva"
|
|
|
|
#: tfrmfileproperties.tsplugins.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.tsplugins.caption"
|
|
msgid "Plugins"
|
|
msgstr "Prikljuci"
|
|
|
|
#: tfrmfileproperties.tsproperties.caption
|
|
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
|
msgid "Properties"
|
|
msgstr "Svojstva"
|
|
|
|
#: tfrmfileunlock.btnclose.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileunlock.btnclose.caption"
|
|
msgid "Close"
|
|
msgstr "Zatvori"
|
|
|
|
#: tfrmfileunlock.btnterminate.caption
|
|
msgid "Terminate"
|
|
msgstr ""
|
|
|
|
#: tfrmfileunlock.btnunlock.caption
|
|
msgctxt "tfrmfileunlock.btnunlock.caption"
|
|
msgid "Unlock"
|
|
msgstr ""
|
|
|
|
#: tfrmfileunlock.btnunlockall.caption
|
|
msgid "Unlock All"
|
|
msgstr ""
|
|
|
|
#: tfrmfileunlock.caption
|
|
msgctxt "tfrmfileunlock.caption"
|
|
msgid "Unlock"
|
|
msgstr ""
|
|
|
|
#: tfrmfileunlock.stgfilehandles.columns[0].title.caption
|
|
msgid "File Handle"
|
|
msgstr ""
|
|
|
|
#: tfrmfileunlock.stgfilehandles.columns[1].title.caption
|
|
msgid "Process ID"
|
|
msgstr ""
|
|
|
|
#: tfrmfileunlock.stgfilehandles.columns[2].title.caption
|
|
msgid "Executable Path"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actcancel.caption
|
|
msgctxt "tfrmfinddlg.actcancel.caption"
|
|
msgid "C&ancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmfinddlg.actcancelclose.caption
|
|
msgid "Cancel search and close window"
|
|
msgstr "&Zatvori"
|
|
|
|
#: tfrmfinddlg.actclose.caption
|
|
msgctxt "tfrmfinddlg.actclose.caption"
|
|
msgid "&Close"
|
|
msgstr "Zatvori"
|
|
|
|
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
|
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
|
|
msgid "Configuration of hot keys"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actedit.caption
|
|
msgctxt "tfrmfinddlg.actedit.caption"
|
|
msgid "&Edit"
|
|
msgstr "Uredi&"
|
|
|
|
#: tfrmfinddlg.actfeedtolistbox.caption
|
|
msgid "Feed to &listbox"
|
|
msgstr "Dovod &spisku"
|
|
|
|
#: tfrmfinddlg.actfreefrommem.caption
|
|
msgid "Cancel search, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actfreefrommemallothers.caption
|
|
msgid "For all other \"Find files\", cancel, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actgotofile.caption
|
|
msgid "&Go to file"
|
|
msgstr "&Idi na datoteku"
|
|
|
|
#: tfrmfinddlg.actintellifocus.caption
|
|
msgctxt "tfrmfinddlg.actintellifocus.caption"
|
|
msgid "Find Data"
|
|
msgstr "Pronađi podatke"
|
|
|
|
#: tfrmfinddlg.actlastsearch.caption
|
|
msgid "&Last search"
|
|
msgstr "&Poslednja pretraga"
|
|
|
|
#: tfrmfinddlg.actnewsearch.caption
|
|
msgid "&New search"
|
|
msgstr "&Nova pretraga"
|
|
|
|
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
|
msgid "New search (clear filters)"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageadvanced.caption
|
|
msgid "Go to page \"Advanced\""
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageloadsave.caption
|
|
msgid "Go to page \"Load/Save\""
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpagenext.caption
|
|
msgid "Switch to Nex&t Page"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageplugins.caption
|
|
msgid "Go to page \"Plugins\""
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageprev.caption
|
|
msgid "Switch to &Previous Page"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageresults.caption
|
|
msgid "Go to page \"Results\""
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpagestandard.caption
|
|
msgid "Go to page \"Standard\""
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actstart.caption
|
|
msgctxt "tfrmfinddlg.actstart.caption"
|
|
msgid "&Start"
|
|
msgstr "&Početak"
|
|
|
|
#: tfrmfinddlg.actview.caption
|
|
msgctxt "tfrmfinddlg.actview.caption"
|
|
msgid "&View"
|
|
msgstr "&Pregled"
|
|
|
|
#: tfrmfinddlg.btnaddattribute.caption
|
|
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "Dodaj&"
|
|
|
|
#: tfrmfinddlg.btnattrshelp.caption
|
|
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "&Pomoć"
|
|
|
|
#: tfrmfinddlg.btnsavetemplate.caption
|
|
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
|
msgid "&Save"
|
|
msgstr "&Sačuvaj"
|
|
|
|
#: tfrmfinddlg.btnsearchdelete.caption
|
|
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Izbriši"
|
|
|
|
#: tfrmfinddlg.btnsearchload.caption
|
|
msgid "L&oad"
|
|
msgstr "U&čitaj"
|
|
|
|
#: tfrmfinddlg.btnsearchsave.caption
|
|
msgid "S&ave"
|
|
msgstr "Sačuvaj&"
|
|
|
|
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
|
msgid "Sa&ve with \"Start in directory\""
|
|
msgstr "Sačuvaj kao „Početak u fascikli“"
|
|
|
|
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
|
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
|
msgstr "Ako se sačuva, „Početak u fascikli“ će biti povraćen prilikom učitavanja obrasca. Upotrebite to ako želite da primenite pretragu na određenu fasciklu"
|
|
|
|
#: tfrmfinddlg.btnusetemplate.caption
|
|
msgid "Use template"
|
|
msgstr "Koristi obrazac"
|
|
|
|
#: tfrmfinddlg.caption
|
|
msgctxt "TFRMFINDDLG.CAPTION"
|
|
msgid "Find files"
|
|
msgstr "Pronađi datoteke"
|
|
|
|
#: tfrmfinddlg.cbcasesens.caption
|
|
msgid "Case sens&itive"
|
|
msgstr "O&setljivo na veličinu slova"
|
|
|
|
#: tfrmfinddlg.cbdatefrom.caption
|
|
msgid "&Date from:"
|
|
msgstr "Od &datuma:"
|
|
|
|
#: tfrmfinddlg.cbdateto.caption
|
|
msgid "Dat&e to:"
|
|
msgstr "Do &datuma:"
|
|
|
|
#: tfrmfinddlg.cbfilesizefrom.caption
|
|
msgid "S&ize from:"
|
|
msgstr "Od &veličine:"
|
|
|
|
#: tfrmfinddlg.cbfilesizeto.caption
|
|
msgid "Si&ze to:"
|
|
msgstr "Do &veličine:"
|
|
|
|
#: tfrmfinddlg.cbfindinarchive.caption
|
|
msgid "Search in &archives"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.cbfindtext.caption
|
|
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
|
|
msgid "Find &text in file"
|
|
msgstr "Pronađi &tekst u datoteci"
|
|
|
|
#: tfrmfinddlg.cbfollowsymlinks.caption
|
|
msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION"
|
|
msgid "Follow s&ymlinks"
|
|
msgstr "Prati &simboličke veze"
|
|
|
|
#: tfrmfinddlg.cbnotcontainingtext.caption
|
|
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
|
|
msgid "Find files N&OT containing the text"
|
|
msgstr "Pronađi datoteke koje ne& sadrže tekst"
|
|
|
|
#: tfrmfinddlg.cbnotolderthan.caption
|
|
msgid "N&ot older than:"
|
|
msgstr "Ne& starije od:"
|
|
|
|
#: tfrmfinddlg.cbopenedtabs.caption
|
|
msgid "Opened tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.cbpartialnamesearch.caption
|
|
msgid "Searc&h for part of file name"
|
|
msgstr "Traži& po delu imena datoteke"
|
|
|
|
#: tfrmfinddlg.cbregexp.caption
|
|
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
|
|
msgid "&Regular expression"
|
|
msgstr "&Regularni izraz"
|
|
|
|
#: tfrmfinddlg.cbreplacetext.caption
|
|
msgid "Re&place by"
|
|
msgstr "Zameni& sa"
|
|
|
|
#: tfrmfinddlg.cbselectedfiles.caption
|
|
msgid "Selected directories and &files"
|
|
msgstr "Označenim fasciklama i &datotekama"
|
|
|
|
#: tfrmfinddlg.cbtextregexp.caption
|
|
msgid "Regular &expression"
|
|
msgstr "&Regularni izraz"
|
|
|
|
#: tfrmfinddlg.cbtimefrom.caption
|
|
msgid "&Time from:"
|
|
msgstr "Od &vremena:"
|
|
|
|
#: tfrmfinddlg.cbtimeto.caption
|
|
msgid "Ti&me to:"
|
|
msgstr "Do vre&mena:"
|
|
|
|
#: tfrmfinddlg.cbuseplugin.caption
|
|
msgid "&Use search plugin:"
|
|
msgstr "&Koristi priključak za pretragu:"
|
|
|
|
#: tfrmfinddlg.chkhex.caption
|
|
msgid "Hexadecimal"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.cmbexcludedirectories.hint
|
|
msgid "Enter directories names that should be excluded from search separated with \";\""
|
|
msgstr "Unesite imena fascikli koje bi trebalo da budu isključene iz pretrage odvojene znakom „;“"
|
|
|
|
#: tfrmfinddlg.cmbexcludefiles.hint
|
|
msgid "Enter files names that should be excluded from search separated with \";\""
|
|
msgstr "Unesite imena datoteka koje bi trebalo da budu isključene iz pretrage odvojene znakom „;“"
|
|
|
|
#: tfrmfinddlg.cmbfindfilemask.hint
|
|
msgid "Enter files names separated with \";\""
|
|
msgstr "Unesite imena datoteka razdvojena znakom „;“"
|
|
|
|
#: tfrmfinddlg.gbdirectories.caption
|
|
msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION"
|
|
msgid "Directories"
|
|
msgstr "Fascikle"
|
|
|
|
#: tfrmfinddlg.gbfiles.caption
|
|
msgctxt "TFRMFINDDLG.GBFILES.CAPTION"
|
|
msgid "Files"
|
|
msgstr "Datoteke"
|
|
|
|
#: tfrmfinddlg.gbfinddata.caption
|
|
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
|
msgid "Find Data"
|
|
msgstr "Pronađi podatke"
|
|
|
|
#: tfrmfinddlg.lblattributes.caption
|
|
msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION"
|
|
msgid "Attri&butes"
|
|
msgstr "Odrednice&"
|
|
|
|
#: tfrmfinddlg.lblencoding.caption
|
|
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
|
|
msgid "Encodin&g:"
|
|
msgstr "&Šifrovanje:"
|
|
|
|
#: tfrmfinddlg.lblexcludedirectories.caption
|
|
msgid "E&xclude subdirectories"
|
|
msgstr "I&zuzmi podfascikle"
|
|
|
|
#: tfrmfinddlg.lblexcludefiles.caption
|
|
msgid "&Exclude files"
|
|
msgstr "&Izuzmi datoteke"
|
|
|
|
#: tfrmfinddlg.lblfindfilemask.caption
|
|
msgid "&File mask"
|
|
msgstr "&Maska datoteke"
|
|
|
|
#: tfrmfinddlg.lblfindpathstart.caption
|
|
msgid "Start in &directory"
|
|
msgstr "Počni u &fascikli"
|
|
|
|
#: tfrmfinddlg.lblsearchdepth.caption
|
|
msgid "Search su&bdirectories:"
|
|
msgstr "traži u &podfasciklama:"
|
|
|
|
#: tfrmfinddlg.lbltemplateheader.caption
|
|
msgid "&Previous searches:"
|
|
msgstr "&Prethodne pretrage:"
|
|
|
|
#: tfrmfinddlg.miaction.caption
|
|
msgid "&Action"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.mifreefrommemallothers.caption
|
|
msgid "For all others, cancel, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.miopeninnewtab.caption
|
|
msgid "Open In New Tab(s)"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.mioptions.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfinddlg.mioptions.caption"
|
|
msgid "Options"
|
|
msgstr "Mogućnosti"
|
|
|
|
#: tfrmfinddlg.miremovefromllist.caption
|
|
msgid "Remove from list"
|
|
msgstr "Ukloni sa spiska"
|
|
|
|
#: tfrmfinddlg.miresult.caption
|
|
msgid "&Result"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.mishowallfound.caption
|
|
msgid "Show all found items"
|
|
msgstr "Prikaži sve pronađene stavke"
|
|
|
|
#: tfrmfinddlg.mishowineditor.caption
|
|
msgid "Show In Editor"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.mishowinviewer.caption
|
|
msgid "Show In Viewer"
|
|
msgstr "Prikaži u pregledniku"
|
|
|
|
#: tfrmfinddlg.miviewtab.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfinddlg.miviewtab.caption"
|
|
msgid "&View"
|
|
msgstr "&Pregled"
|
|
|
|
#: tfrmfinddlg.tsadvanced.caption
|
|
msgid "Advanced"
|
|
msgstr "Napredno"
|
|
|
|
#: tfrmfinddlg.tsloadsave.caption
|
|
msgid "Load/Save"
|
|
msgstr "Učitaj/Sačuvaj"
|
|
|
|
#: tfrmfinddlg.tsplugins.caption
|
|
msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION"
|
|
msgid "Plugins"
|
|
msgstr "Prikljuci"
|
|
|
|
#: tfrmfinddlg.tsresults.caption
|
|
msgid "Results"
|
|
msgstr "Izlazi"
|
|
|
|
#: tfrmfinddlg.tsstandard.caption
|
|
msgid "Standard"
|
|
msgstr "Obično"
|
|
|
|
#: tfrmfindview.btnclose.caption
|
|
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmfindview.btnfind.caption
|
|
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
|
msgid "&Find"
|
|
msgstr "Pronađi&"
|
|
|
|
#: tfrmfindview.caption
|
|
msgctxt "TFRMFINDVIEW.CAPTION"
|
|
msgid "Find"
|
|
msgstr "Pronađi"
|
|
|
|
#: tfrmfindview.cbcasesens.caption
|
|
msgid "C&ase sensitive"
|
|
msgstr "O&setljivo na veličinu slova"
|
|
|
|
#: tfrmhardlink.btncancel.caption
|
|
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmhardlink.btnok.caption
|
|
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmhardlink.caption
|
|
msgid "Create hard link"
|
|
msgstr "Napravi čvrstu vezu"
|
|
|
|
#: tfrmhardlink.lblexistingfile.caption
|
|
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
|
|
msgid "&Destination that the link will point to"
|
|
msgstr "&Odredište na koje će veza biti usmerena"
|
|
|
|
#: tfrmhardlink.lbllinktocreate.caption
|
|
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
|
|
msgid "&Link name"
|
|
msgstr "Ime &veze"
|
|
|
|
#: tfrmhotdirexportimport.btnselectall.caption
|
|
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTALL.CAPTION"
|
|
msgid "Import all!"
|
|
msgstr "Uvezi sve!"
|
|
|
|
#: tfrmhotdirexportimport.btnselectiondone.caption
|
|
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTIONDONE.CAPTION"
|
|
msgid "Import selected"
|
|
msgstr "Uvezi izabrano"
|
|
|
|
#: tfrmhotdirexportimport.caption
|
|
msgid "Select the entries your want to import"
|
|
msgstr "Izaberite stavke koje želite da uvezete"
|
|
|
|
#: tfrmhotdirexportimport.lbhint.caption
|
|
msgid "When clicking a sub-menu, it will select the whole menu"
|
|
msgstr "Klikom na podizbornik će se izabrati ceo izbornik"
|
|
|
|
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
|
msgid "Hold CTRL and click entries to select multiple ones"
|
|
msgstr "Držite KTRL i kliknite na stavke radi izbora više njih"
|
|
|
|
#: tfrmlinker.btnsave.caption
|
|
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmlinker.caption
|
|
msgctxt "TFRMLINKER.CAPTION"
|
|
msgid "Linker"
|
|
msgstr "Usmerivač"
|
|
|
|
#: tfrmlinker.gbsaveto.caption
|
|
msgid "Save to..."
|
|
msgstr "Sačuvaj u..."
|
|
|
|
#: tfrmlinker.grbxcontrol.caption
|
|
msgid "Item"
|
|
msgstr "Stavka"
|
|
|
|
#: tfrmlinker.lblfilename.caption
|
|
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
|
|
msgid "&File name"
|
|
msgstr "&Ime datoteke"
|
|
|
|
#: tfrmlinker.spbtndown.caption
|
|
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
|
|
msgid "Do&wn"
|
|
msgstr "Dole&"
|
|
|
|
#: tfrmlinker.spbtndown.hint
|
|
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
|
|
msgid "Down"
|
|
msgstr "Dole"
|
|
|
|
#: tfrmlinker.spbtnrem.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmlinker.spbtnrem.caption"
|
|
msgid "&Remove"
|
|
msgstr "Ukloni&"
|
|
|
|
#: tfrmlinker.spbtnrem.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmlinker.spbtnrem.hint"
|
|
msgid "Delete"
|
|
msgstr "Obriši"
|
|
|
|
#: tfrmlinker.spbtnup.caption
|
|
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
|
|
msgid "&Up"
|
|
msgstr "&gore"
|
|
|
|
#: tfrmlinker.spbtnup.hint
|
|
msgctxt "TFRMLINKER.SPBTNUP.HINT"
|
|
msgid "Up"
|
|
msgstr "Gore"
|
|
|
|
#: tfrmmain.actabout.caption
|
|
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
|
|
msgid "&About"
|
|
msgstr "&O programu"
|
|
|
|
#: tfrmmain.actactivatetabbyindex.caption
|
|
msgid "Activate Tab By Index"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actaddfilenametocmdline.caption
|
|
msgid "Add file name to command line"
|
|
msgstr "Dodaj ime datoteke u naredbenu liniju"
|
|
|
|
#: tfrmmain.actaddnewsearch.caption
|
|
msgid "New search instance..."
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
|
msgid "Add path and file name to command line"
|
|
msgstr "Dodaj putanju i ime datoteke u naredbenu liniju"
|
|
|
|
#: tfrmmain.actaddpathtocmdline.caption
|
|
msgid "Copy path to command line"
|
|
msgstr "Umnoži putanju u naredbenu liniju"
|
|
|
|
#: tfrmmain.actbenchmark.caption
|
|
msgid "&Benchmark"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actbriefview.caption
|
|
#, fuzzy
|
|
#| msgid "Brief"
|
|
msgctxt "tfrmmain.actbriefview.caption"
|
|
msgid "Brief view"
|
|
msgstr "Sažeto"
|
|
|
|
#: tfrmmain.actbriefview.hint
|
|
msgid "Brief View"
|
|
msgstr "Sažeti pregled"
|
|
|
|
#: tfrmmain.actcalculatespace.caption
|
|
msgid "Calculate &Occupied Space"
|
|
msgstr "Izračunaj zauzeće prostora"
|
|
|
|
#: tfrmmain.actchangedir.caption
|
|
msgid "Change directory"
|
|
msgstr "Promeni fasciklu"
|
|
|
|
#: tfrmmain.actchangedirtohome.caption
|
|
msgid "Change directory to home"
|
|
msgstr "Pređi na domaću fasciklu"
|
|
|
|
#: tfrmmain.actchangedirtoparent.caption
|
|
msgid "Change Directory To Parent"
|
|
msgstr "Pređi u roditeljsku fasciklu"
|
|
|
|
#: tfrmmain.actchangedirtoroot.caption
|
|
msgid "Change directory to root"
|
|
msgstr "Pređi u korenu fasciklu"
|
|
|
|
#: tfrmmain.actchecksumcalc.caption
|
|
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
|
|
msgid "Calculate Check&sum..."
|
|
msgstr "Računanje zbirne& provere..."
|
|
|
|
#: tfrmmain.actchecksumverify.caption
|
|
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
|
|
msgid "&Verify Checksum..."
|
|
msgstr "Provera zbira..."
|
|
|
|
#: tfrmmain.actclearlogfile.caption
|
|
msgid "Clear log file"
|
|
msgstr "Očisti datoteku dnevnika"
|
|
|
|
#: tfrmmain.actclearlogwindow.caption
|
|
msgid "Clear log window"
|
|
msgstr "Očisti prozor dnevnika"
|
|
|
|
#: tfrmmain.actclosealltabs.caption
|
|
msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION"
|
|
msgid "Close &All Tabs"
|
|
msgstr "Zatvori &sve kartice"
|
|
|
|
#: tfrmmain.actcloseduplicatetabs.caption
|
|
msgid "Close Duplicate Tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actclosetab.caption
|
|
msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION"
|
|
msgid "&Close Tab"
|
|
msgstr "&Zatvori karticu"
|
|
|
|
#: tfrmmain.actcmdlinenext.caption
|
|
msgid "Next Command Line"
|
|
msgstr "Sledeća naredbena linija"
|
|
|
|
#: tfrmmain.actcmdlinenext.hint
|
|
msgid "Set command line to next command in history"
|
|
msgstr "Postavi sledeću naredbu iz istorije u naredbenu liniju"
|
|
|
|
#: tfrmmain.actcmdlineprev.caption
|
|
msgid "Previous Command Line"
|
|
msgstr "Prethodna naredbena linija"
|
|
|
|
#: tfrmmain.actcmdlineprev.hint
|
|
msgid "Set command line to previous command in history"
|
|
msgstr "Postavi prethodnu naredbu iz istorije u naredbenu liniju"
|
|
|
|
#: tfrmmain.actcolumnsview.caption
|
|
msgid "Full"
|
|
msgstr "Potpuno"
|
|
|
|
#: tfrmmain.actcolumnsview.hint
|
|
msgid "Columns View"
|
|
msgstr "Pregled u vidu stubaca"
|
|
|
|
#: tfrmmain.actcomparecontents.caption
|
|
msgid "Compare by &Contents"
|
|
msgstr "Uporedi po &sadržaju"
|
|
|
|
#: tfrmmain.actcomparedirectories.caption
|
|
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
|
|
msgid "Compare Directories"
|
|
msgstr "Uporedi fascikle"
|
|
|
|
#: tfrmmain.actcomparedirectories.hint
|
|
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
|
msgid "Compare Directories"
|
|
msgstr "Uporedi fascikle"
|
|
|
|
#: tfrmmain.actconfigarchivers.caption
|
|
msgid "Configuration of Archivers"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigdirhotlist.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
|
msgid "Configuration of Directory Hotlist"
|
|
msgstr "Postavke brzog spiska fascikli"
|
|
|
|
#: tfrmmain.actconfigfavoritetabs.caption
|
|
msgid "Configuration of Favorite Tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigfoldertabs.caption
|
|
msgid "Configuration of folder tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfighotkeys.caption
|
|
msgctxt "tfrmmain.actconfighotkeys.caption"
|
|
msgid "Configuration of hot keys"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigplugins.caption
|
|
msgid "Configuration of Plugins"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigsavesettings.caption
|
|
msgid "Save Settings"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigsearches.caption
|
|
msgid "Configuration of searches"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigtoolbars.caption
|
|
msgid "Toolbar..."
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigtooltips.caption
|
|
msgid "Configuration of tooltips"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigtreeviewmenus.caption
|
|
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
|
msgid "Configuration of Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
|
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
|
msgid "Configuration of Tree View Menu Colors"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actcontextmenu.caption
|
|
msgid "Show context menu"
|
|
msgstr "Prikaži priručni izbornik"
|
|
|
|
#: tfrmmain.actcopy.caption
|
|
msgctxt "tfrmmain.actcopy.caption"
|
|
msgid "Copy"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmmain.actcopyalltabstoopposite.caption
|
|
msgid "Copy all tabs to opposite side"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actcopyfiledetailstoclip.caption
|
|
msgid "Copy all shown &columns"
|
|
msgstr "Umnoži sve prikazane &stupce"
|
|
|
|
#: tfrmmain.actcopyfullnamestoclip.caption
|
|
msgid "Copy Filename(s) with Full &Path"
|
|
msgstr "Umnoži potpunu putanju sa imenima datoteka"
|
|
|
|
#: tfrmmain.actcopynamestoclip.caption
|
|
msgid "Copy &Filename(s) to Clipboard"
|
|
msgstr "Umnoži imena datoteka u ostavu isečaka"
|
|
|
|
#: tfrmmain.actcopynoask.caption
|
|
msgid "Copy files without asking for confirmation"
|
|
msgstr "Umnoži datoteke bez pitanja za potvrdu"
|
|
|
|
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
|
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actcopypathoffilestoclip.caption
|
|
msgid "Copy Full Path of selected file(s)"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actcopysamepanel.caption
|
|
msgid "Copy to same panel"
|
|
msgstr "Umnoži u istu površ"
|
|
|
|
#: tfrmmain.actcopytoclipboard.caption
|
|
msgid "&Copy"
|
|
msgstr "&Umnoži"
|
|
|
|
#: tfrmmain.actcountdircontent.caption
|
|
msgid "Sho&w Occupied Space"
|
|
msgstr "&Prikaži zauzeće memorije"
|
|
|
|
#: tfrmmain.actcuttoclipboard.caption
|
|
msgid "Cu&t"
|
|
msgstr "&Iseci"
|
|
|
|
#: tfrmmain.actdebugshowcommandparameters.caption
|
|
msgid "Show Command Parameters"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actdelete.caption
|
|
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Izbriši"
|
|
|
|
#: tfrmmain.actdeletesearches.caption
|
|
msgid "For all searches, cancel, close and free memory"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actdirhistory.caption
|
|
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
|
|
msgid "Directory history"
|
|
msgstr "Istorija fascikle"
|
|
|
|
#: tfrmmain.actdirhotlist.caption
|
|
msgid "Directory &Hotlist"
|
|
msgstr "Brzi spisak &fascikli"
|
|
|
|
#: tfrmmain.actdoanycmcommand.caption
|
|
msgid "Select any command and execute it"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actedit.caption
|
|
msgctxt "tfrmmain.actedit.caption"
|
|
msgid "Edit"
|
|
msgstr "Uredi"
|
|
|
|
#: tfrmmain.acteditcomment.caption
|
|
msgid "Edit Co&mment..."
|
|
msgstr "Uredi &napomenu..."
|
|
|
|
#: tfrmmain.acteditnew.caption
|
|
msgid "Edit new file"
|
|
msgstr "Uredi novu datoteku"
|
|
|
|
#: tfrmmain.acteditpath.caption
|
|
msgid "Edit path field above file list"
|
|
msgstr "Uredi polje putanje iznad spiska"
|
|
|
|
#: tfrmmain.actexchange.caption
|
|
msgid "Swap &Panels"
|
|
msgstr "Zameni površi"
|
|
|
|
#: tfrmmain.actexecutescript.caption
|
|
msgid "Execute Script"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actexit.caption
|
|
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Napusti"
|
|
|
|
#: tfrmmain.actextractfiles.caption
|
|
msgid "&Extract Files..."
|
|
msgstr "&Izvuci datoteke..."
|
|
|
|
#: tfrmmain.actfileassoc.caption
|
|
#, fuzzy
|
|
#| msgid "File &Associations..."
|
|
msgid "Configuration of File &Associations"
|
|
msgstr "Pridruživanje &datoteka..."
|
|
|
|
#: tfrmmain.actfilelinker.caption
|
|
msgid "Com&bine Files..."
|
|
msgstr "&Spoji datoteke..."
|
|
|
|
#: tfrmmain.actfileproperties.caption
|
|
msgid "Show &File Properties"
|
|
msgstr "Prikaži svojstva &datoteka"
|
|
|
|
#: tfrmmain.actfilespliter.caption
|
|
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
|
|
msgid "Spl&it File..."
|
|
msgstr "Podeli& datoteku..."
|
|
|
|
#: tfrmmain.actflatview.caption
|
|
msgid "&Flat view"
|
|
msgstr "&Ravan prikaz"
|
|
|
|
#: tfrmmain.actfocuscmdline.caption
|
|
msgid "Focus command line"
|
|
msgstr "Žiža na naredbenu liniju"
|
|
|
|
#: tfrmmain.actfocusswap.caption
|
|
msgid "Swap focus"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actfocusswap.hint
|
|
msgid "Switch between left and right file list"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actgotofirstfile.caption
|
|
msgid "Place cursor on first file in list"
|
|
msgstr "Postavi pokazivač na prvu datoteku spiska"
|
|
|
|
#: tfrmmain.actgotolastfile.caption
|
|
msgid "Place cursor on last file in list"
|
|
msgstr "Postavi pokazivač na poslednju datoteku spiska"
|
|
|
|
#: tfrmmain.acthardlink.caption
|
|
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
|
|
msgid "Create &Hard Link..."
|
|
msgstr "Napravi &čvrstu vezu..."
|
|
|
|
#: tfrmmain.acthelpindex.caption
|
|
msgid "&Contents"
|
|
msgstr "&Sadržaj"
|
|
|
|
#: tfrmmain.acthorizontalfilepanels.caption
|
|
msgid "&Horizontal Panels Mode"
|
|
msgstr "&Vodoravan prikaz površi"
|
|
|
|
#: tfrmmain.actkeyboard.caption
|
|
msgid "&Keyboard"
|
|
msgstr "&Tastatura"
|
|
|
|
#: tfrmmain.actleftbriefview.caption
|
|
msgid "Brief view on left panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftcolumnsview.caption
|
|
msgid "Columns view on left panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftequalright.caption
|
|
msgid "Left &= Right"
|
|
msgstr "Levo &= Desno"
|
|
|
|
#: tfrmmain.actleftflatview.caption
|
|
msgid "&Flat view on left panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftopendrives.caption
|
|
msgid "Open left drive list"
|
|
msgstr "Otvori spisak levog uređaja"
|
|
|
|
#: tfrmmain.actleftreverseorder.caption
|
|
msgid "Re&verse order on left panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftsortbyattr.caption
|
|
msgid "Sort left panel by &Attributes"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftsortbydate.caption
|
|
msgid "Sort left panel by &Date"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftsortbyext.caption
|
|
msgid "Sort left panel by &Extension"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftsortbyname.caption
|
|
msgid "Sort left panel by &Name"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftsortbysize.caption
|
|
msgid "Sort left panel by &Size"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actleftthumbview.caption
|
|
msgid "Thumbnails view on left panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actloadfavoritetabs.caption
|
|
msgid "Load tabs from Favorite Tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actloadselectionfromclip.caption
|
|
msgid "Load Selection from Clip&board"
|
|
msgstr "Učitaj sadržaj ostave isečaka"
|
|
|
|
#: tfrmmain.actloadselectionfromfile.caption
|
|
msgid "&Load Selection from File..."
|
|
msgstr "&Učitaj izbor iz datoteke..."
|
|
|
|
#: tfrmmain.actloadtabs.caption
|
|
msgid "&Load Tabs from File"
|
|
msgstr "&Učitaj kartice iz datoteke"
|
|
|
|
#: tfrmmain.actmakedir.caption
|
|
msgid "Create &Directory"
|
|
msgstr "Napravi &fasciklu"
|
|
|
|
#: tfrmmain.actmarkcurrentextension.caption
|
|
msgid "Select All with the Same E&xtension"
|
|
msgstr "Označi sve sa istim nastavkom&"
|
|
|
|
#: tfrmmain.actmarkcurrentname.caption
|
|
msgid "Select all files with same name"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkcurrentnameext.caption
|
|
msgid "Select all files with same name and extension"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkcurrentpath.caption
|
|
msgid "Select all in same path"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkinvert.caption
|
|
msgid "&Invert Selection"
|
|
msgstr "&Obrni izbor"
|
|
|
|
#: tfrmmain.actmarkmarkall.caption
|
|
msgid "&Select All"
|
|
msgstr "&Označi sve"
|
|
|
|
#: tfrmmain.actmarkminus.caption
|
|
msgid "Unselect a Gro&up..."
|
|
msgstr "Poništi izbor &skupa..."
|
|
|
|
#: tfrmmain.actmarkplus.caption
|
|
msgid "Select a &Group..."
|
|
msgstr "Izaberi &skup..."
|
|
|
|
#: tfrmmain.actmarkunmarkall.caption
|
|
msgid "&Unselect All"
|
|
msgstr "&Odznači sve"
|
|
|
|
#: tfrmmain.actminimize.caption
|
|
msgid "Minimize window"
|
|
msgstr "Umanji prozor"
|
|
|
|
#: tfrmmain.actmultirename.caption
|
|
msgid "Multi &Rename Tool"
|
|
msgstr "Pribor za masovno &preimenovanje"
|
|
|
|
#: tfrmmain.actnetworkconnect.caption
|
|
msgid "Network &Connect..."
|
|
msgstr "Uspostavi mrežnu &vezu..."
|
|
|
|
#: tfrmmain.actnetworkdisconnect.caption
|
|
msgid "Network &Disconnect"
|
|
msgstr "Prekini mrežnu &vezu"
|
|
|
|
#: tfrmmain.actnetworkquickconnect.caption
|
|
msgid "Network &Quick Connect..."
|
|
msgstr "&Brza mrežna veza..."
|
|
|
|
#: tfrmmain.actnewtab.caption
|
|
msgid "&New Tab"
|
|
msgstr "&Novi list"
|
|
|
|
#: tfrmmain.actnextfavoritetabs.caption
|
|
msgid "Load the Next Favorite Tabs in the list"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actnexttab.caption
|
|
msgid "Switch to Nex&t Tab"
|
|
msgstr "Pređi na &sledeći list"
|
|
|
|
#: tfrmmain.actopen.caption
|
|
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
|
msgid "Open"
|
|
msgstr "Otvori"
|
|
|
|
#: tfrmmain.actopenarchive.caption
|
|
msgid "Try open archive"
|
|
msgstr "Pokušaj da otvoriš skladište"
|
|
|
|
#: tfrmmain.actopenbar.caption
|
|
msgid "Open bar file"
|
|
msgstr "Otvori datoteku sa trake"
|
|
|
|
#: tfrmmain.actopendirinnewtab.caption
|
|
msgid "Open &Folder in a New Tab"
|
|
msgstr "Otvori &fasciklu u novom listu"
|
|
|
|
#: tfrmmain.actopendrivebyindex.caption
|
|
msgid "Open Drive by Index"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
|
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
|
|
msgid "Open &VFS List"
|
|
msgstr "Otvori &VFS spisak"
|
|
|
|
#: tfrmmain.actoperationsviewer.caption
|
|
msgid "Operations &Viewer"
|
|
msgstr "Preglednik &napretka radnji"
|
|
|
|
#: tfrmmain.actoptions.caption
|
|
msgid "&Options..."
|
|
msgstr "&Mogućnosti..."
|
|
|
|
#: tfrmmain.actpackfiles.caption
|
|
msgid "&Pack Files..."
|
|
msgstr "&Skladišti datoteke..."
|
|
|
|
#: tfrmmain.actpanelssplitterperpos.caption
|
|
msgid "Set splitter position"
|
|
msgstr "Podesite položaj deobe"
|
|
|
|
#: tfrmmain.actpastefromclipboard.caption
|
|
msgid "&Paste"
|
|
msgstr "&Prilepi"
|
|
|
|
#: tfrmmain.actpreviousfavoritetabs.caption
|
|
msgid "Load the Previous Favorite Tabs in the list"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actprevtab.caption
|
|
msgid "Switch to &Previous Tab"
|
|
msgstr "Pređi na &prethodni list"
|
|
|
|
#: tfrmmain.actquickfilter.caption
|
|
msgid "Quick filter"
|
|
msgstr "Brzi propusnik"
|
|
|
|
#: tfrmmain.actquicksearch.caption
|
|
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
|
|
msgid "Quick search"
|
|
msgstr "Brza pretraga"
|
|
|
|
#: tfrmmain.actquickview.caption
|
|
msgid "&Quick View Panel"
|
|
msgstr "&Površ za brzi pregled"
|
|
|
|
#: tfrmmain.actrefresh.caption
|
|
msgid "&Refresh"
|
|
msgstr "&Osveži"
|
|
|
|
#: tfrmmain.actreloadfavoritetabs.caption
|
|
msgid "Reload the last Favorite Tabs loaded"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrename.caption
|
|
msgctxt "tfrmmain.actrename.caption"
|
|
msgid "Move"
|
|
msgstr "Premesti"
|
|
|
|
#: tfrmmain.actrenamenoask.caption
|
|
msgid "Move/Rename files without asking for confirmation"
|
|
msgstr "Premeštaj i preimenuj datoteke bez pitanja za potvrdu"
|
|
|
|
#: tfrmmain.actrenameonly.caption
|
|
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
|
|
msgid "Rename"
|
|
msgstr "Preimenuj"
|
|
|
|
#: tfrmmain.actrenametab.caption
|
|
msgid "&Rename Tab"
|
|
msgstr "&Preimenuj list"
|
|
|
|
#: tfrmmain.actresavefavoritetabs.caption
|
|
msgid "Resave on the last Favorite Tabs loaded"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrestoreselection.caption
|
|
msgid "&Restore Selection"
|
|
msgstr "&Povrati izbor"
|
|
|
|
#: tfrmmain.actreverseorder.caption
|
|
msgid "Re&verse Order"
|
|
msgstr "&Obrnuti redosled"
|
|
|
|
#: tfrmmain.actrightbriefview.caption
|
|
msgid "Brief view on right panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightcolumnsview.caption
|
|
msgid "Columns view on right panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightequalleft.caption
|
|
msgid "Right &= Left"
|
|
msgstr "Desno &= levo"
|
|
|
|
#: tfrmmain.actrightflatview.caption
|
|
msgid "&Flat view on right panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightopendrives.caption
|
|
msgid "Open right drive list"
|
|
msgstr "Otvori spisak desnog uređaja"
|
|
|
|
#: tfrmmain.actrightreverseorder.caption
|
|
msgid "Re&verse order on right panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightsortbyattr.caption
|
|
msgid "Sort right panel by &Attributes"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightsortbydate.caption
|
|
msgid "Sort right panel by &Date"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightsortbyext.caption
|
|
msgid "Sort right panel by &Extension"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightsortbyname.caption
|
|
msgid "Sort right panel by &Name"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightsortbysize.caption
|
|
msgid "Sort right panel by &Size"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrightthumbview.caption
|
|
msgid "Thumbnails view on right panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actrunterm.caption
|
|
msgid "Run &Terminal"
|
|
msgstr "Pokreni u &terminalu"
|
|
|
|
#: tfrmmain.actsavefavoritetabs.caption
|
|
msgid "Save current tabs to a New Favorite Tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actsaveselection.caption
|
|
msgid "Sa&ve Selection"
|
|
msgstr "&Sačuvaj izbor"
|
|
|
|
#: tfrmmain.actsaveselectiontofile.caption
|
|
msgid "Save S&election to File..."
|
|
msgstr "Sačuvaj &izbor u datoteku..."
|
|
|
|
#: tfrmmain.actsavetabs.caption
|
|
msgid "&Save Tabs to File"
|
|
msgstr "&Sačuvaj kartice u datoteku"
|
|
|
|
#: tfrmmain.actsearch.caption
|
|
msgid "&Search..."
|
|
msgstr "&Traži..."
|
|
|
|
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
|
msgid "All tabs Locked with Dir Opened in New Tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actsetalltabsoptionnormal.caption
|
|
msgid "Set all tabs to Normal"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
|
msgid "Set all tabs to Locked"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
|
msgid "All tabs Locked with Dir Changes Allowed"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actsetfileproperties.caption
|
|
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
|
|
msgid "Change &Attributes..."
|
|
msgstr "Promeni &svojstva..."
|
|
|
|
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
|
msgid "Locked with Directories Opened in New &Tabs"
|
|
msgstr "Zaključano sa fasciklama otvorenim u novom &listu"
|
|
|
|
#: tfrmmain.actsettaboptionnormal.caption
|
|
msgid "&Normal"
|
|
msgstr "&Obično"
|
|
|
|
#: tfrmmain.actsettaboptionpathlocked.caption
|
|
msgid "&Locked"
|
|
msgstr "&Zaključano"
|
|
|
|
#: tfrmmain.actsettaboptionpathresets.caption
|
|
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
|
|
msgid "Locked with &Directory Changes Allowed"
|
|
msgstr "Zaključeno sa dozvolom izmene &fascikli"
|
|
|
|
#: tfrmmain.actshellexecute.caption
|
|
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
|
|
msgid "Open"
|
|
msgstr "Otvori"
|
|
|
|
#: tfrmmain.actshellexecute.hint
|
|
msgid "Open using system associations"
|
|
msgstr "Otvori koristeći pridruživanje datoteka"
|
|
|
|
#: tfrmmain.actshowbuttonmenu.caption
|
|
msgid "Show button menu"
|
|
msgstr "Prikaži izbornik dugmeta"
|
|
|
|
#: tfrmmain.actshowcmdlinehistory.caption
|
|
msgid "Show command line history"
|
|
msgstr "prikaži istoriju naredbi"
|
|
|
|
#: tfrmmain.actshowmainmenu.caption
|
|
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
|
|
msgid "Menu"
|
|
msgstr "Izbornik"
|
|
|
|
#: tfrmmain.actshowsysfiles.caption
|
|
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
|
|
msgid "Show &Hidden/System Files"
|
|
msgstr "Prikazuj &skrivene i sistemske datoteke"
|
|
|
|
#: tfrmmain.actsortbyattr.caption
|
|
msgid "Sort by &Attributes"
|
|
msgstr "Poređaj po &svojstvima"
|
|
|
|
#: tfrmmain.actsortbydate.caption
|
|
msgid "Sort by &Date"
|
|
msgstr "Poređaj po &datumu"
|
|
|
|
#: tfrmmain.actsortbyext.caption
|
|
msgid "Sort by &Extension"
|
|
msgstr "Poređaj po &nastavku"
|
|
|
|
#: tfrmmain.actsortbyname.caption
|
|
msgid "Sort by &Name"
|
|
msgstr "Poređaj po &imenu"
|
|
|
|
#: tfrmmain.actsortbysize.caption
|
|
msgid "Sort by &Size"
|
|
msgstr "Poređaj po &veličini"
|
|
|
|
#: tfrmmain.actsrcopendrives.caption
|
|
msgid "Open drive list"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actswitchignorelist.caption
|
|
msgid "Enable/disable ignore list file to not show file names"
|
|
msgstr "Omogući/onemogući prikaz zanemarenih datoteka sa spiska"
|
|
|
|
#: tfrmmain.actsymlink.caption
|
|
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
|
|
msgid "Create Symbolic &Link..."
|
|
msgstr "Napravi simboličku &vezu..."
|
|
|
|
#: tfrmmain.actsyncdirs.caption
|
|
msgid "Syn&chronize dirs..."
|
|
msgstr "Uskladi fascikle..."
|
|
|
|
#: tfrmmain.acttargetequalsource.caption
|
|
msgid "Target &= Source"
|
|
msgstr "Cilj &= izvor"
|
|
|
|
#: tfrmmain.acttestarchive.caption
|
|
msgid "&Test Archive(s)"
|
|
msgstr "&Proveri skladište"
|
|
|
|
#: tfrmmain.actthumbnailsview.caption
|
|
msgctxt "tfrmmain.actthumbnailsview.caption"
|
|
msgid "Thumbnails"
|
|
msgstr "Umanjene sličice"
|
|
|
|
#: tfrmmain.actthumbnailsview.hint
|
|
msgid "Thumbnails View"
|
|
msgstr "Pregled umanjenih sličica"
|
|
|
|
#: tfrmmain.acttogglefullscreenconsole.caption
|
|
msgid "Toggle fullscreen mode console"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.acttransferleft.caption
|
|
msgid "Transfer dir under cursor to left window"
|
|
msgstr "Premesti fasciklu pod pokazivačem na levi prozor"
|
|
|
|
#: tfrmmain.acttransferright.caption
|
|
msgid "Transfer dir under cursor to right window"
|
|
msgstr "Premesti fasciklu pod pokazivačem na desni prozor"
|
|
|
|
#: tfrmmain.acttreeview.caption
|
|
msgid "&Tree View Panel"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actuniversalsingledirectsort.caption
|
|
msgid "Sort according to parameters"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actunmarkcurrentextension.caption
|
|
msgid "Unselect All with the Same Ex&tension"
|
|
msgstr "Odznači sve sa istim nastavkom&"
|
|
|
|
#: tfrmmain.actunmarkcurrentname.caption
|
|
msgid "Unselect all files with same name"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actunmarkcurrentnameext.caption
|
|
msgid "Unselect all files with same name and extension"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actunmarkcurrentpath.caption
|
|
msgid "Unselect all in same path"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actview.caption
|
|
msgctxt "tfrmmain.actview.caption"
|
|
msgid "View"
|
|
msgstr "Pregled"
|
|
|
|
#: tfrmmain.actviewhistory.caption
|
|
msgid "Show history of visited paths for active view"
|
|
msgstr "Prikaži istoriju posećenih putanja pod ovakvim pregledom"
|
|
|
|
#: tfrmmain.actviewhistorynext.caption
|
|
msgid "Go to next entry in history"
|
|
msgstr "Idi na sledeću stavku istorije"
|
|
|
|
#: tfrmmain.actviewhistoryprev.caption
|
|
msgid "Go to previous entry in history"
|
|
msgstr "Idi na prethodnu stavku istorije"
|
|
|
|
#: tfrmmain.actviewlogfile.caption
|
|
msgid "View log file"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actviewsearches.caption
|
|
msgid "View current search instances"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actvisithomepage.caption
|
|
msgid "&Visit Double Commander Website"
|
|
msgstr "&Posetite Veb stranicu Double Commander-a"
|
|
|
|
#: tfrmmain.actwipe.caption
|
|
msgid "Wipe"
|
|
msgstr "Briši potpuno"
|
|
|
|
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
|
msgid "Work with Directory Hotlist and parameters"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.btnf10.caption
|
|
msgctxt "tfrmmain.btnf10.caption"
|
|
msgid "Exit"
|
|
msgstr "Izlaz"
|
|
|
|
#: tfrmmain.btnf7.caption
|
|
msgctxt "TFRMMAIN.BTNF7.CAPTION"
|
|
msgid "Directory"
|
|
msgstr "Fascikla"
|
|
|
|
#: tfrmmain.btnf8.caption
|
|
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Izbriši"
|
|
|
|
#: tfrmmain.btnf9.caption
|
|
msgctxt "tfrmmain.btnf9.caption"
|
|
msgid "Terminal"
|
|
msgstr "Terminal"
|
|
|
|
#: tfrmmain.btnleftdirectoryhotlist.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
|
msgid "*"
|
|
msgstr "*"
|
|
|
|
#: tfrmmain.btnleftdirectoryhotlist.hint
|
|
#, fuzzy
|
|
#| msgid "Directory hotlist"
|
|
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Brzi spisak fascikli"
|
|
|
|
#: tfrmmain.btnleftequalright.caption
|
|
msgctxt "tfrmmain.btnleftequalright.caption"
|
|
msgid "<"
|
|
msgstr "<"
|
|
|
|
#: tfrmmain.btnleftequalright.hint
|
|
msgid "Show current directory of the right panel in the left panel"
|
|
msgstr "Prikaži trenutnu fasciklu sa desne površi na levu površ"
|
|
|
|
#: tfrmmain.btnlefthome.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
|
|
msgid "~"
|
|
msgstr "~"
|
|
|
|
#: tfrmmain.btnlefthome.hint
|
|
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
|
|
msgid "Go to home directory"
|
|
msgstr "Idi u domaću fasciklu"
|
|
|
|
#: tfrmmain.btnleftroot.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
|
|
msgid "/"
|
|
msgstr "/"
|
|
|
|
#: tfrmmain.btnleftroot.hint
|
|
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
|
|
msgid "Go to root directory"
|
|
msgstr "Idi u korenu fasciklu"
|
|
|
|
#: tfrmmain.btnleftup.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
|
|
msgid ".."
|
|
msgstr ".."
|
|
|
|
#: tfrmmain.btnleftup.hint
|
|
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
|
|
msgid "Go to parent directory"
|
|
msgstr "Idi u roditeljsku fasciklu"
|
|
|
|
#: tfrmmain.btnrightdirectoryhotlist.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
|
msgid "*"
|
|
msgstr "*"
|
|
|
|
#: tfrmmain.btnrightdirectoryhotlist.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Brzi spisak fascikli"
|
|
|
|
#: tfrmmain.btnrightequalleft.caption
|
|
msgctxt "tfrmmain.btnrightequalleft.caption"
|
|
msgid ">"
|
|
msgstr ">"
|
|
|
|
#: tfrmmain.btnrightequalleft.hint
|
|
msgid "Show current directory of the left panel in the right panel"
|
|
msgstr "Prikaži trenutnu fasciklu sa leve površi na desnu površ"
|
|
|
|
#: tfrmmain.btnrighthome.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
|
msgid "~"
|
|
msgstr "~"
|
|
|
|
#: tfrmmain.btnrightroot.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
|
msgid "/"
|
|
msgstr "/"
|
|
|
|
#: tfrmmain.btnrightup.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
|
msgid ".."
|
|
msgstr ".."
|
|
|
|
#: tfrmmain.caption
|
|
msgctxt "TFRMMAIN.CAPTION"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmmain.lblcommandpath.caption
|
|
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
|
|
msgid "Path"
|
|
msgstr "Putanja"
|
|
|
|
#: tfrmmain.mi2080.caption
|
|
msgid "&20/80"
|
|
msgstr "&20/80"
|
|
|
|
#: tfrmmain.mi3070.caption
|
|
msgid "&30/70"
|
|
msgstr "&30/70"
|
|
|
|
#: tfrmmain.mi4060.caption
|
|
msgid "&40/60"
|
|
msgstr "&40/60"
|
|
|
|
#: tfrmmain.mi5050.caption
|
|
msgid "&50/50"
|
|
msgstr "&50/50"
|
|
|
|
#: tfrmmain.mi6040.caption
|
|
msgid "&60/40"
|
|
msgstr "&60/40"
|
|
|
|
#: tfrmmain.mi7030.caption
|
|
msgid "&70/30"
|
|
msgstr "&70/30"
|
|
|
|
#: tfrmmain.mi8020.caption
|
|
msgid "&80/20"
|
|
msgstr "&80/20"
|
|
|
|
#: tfrmmain.micancel.caption
|
|
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Otkaži"
|
|
|
|
#: tfrmmain.micopy.caption
|
|
msgid "Copy..."
|
|
msgstr "Umnožavanje..."
|
|
|
|
#: tfrmmain.mihardlink.caption
|
|
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
|
|
msgid "Create link..."
|
|
msgstr "Stvaranje veze..."
|
|
|
|
#: tfrmmain.milogclear.caption
|
|
msgid "Clear"
|
|
msgstr "Očisti"
|
|
|
|
#: tfrmmain.milogcopy.caption
|
|
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmmain.miloghide.caption
|
|
msgid "Hide"
|
|
msgstr "Sakrij"
|
|
|
|
#: tfrmmain.milogselectall.caption
|
|
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
|
msgid "Select All"
|
|
msgstr "Označi sve"
|
|
|
|
#: tfrmmain.mimove.caption
|
|
msgid "Move..."
|
|
msgstr "Premesti..."
|
|
|
|
#: tfrmmain.misymlink.caption
|
|
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
|
|
msgid "Create symlink..."
|
|
msgstr "Stvaranje simboličke veze..."
|
|
|
|
#: tfrmmain.mitaboptions.caption
|
|
msgid "Tab options"
|
|
msgstr "Mogućnosti lista"
|
|
|
|
#: tfrmmain.mitrayiconexit.caption
|
|
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "Izlaz&"
|
|
|
|
#: tfrmmain.mitrayiconrestore.caption
|
|
msgid "Restore"
|
|
msgstr "Povrati"
|
|
|
|
#: tfrmmain.mnualloperpause.caption
|
|
msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION"
|
|
msgid "||"
|
|
msgstr "||"
|
|
|
|
#: tfrmmain.mnualloperstart.caption
|
|
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
|
|
msgid "Start"
|
|
msgstr "Početak"
|
|
|
|
#: tfrmmain.mnualloperstop.caption
|
|
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Otkaži"
|
|
|
|
#: tfrmmain.mnucmd.caption
|
|
msgid "&Commands"
|
|
msgstr "&Naredbe"
|
|
|
|
#: tfrmmain.mnuconfig.caption
|
|
msgid "C&onfiguration"
|
|
msgstr "&Postavke"
|
|
|
|
#: tfrmmain.mnufavoritetabs.caption
|
|
msgid "Favorites"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.mnufiles.caption
|
|
msgid "&Files"
|
|
msgstr "Datoteke&"
|
|
|
|
#: tfrmmain.mnuhelp.caption
|
|
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "Pomoć&"
|
|
|
|
#: tfrmmain.mnumark.caption
|
|
msgid "&Mark"
|
|
msgstr "Oznaka&"
|
|
|
|
#: tfrmmain.mnunetwork.caption
|
|
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
|
|
msgid "Network"
|
|
msgstr "Mreža"
|
|
|
|
#: tfrmmain.mnushow.caption
|
|
msgid "&Show"
|
|
msgstr "Prikaži&"
|
|
|
|
#: tfrmmain.mnutaboptions.caption
|
|
#, fuzzy
|
|
#| msgid "&Options"
|
|
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
|
|
msgid "Tab &Options"
|
|
msgstr "&Mogućnosti"
|
|
|
|
#: tfrmmain.mnutabs.caption
|
|
msgid "&Tabs"
|
|
msgstr "Listovi&"
|
|
|
|
#: tfrmmain.tbchangedir.caption
|
|
msgid "CD"
|
|
msgstr "CD"
|
|
|
|
#: tfrmmain.tbcopy.caption
|
|
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmmain.tbcut.caption
|
|
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Iseci"
|
|
|
|
#: tfrmmain.tbdelete.caption
|
|
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Izbriši"
|
|
|
|
#: tfrmmain.tbedit.caption
|
|
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
|
msgid "Edit"
|
|
msgstr "Uredi"
|
|
|
|
#: tfrmmain.tbpaste.caption
|
|
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Prilepi"
|
|
|
|
#: tfrmmaincommandsdlg.btncancel.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmmaincommandsdlg.btnok.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaincommandsdlg.btnok.caption"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmmaincommandsdlg.caption
|
|
msgid "Select your internal command"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
|
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
|
msgid "Legacy sorted"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
|
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
|
|
msgid "Legacy sorted"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
|
msgid "Select all categories by default"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.gbselection.caption
|
|
msgid "Selection:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblcategory.caption
|
|
msgid "&Categories:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblcommandname.caption
|
|
msgid "Command &name:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
|
msgid "&Filter:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblhint.caption
|
|
msgid "Hint:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblhotkey.caption
|
|
msgid "Hotkey:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
|
msgid "cm_name"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
|
msgid "Category"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
|
msgid "Help"
|
|
msgstr "Pomoć"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
|
msgid "Hint"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
|
msgid "Hotkey"
|
|
msgstr "Prečica"
|
|
|
|
#: tfrmmaskinputdlg.btnaddattribute.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "Dodaj&"
|
|
|
|
#: tfrmmaskinputdlg.btnattrshelp.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
|
|
msgid "&Help"
|
|
msgstr "&Pomoć"
|
|
|
|
#: tfrmmaskinputdlg.btncancel.caption
|
|
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "Otkaži&"
|
|
|
|
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
|
msgid "&Define..."
|
|
msgstr "Opiši&..."
|
|
|
|
#: tfrmmaskinputdlg.btnok.caption
|
|
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "U redu&"
|
|
|
|
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
|
msgid "Case sensitive"
|
|
msgstr "Osetljivo na veličinu slova"
|
|
|
|
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
|
msgid "Ignore accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmmaskinputdlg.lblattributes.caption
|
|
msgid "Attri&butes:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaskinputdlg.lblprompt.caption
|
|
msgid "Input Mask:"
|
|
msgstr "Unesi masku:"
|
|
|
|
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
|
msgid "O&r select predefined selection type:"
|
|
msgstr "Ili& odaberi predodređenu vrstu izbora:"
|
|
|
|
#: tfrmmkdir.btncancel.caption
|
|
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "Otkaži&"
|
|
|
|
#: tfrmmkdir.btnok.caption
|
|
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "U redu&"
|
|
|
|
#: tfrmmkdir.caption
|
|
msgid "Create new directory"
|
|
msgstr "Napravi novu fasciklu"
|
|
|
|
#: tfrmmkdir.lblmakedir.caption
|
|
msgid "&Input new directory name:"
|
|
msgstr "Unesite& ime nove fascikle:"
|
|
|
|
#: tfrmmodview.btnpath1.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath2.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath3.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath4.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath5.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.caption
|
|
msgctxt "TFRMMODVIEW.CAPTION"
|
|
msgid "New Size"
|
|
msgstr "Nova veličina"
|
|
|
|
#: tfrmmodview.lblheight.caption
|
|
msgid "Height :"
|
|
msgstr "Visina :"
|
|
|
|
#: tfrmmodview.lblpath1.caption
|
|
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmodview.lblpath2.caption
|
|
msgctxt "tfrmmodview.lblpath2.caption"
|
|
msgid "2"
|
|
msgstr "2"
|
|
|
|
#: tfrmmodview.lblpath3.caption
|
|
msgctxt "tfrmmodview.lblpath3.caption"
|
|
msgid "3"
|
|
msgstr "3"
|
|
|
|
#: tfrmmodview.lblpath4.caption
|
|
msgid "4"
|
|
msgstr "4"
|
|
|
|
#: tfrmmodview.lblpath5.caption
|
|
msgid "5"
|
|
msgstr "5"
|
|
|
|
#: tfrmmodview.lblquality.caption
|
|
msgid "Quality of compress to Jpg"
|
|
msgstr "Kakvoća sažmanosti JPG"
|
|
|
|
#: tfrmmodview.lblwidth.caption
|
|
msgid "Width :"
|
|
msgstr "Širina :"
|
|
|
|
#: tfrmmodview.rbbmp.caption
|
|
msgid "BMP"
|
|
msgstr "BMP"
|
|
|
|
#: tfrmmodview.rbico.caption
|
|
msgid "ICO"
|
|
msgstr "ICO"
|
|
|
|
#: tfrmmodview.rbjpg.caption
|
|
msgid "JPG"
|
|
msgstr "JPG"
|
|
|
|
#: tfrmmodview.rbpng.caption
|
|
msgid "PNG"
|
|
msgstr "PNG"
|
|
|
|
#: tfrmmodview.rbpnm.caption
|
|
msgid "PNM"
|
|
msgstr "PNM"
|
|
|
|
#: tfrmmodview.teheight.text
|
|
msgctxt "tfrmmodview.teheight.text"
|
|
msgid "Height"
|
|
msgstr "Visina"
|
|
|
|
#: tfrmmodview.tequality.text
|
|
msgid "80"
|
|
msgstr "80"
|
|
|
|
#: tfrmmodview.tewidth.text
|
|
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
|
|
msgid "Width"
|
|
msgstr "Širina"
|
|
|
|
#: tfrmmsg.lblmsg.caption
|
|
msgid "456456465465465"
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.btnclose.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "Zatvori&"
|
|
|
|
#: tfrmmultirename.btndeletepreset.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "Izbriši&"
|
|
|
|
#: tfrmmultirename.btnedit.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmultirename.btnedit.caption"
|
|
msgid "&Edit"
|
|
msgstr "Uredi&"
|
|
|
|
#: tfrmmultirename.btnextmenu.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmultirename.btnloadpreset.caption
|
|
msgid "&Load"
|
|
msgstr "Učitaj&"
|
|
|
|
#: tfrmmultirename.btnnamemenu.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmultirename.btnrename.caption
|
|
msgctxt "tfrmmultirename.btnrename.caption"
|
|
msgid "&Rename"
|
|
msgstr "Pre&imenuj"
|
|
|
|
#: tfrmmultirename.btnrestore.caption
|
|
msgid "Reset &all"
|
|
msgstr "Poništi sve&"
|
|
|
|
#: tfrmmultirename.btnsavepreset.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
|
msgid "&Save"
|
|
msgstr "Sačuvaj&"
|
|
|
|
#: tfrmmultirename.caption
|
|
msgctxt "TFRMMULTIRENAME.CAPTION"
|
|
msgid "MultiRename"
|
|
msgstr "Višestruko preimenovanje"
|
|
|
|
#: tfrmmultirename.cblog.caption
|
|
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
|
|
msgid "Ena&ble"
|
|
msgstr "Omogući&"
|
|
|
|
#: tfrmmultirename.cbregexp.caption
|
|
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
|
|
msgid "Regular e&xpressions"
|
|
msgstr "&Regularni izrazi"
|
|
|
|
#: tfrmmultirename.cbusesubs.caption
|
|
msgid "&Use substitution"
|
|
msgstr "Koristi& zamenu"
|
|
|
|
#: tfrmmultirename.cmbxwidth.text
|
|
msgid "01"
|
|
msgstr "01"
|
|
|
|
#: tfrmmultirename.edinterval.text
|
|
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmultirename.edpoc.text
|
|
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmultirename.extension.caption
|
|
msgid "[E] Extension"
|
|
msgstr "[E] nastavak"
|
|
|
|
#: tfrmmultirename.gbcounter.caption
|
|
msgid "Counter"
|
|
msgstr "Brojač"
|
|
|
|
#: tfrmmultirename.gbfindreplace.caption
|
|
msgid "Find && Replace"
|
|
msgstr "Nađi i zameni"
|
|
|
|
#: tfrmmultirename.gblog.caption
|
|
msgid "Log Result"
|
|
msgstr "Izlazi dnevnika"
|
|
|
|
#: tfrmmultirename.gbmaska.caption
|
|
msgid "Mask"
|
|
msgstr "Maska"
|
|
|
|
#: tfrmmultirename.gbpresets.caption
|
|
msgid "Presets"
|
|
msgstr "Obrasci"
|
|
|
|
#: tfrmmultirename.lbext.caption
|
|
msgid "&Extension"
|
|
msgstr "Nastavci&"
|
|
|
|
#: tfrmmultirename.lbfind.caption
|
|
msgid "&Find..."
|
|
msgstr "Pronađi&..."
|
|
|
|
#: tfrmmultirename.lbinterval.caption
|
|
msgid "&Interval"
|
|
msgstr "&Međuvreme"
|
|
|
|
#: tfrmmultirename.lbname.caption
|
|
msgid "File &Name"
|
|
msgstr "Ime datoteke"
|
|
|
|
#: tfrmmultirename.lbreplace.caption
|
|
msgid "Re&place..."
|
|
msgstr "Zameni&..."
|
|
|
|
#: tfrmmultirename.lbstnb.caption
|
|
msgid "S&tart Number"
|
|
msgstr "Početni broj"
|
|
|
|
#: tfrmmultirename.lbwidth.caption
|
|
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
|
|
msgid "&Width"
|
|
msgstr "Širina&"
|
|
|
|
#: tfrmmultirename.micounter.caption
|
|
msgid "[C] Counter"
|
|
msgstr "[C] Brojač"
|
|
|
|
#: tfrmmultirename.miday.caption
|
|
msgid "[D] Day"
|
|
msgstr "[D] dan"
|
|
|
|
#: tfrmmultirename.miday1.caption
|
|
msgid "[DD] Day (2 digits)"
|
|
msgstr "[DD] dan (2 cifre)"
|
|
|
|
#: tfrmmultirename.miday2.caption
|
|
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
|
msgstr "[DDD] dan u nedelji (kratko, npr. „pon“)"
|
|
|
|
#: tfrmmultirename.miday3.caption
|
|
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
|
msgstr "[DDD] dan u nedelji (potpuno, npr. „ponedeljak“)"
|
|
|
|
#: tfrmmultirename.miextensionx.caption
|
|
msgid "[Ex] Character at position x"
|
|
msgstr "[Ex] znak na položaju x"
|
|
|
|
#: tfrmmultirename.miextensionxx.caption
|
|
msgid "[Ex:y] Characters from position x to y"
|
|
msgstr "[Ex:y] znaci od položaja x do položaja y"
|
|
|
|
#: tfrmmultirename.mihour.caption
|
|
msgid "[h] Hour"
|
|
msgstr "[h] čas"
|
|
|
|
#: tfrmmultirename.mihour1.caption
|
|
msgid "[hh] Hour (2 digits)"
|
|
msgstr "[hh] Čas (2 znaka)"
|
|
|
|
#: tfrmmultirename.miminute.caption
|
|
msgid "[n] Minute"
|
|
msgstr "[n] Minut"
|
|
|
|
#: tfrmmultirename.miminute1.caption
|
|
msgid "[nn] Minute (2 digits)"
|
|
msgstr "[nn] Minut (2 znaka)"
|
|
|
|
#: tfrmmultirename.mimonth.caption
|
|
msgid "[M] Month"
|
|
msgstr "[M] Mesec"
|
|
|
|
#: tfrmmultirename.mimonth1.caption
|
|
msgid "[MM] Month (2 digits)"
|
|
msgstr "[MM] Mesec (2 znaka)"
|
|
|
|
#: tfrmmultirename.mimonth2.caption
|
|
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
|
msgstr "[MMM] Ime meseca (kratko, npr., „jan“)"
|
|
|
|
#: tfrmmultirename.mimonth3.caption
|
|
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
|
msgstr "[MMMM] Ime meseca (puno, npr., „januar“)"
|
|
|
|
#: tfrmmultirename.miname.caption
|
|
msgid "[N] Name"
|
|
msgstr "[N] Ime"
|
|
|
|
#: tfrmmultirename.minamex.caption
|
|
msgid "[Nx] Character at position x"
|
|
msgstr "[Nx] znak na položaju x"
|
|
|
|
#: tfrmmultirename.minamexx.caption
|
|
msgid "[Nx:y] Characters from position x to y"
|
|
msgstr "[Nx:y] znaci od položaja x do položaja y"
|
|
|
|
#: tfrmmultirename.minext.caption
|
|
msgid "Time..."
|
|
msgstr "Vreme..."
|
|
|
|
#: tfrmmultirename.minextextension.caption
|
|
msgid "Extension..."
|
|
msgstr "Nastavak..."
|
|
|
|
#: tfrmmultirename.minextname.caption
|
|
msgid "Name..."
|
|
msgstr "Ime..."
|
|
|
|
#: tfrmmultirename.miplugin.caption
|
|
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
|
|
msgid "Plugin"
|
|
msgstr "Priključak"
|
|
|
|
#: tfrmmultirename.misecond.caption
|
|
msgid "[s] Second"
|
|
msgstr "[s] Sekund"
|
|
|
|
#: tfrmmultirename.misecond1.caption
|
|
msgid "[ss] Second (2 digits)"
|
|
msgstr "[ss] Sekund (2 znaka)"
|
|
|
|
#: tfrmmultirename.miyear.caption
|
|
msgid "[Y] Year (2 digits)"
|
|
msgstr "[Y] Godina (2 znaka)"
|
|
|
|
#: tfrmmultirename.miyear1.caption
|
|
msgid "[YYYY] Year (4 digits)"
|
|
msgstr "[YYYY] Godina (4 znaka)"
|
|
|
|
#: tfrmmultirename.mnueditnames.caption
|
|
msgid "Edit names..."
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.mnuloadfromfile.caption
|
|
msgid "Load names from file..."
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.n1.caption
|
|
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n2.caption
|
|
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n3.caption
|
|
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n4.caption
|
|
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n5.caption
|
|
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
|
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION"
|
|
msgid "Old File Name"
|
|
msgstr "Staro ime datoteke"
|
|
|
|
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
|
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION"
|
|
msgid "New File Name"
|
|
msgstr "Novo ime datoteke"
|
|
|
|
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
|
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION"
|
|
msgid "File Path"
|
|
msgstr "Putanja datoteke"
|
|
|
|
#: tfrmmultirenamewait.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmultirenamewait.caption"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmmultirenamewait.lblmessage.caption
|
|
msgid "Click OK when you have closed the editor to load the changed names!"
|
|
msgstr ""
|
|
|
|
#: tfrmopenwith.caption
|
|
msgid "Choose an application"
|
|
msgstr "Izaberite program"
|
|
|
|
#: tfrmopenwith.chkcustomcommand.caption
|
|
msgid "Custom command"
|
|
msgstr "Prilagođena naredba"
|
|
|
|
#: tfrmopenwith.chksaveassociation.caption
|
|
msgid "Save association"
|
|
msgstr "Sačuvaj pridruživanje"
|
|
|
|
#: tfrmopenwith.chkuseasdefault.caption
|
|
msgid "Set selected application as default action"
|
|
msgstr "Postavi izabrani program kao podrazumevani program"
|
|
|
|
#: tfrmopenwith.lblmimetype.caption
|
|
msgid "File type to be opened: %s"
|
|
msgstr "Vrsta datoteke koja će biti otvorena: %s"
|
|
|
|
#: tfrmopenwith.milistoffiles.caption
|
|
msgid "Multiple file names"
|
|
msgstr "Višestruka imena datoteka"
|
|
|
|
#: tfrmopenwith.milistoffiles.hint
|
|
msgid "%F"
|
|
msgstr "%F"
|
|
|
|
#: tfrmopenwith.milistofurls.caption
|
|
msgid "Multiple URIs"
|
|
msgstr "Višestruke adrese"
|
|
|
|
#: tfrmopenwith.milistofurls.hint
|
|
msgid "%U"
|
|
msgstr "%U"
|
|
|
|
#: tfrmopenwith.misinglefilename.caption
|
|
msgid "Single file name"
|
|
msgstr "Jedno ime datoteke"
|
|
|
|
#: tfrmopenwith.misinglefilename.hint
|
|
msgid "%f"
|
|
msgstr "%f"
|
|
|
|
#: tfrmopenwith.misingleurl.caption
|
|
msgid "Single URI"
|
|
msgstr "Jedna adresa"
|
|
|
|
#: tfrmopenwith.misingleurl.hint
|
|
msgid "%u"
|
|
msgstr "%u"
|
|
|
|
#: tfrmoptions.btnapply.caption
|
|
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
|
|
msgid "&Apply"
|
|
msgstr "Primeni&"
|
|
|
|
#: tfrmoptions.btncancel.caption
|
|
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "Otkaži&"
|
|
|
|
#: tfrmoptions.btnok.caption
|
|
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "U redu&"
|
|
|
|
#: tfrmoptions.caption
|
|
msgctxt "TFRMOPTIONS.CAPTION"
|
|
msgid "Options"
|
|
msgstr "Mogućnosti"
|
|
|
|
#: tfrmoptions.lblemptyeditor.caption
|
|
msgid "Please select one of the subpages, this page does not contain any settings."
|
|
msgstr "Izaberite jednu podstranicu, ova stranica ne sadrži ni jednu postavku."
|
|
|
|
#: tfrmoptionsarchivers.btnarchiveradd.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
|
|
msgid "A&dd"
|
|
msgstr "Dodaj&"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverapply.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
|
|
msgid "A&pply"
|
|
msgstr "Primeni&"
|
|
|
|
#: tfrmoptionsarchivers.btnarchivercopy.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchivercopy.caption"
|
|
msgid "Cop&y"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverdelete.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
|
|
msgid "Delete"
|
|
msgstr "Izbriši&"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverother.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverother.caption"
|
|
msgid "Oth&er..."
|
|
msgstr "Ostalo..."
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverrename.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
|
|
msgid "&Rename"
|
|
msgstr "Preimenuj&"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.bvlarchiverids.caption
|
|
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
|
|
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
|
|
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
|
|
msgid "Options:"
|
|
msgstr "Mogućnosti:"
|
|
|
|
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
|
|
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
|
|
msgid "Format parsing mode:"
|
|
msgstr "Način rada raščlanjivanja oblika:"
|
|
|
|
#: tfrmoptionsarchivers.chkarchiverenabled.caption
|
|
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
|
|
msgid "E&nabled"
|
|
msgstr "Omogućen&"
|
|
|
|
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
|
|
msgid "De&bug mode"
|
|
msgstr "Način otklanjanja& grešaka"
|
|
|
|
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
|
|
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
|
|
msgid "S&how console output"
|
|
msgstr "Prikazuj& izlaz iz konzole"
|
|
|
|
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
|
|
msgid "Uni&x file attributes"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
|
|
msgid "&Unix path delimiter \"/\""
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
|
|
msgid "Windows &file attributes"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
|
|
msgid "Windows path deli&miter \"\\\""
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveradd.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
|
|
msgid "Add&ing:"
|
|
msgstr "Dodajem&:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
|
|
msgid "Arc&hiver:"
|
|
msgstr "Program za sažimanje:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverdelete.caption
|
|
msgid "De&lete:"
|
|
msgstr "Izbriši:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverdescription.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
|
|
msgid "De&scription:"
|
|
msgstr "Opis&:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverextension.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
|
|
msgid "E&xtension:"
|
|
msgstr "Nastavci&:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverextract.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
|
|
msgid "Ex&tract:"
|
|
msgstr "Izdvoji&:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
|
|
msgid "Extract &without path:"
|
|
msgstr "Izdvoji bez putanje:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveridposition.caption
|
|
msgid "ID Po&sition:"
|
|
msgstr "Položaj LB:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverids.caption
|
|
msgid "&ID:"
|
|
msgstr "LB:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
|
|
msgid "ID See&k Range:"
|
|
msgstr "Opseg traženja LB:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverlist.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
|
|
msgid "&List:"
|
|
msgstr "Listaj&:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
|
|
msgid "Archi&vers:"
|
|
msgstr "Programi za sažimanje:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverlistend.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
|
|
msgid "Listing &finish (optional):"
|
|
msgstr "Listanje i dovršavanje& (mogućnost):"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
|
|
msgid "Listing for&mat:"
|
|
msgstr "Oblik& listanja:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverliststart.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
|
|
msgid "Listin&g start (optional):"
|
|
msgstr "Početak listanja& (mogućnost):"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
|
|
msgid "Password &query string:"
|
|
msgstr "Niska upita lozinke:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
|
|
msgid "Create self extractin&g archive:"
|
|
msgstr "Obrazuj samoizdvajajuće skladište:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchivertest.caption
|
|
msgid "Tes&t:"
|
|
msgstr "Proba:"
|
|
|
|
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
|
|
msgid "Auto Configure"
|
|
msgstr "Samostalno& podesi"
|
|
|
|
#: tfrmoptionsarchivers.miarchiverdisableall.caption
|
|
msgid "Disable all"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
|
|
msgid "Discard modifications"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.miarchiverenableall.caption
|
|
msgid "Enable all"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.miarchiverexport.caption
|
|
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
|
|
msgid "Export..."
|
|
msgstr "Izvoz..."
|
|
|
|
#: tfrmoptionsarchivers.miarchiverimport.caption
|
|
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
|
|
msgid "Import..."
|
|
msgstr "Uvoz..."
|
|
|
|
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
|
|
msgid "Sort archivers"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
|
|
msgid "Additional"
|
|
msgstr "Dodatno"
|
|
|
|
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
|
|
msgid "General"
|
|
msgstr "Opšte"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
|
|
msgid "When &size, date or attributes change"
|
|
msgstr "Prilikom izmena &veličine, datuma ili svojstava"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
|
|
msgid "For the following &paths and their subdirectories:"
|
|
msgstr "Za sledeće putanje& i njene podfascikle:"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
|
|
msgid "When &files are created, deleted or renamed"
|
|
msgstr "Prilikom stvaranja datoteka, brisanja ili preimenovanja"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
|
|
msgid "When application is in the &background"
|
|
msgstr "Kada je program u pozadini&"
|
|
|
|
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
|
|
msgid "Disable auto-refresh"
|
|
msgstr "Onemogući samostalno osvežavanje"
|
|
|
|
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
|
|
msgid "Refresh file list"
|
|
msgstr "Osveži spisak datoteka"
|
|
|
|
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
|
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
|
|
msgid "Al&ways show tray icon"
|
|
msgstr "Uvek prikazuj ikonu u obaveštajnoj oblasti"
|
|
|
|
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
|
msgid "Automatically &hide unmounted devices"
|
|
msgstr "Samostalno skrivaj& otkačene uređaje"
|
|
|
|
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
|
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
|
|
msgid "Mo&ve icon to system tray when minimized"
|
|
msgstr "Prilikom umanjenja premesti ikonu u obaveštajnu oblast"
|
|
|
|
#: tfrmoptionsbehavior.cbonlyonce.caption
|
|
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
|
|
msgid "A&llow only one copy of DC at a time"
|
|
msgstr "Dozvoli samo jedan primerak DN u isto vreme"
|
|
|
|
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
|
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
|
msgstr "Ovde možete uneti jedan ili veše uređaja ili tačaka kačenja odvajajući ih znacima „;“"
|
|
|
|
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
|
msgid "Drives &blacklist"
|
|
msgstr "Crni spisak uređaja"
|
|
|
|
#: tfrmoptionsbriefview.gbcolumns.caption
|
|
msgid "Columns size"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsbriefview.gbshowfileext.caption
|
|
msgid "Show file extensions"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsbriefview.rbaligned.caption
|
|
msgid "ali&gned (with Tab)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsbriefview.rbdirectly.caption
|
|
msgid "di&rectly after filename"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsbriefview.rbuseautosize.caption
|
|
msgid "Auto"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
|
msgid "Fixed columns count"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
|
msgid "Fixed columns width"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
|
msgid "Cut &text to column width"
|
|
msgstr "Opseci tekst na širinu stupca"
|
|
|
|
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
|
|
msgid "&Extend cell width if text is not fitting into column"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
|
msgid "&Horizontal lines"
|
|
msgstr "Vodoravne& linije"
|
|
|
|
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
|
msgid "&Vertical lines"
|
|
msgstr "Uspravne& linije"
|
|
|
|
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
|
msgid "A&uto fill columns"
|
|
msgstr "Samostalno& popuni stupce"
|
|
|
|
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
|
msgid "Show grid"
|
|
msgstr "Prikazuj mrežu"
|
|
|
|
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
|
msgid "Auto-size columns"
|
|
msgstr "Samostalno uklopi veličinu stubaca"
|
|
|
|
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
|
msgid "Auto si&ze column:"
|
|
msgstr "Samostalno uklopi veličinu stupca:"
|
|
|
|
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "Primeni&"
|
|
|
|
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "Uredi&"
|
|
|
|
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
|
msgid "Co&mmand line history"
|
|
msgstr "Istorija naredbi&"
|
|
|
|
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
|
|
msgid "&Directory history"
|
|
msgstr "Istorija fascikli&"
|
|
|
|
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
|
msgid "&File mask history"
|
|
msgstr "Istorija maski datoteka&"
|
|
|
|
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
|
msgid "Sa&ve configuration"
|
|
msgstr "Sačuvaj& postavke"
|
|
|
|
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
|
msgid "Searc&h/Replace history"
|
|
msgstr "Istorija pretrage& i zamene"
|
|
|
|
#: tfrmoptionsconfiguration.gbdirectories.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
|
|
msgid "Directories"
|
|
msgstr "Fascikle"
|
|
|
|
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
|
msgid "Location of configuration files"
|
|
msgstr "Putanja datoteka postavki"
|
|
|
|
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
|
msgid "Save on exit"
|
|
msgstr "Sačuvaj po izlazu"
|
|
|
|
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
|
msgid "Sort order of configuration order in left tree"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.gpconfigurationtreestate.caption
|
|
msgid "Tree state when entering in configuration page"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
|
msgid "Set on command line"
|
|
msgstr "Uključi naredbenu liniju"
|
|
|
|
#: tfrmoptionsconfiguration.lblhighlighters.caption
|
|
msgid "Highlighters:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.lbliconthemes.caption
|
|
msgid "Icon themes:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.lblthumbcache.caption
|
|
msgid "Thumbnails cache:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
|
msgid "P&rogram directory (portable version)"
|
|
msgstr "Fascikla programa& (prenosno izdanje)"
|
|
|
|
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
|
msgid "&User home directory"
|
|
msgstr "Domaća fascikla korisnika&"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallfont.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallfont.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursortext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
|
|
msgid "&Delete"
|
|
msgstr "&Izbriši"
|
|
|
|
#: tfrmoptionscustomcolumns.btnfont.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
|
msgid "Go to set default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
|
|
msgid "New"
|
|
msgstr "Novo"
|
|
|
|
#: tfrmoptionscustomcolumns.btnnext.caption
|
|
msgid "Next"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnprev.caption
|
|
msgid "Previous"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
|
|
msgid "Rename"
|
|
msgstr "Preimenuj"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
|
|
msgid "Reset to default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
|
|
msgid "Save as"
|
|
msgstr "Sačuvaj kao"
|
|
|
|
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
|
|
msgid "Save"
|
|
msgstr "Sačuvaj"
|
|
|
|
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
|
msgid "Allow Overcolor"
|
|
msgstr "Omogući pojačano bojenje"
|
|
|
|
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
|
msgid "When clicking to change something, change for all columns"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
|
|
msgid "General"
|
|
msgstr "Opšte"
|
|
|
|
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
|
msgid "Cursor border"
|
|
msgstr "Okvir pokazivača"
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
|
msgid "Use Frame Cursor"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
|
msgid "Use Inactive Selection Color"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
|
msgid "Use Inverted Selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
|
msgid "Use custom font and color for this view"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
|
|
msgid "BackGround:"
|
|
msgstr "Pozadina:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
|
|
msgid "Background 2:"
|
|
msgstr "Pozadina 2:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
|
#, fuzzy
|
|
#| msgid "Con&figure columns for file system:"
|
|
msgid "Con&figure columns view:"
|
|
msgstr "Podesi stupce za sistem datoteka:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
|
msgid "[Current Column Name]"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
|
|
msgid "Cursor Color:"
|
|
msgstr "Boja pokazivača:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
|
|
msgid "Cursor Text:"
|
|
msgstr "Pokazivač teksta:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblfontname.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
|
|
msgid "Font:"
|
|
msgstr "Slovni lik:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
|
|
msgid "Size:"
|
|
msgstr "Veličina:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
|
|
msgid "Text Color:"
|
|
msgstr "Boja teksta:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
|
msgid "Inactive Cursor Color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
|
msgid "Inactive Mark Color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
|
|
msgid "Mark Color:"
|
|
msgstr "Boja označavanja:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
|
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
|
msgid "Settings for column:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
|
|
msgid "Add column"
|
|
msgstr "Dodaj stubac"
|
|
|
|
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
|
msgid "Position of frame panel after the comparison:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
|
|
msgid "Add directory of the &active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
|
|
msgid "Add &directories of the active && inactive frames"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
|
|
msgid "Add directory I will bro&wse to"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
|
|
msgid "Add a copy of the selected entry"
|
|
msgstr "Dodaj umnožak označene stavke"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
|
|
msgid "Add current &selected or active directories of active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
|
|
msgid "Add a separator"
|
|
msgstr "Dodaj razdvajač"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
|
|
msgid "Add a sub menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
|
|
msgid "Add directory I will type"
|
|
msgstr "Dodaj fasciklu za kucanje"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
|
|
msgid "Collapse all"
|
|
msgstr "Skupi sve"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
|
|
msgid "Collapse item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcut.caption
|
|
msgid "Cut selection of entries"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
|
|
msgid "Delete all!"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
|
|
msgid "Delete selected item"
|
|
msgstr "Obrišite označenu stavku"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
|
|
msgid "Delete sub-menu and all its elements"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
|
|
msgid "Delete just sub-menu but keep elements"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
|
|
msgid "Expand item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
|
|
msgid "Focus tree window"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
|
|
msgid "Goto first item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
|
|
msgid "Goto last item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
|
|
msgid "Go to next item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
|
|
msgid "Go to previous item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
|
|
msgid "Insert directory of the &active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
|
|
msgid "Insert &directories of the active && inactive frames"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
|
|
msgid "Insert directory I will bro&wse to"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
|
|
msgid "Insert a copy of the selected entry"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
|
|
msgid "Insert current &selected or active directories of active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
|
|
msgid "Insert a separator"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
|
|
msgid "Insert sub menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
|
|
msgid "Insert directory I will type"
|
|
msgstr "Ubaci fasciklu za kucanje"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
|
|
msgid "Move to next"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
|
|
msgid "Move to previous"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
|
|
msgid "Open all branches"
|
|
msgstr "Otvori sve grane"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actpaste.caption
|
|
msgid "Paste what was cut"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
|
|
msgid "Search && replace in &path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
|
|
msgid "Search && replace in both path and target"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
|
|
msgid "Search && replace in &target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
|
|
msgid "Tweak path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
|
|
msgid "Tweak target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
|
msgid "A&dd..."
|
|
msgstr "Dodavanje..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
|
msgid "Bac&kup..."
|
|
msgstr "Ostava..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
|
msgid "De&lete..."
|
|
msgstr "Brisanje..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
|
msgid "E&xport..."
|
|
msgstr "Izvoz..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
|
|
msgid "&Help"
|
|
msgstr "Pomoć"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
|
msgid "Impo&rt..."
|
|
msgstr "Uvoz..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
|
msgid "&Insert..."
|
|
msgstr "Umetanje..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
|
msgid "&Miscellaneous..."
|
|
msgstr "Razno..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVETARGET.HINT"
|
|
msgid "Some functions to select appropriate target"
|
|
msgstr "Neke radnje za odabir odgovarajućeg cilja"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
|
msgid "&Sort..."
|
|
msgstr "Razvrstavanje..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
|
msgid "&When adding directory, add also target"
|
|
msgstr "Prilikom dodavanja fascikle, dodaj i cilj"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
|
msgid "Alwa&ys expand tree"
|
|
msgstr "Uvek širi stablo fascikli"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
|
#, fuzzy,badformat
|
|
#| msgid "Show only valid environment variables"
|
|
msgid "Show only &valid environment variables"
|
|
msgstr "Prikazuj samo ispravne %env_var%"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
|
msgid "In pop&up, show [path also]"
|
|
msgstr "Pri iskačućim prozorima prikaži [i putanju]"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRPATH.TEXT"
|
|
msgid "Name, a-z"
|
|
msgstr "Ime, a-š"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
|
|
msgid "Name, a-z"
|
|
msgstr "Ime, a-š"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
|
msgid "Directory Hotlist (reorder by drag && drop)"
|
|
msgstr "Brzi spisak fascikli (preurediti prevlačenjem i spuštanjem)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
|
msgid "Other options"
|
|
msgstr "Ostale mogućnosti"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
|
|
msgid "Name:"
|
|
msgstr "Ime:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
|
|
msgid "Path:"
|
|
msgstr "Putanja:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRTARGET.EDITLABEL.CAPTION"
|
|
msgid "&Target:"
|
|
msgstr "Cilj:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
|
msgid "...current le&vel of item(s) selected only"
|
|
msgstr "...trenutni stupanj stavki koje su samo označene"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHEXIST.CAPTION"
|
|
msgid "Scan all &hotdir's path to validate the ones that actually exist"
|
|
msgstr "Pretraži sve putanje brzih fascikli radi utvrđivanja koje stvarno postoje"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHTARGETEXIST.CAPTION"
|
|
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
|
|
msgstr "Pretraži sve putanje brzih fascikli i ciljeva radi utvrđivanja koji stvarno postoje"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
|
msgid "to a Directory &Hotlist file (.hotlist)"
|
|
msgstr "u datoteku spiska brzih fascikli (brzi spisak)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
|
|
msgstr "u „wincmd.ini“ TC-a (zadrži postojeće)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
|
|
msgstr "u „wincmd.ini“ TC-a (izbriši postojeće)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
|
msgid "Go to &configure TC related info"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
|
|
msgid "Go to &configure TC related info"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
|
msgid "HotDirTestMenu"
|
|
msgstr "Izbornik probe spiska brzih fascikli"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
|
msgid "from a Directory &Hotlist file (.hotlist)"
|
|
msgstr "iz datoteke brzog spiska fascikli (brzi spisak)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
|
msgid "from \"&wincmd.ini\" of TC"
|
|
msgstr "iz „wincmd.ini“ TC-a"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.minavigate.caption
|
|
msgid "&Navigate..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
|
msgid "&Restore a backup of Directory Hotlist"
|
|
msgstr "Povrati spisak brzih fascikli iz ostave"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
|
msgid "&Save a backup of current Directory Hotlist"
|
|
msgstr "Sačuvaj u ostavu trenutni spisak brzih fascikli"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
|
msgid "Search and &replace..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
|
msgid "...everything, from A to &Z!"
|
|
msgstr "...sve, od A do Š!"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
|
msgid "...single &group of item(s) only"
|
|
msgstr "...pojedinačni skup stavki isključivo"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
|
msgid "...&content of submenu(s) selected, no sublevel"
|
|
msgstr "...sadržaj označenog podizbornika, bez podnivoa"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
|
msgid "...content of submenu(s) selected and &all sublevels"
|
|
msgstr "...sadržaj označenog podizbornika i sve njegove podnivoe"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
|
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MITESTRESULTINGHOTLISTMENU.CAPTION"
|
|
msgid "Test resultin&g menu"
|
|
msgstr "Proveri izlazni izbornik"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
|
|
msgid "Tweak &path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
|
|
msgid "Tweak &target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
|
msgid "Addition from main panel"
|
|
msgstr "Dodatak iz glavne površi:"
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
|
msgid "From all the supported formats, ask which one to use every time"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
|
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
|
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
|
msgid "&Show confirmation dialog after drop"
|
|
msgstr "Prikazuj& prozorče potvrde posle otpuštanja"
|
|
|
|
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
|
msgid "When drag && dropping text into panels:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
|
msgid "Place the most desired format on top of list (use dag && drop):"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
|
msgid "(if the most desired is not present, we'll take second one and so on)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
|
msgid "(will not work with some source application, so try to uncheck if problem)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
|
msgid "Show &file system"
|
|
msgstr "Prikazuj sistem datoteka"
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
|
msgid "Show fr&ee space"
|
|
msgstr "Prikazuj slobodan& prostor"
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
|
msgid "Show &label"
|
|
msgstr "Prikaži natpis&"
|
|
|
|
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
|
msgid "Drives list"
|
|
msgstr "Spisak uređaja"
|
|
|
|
#: tfrmoptionseditor.chkautoindent.caption
|
|
msgid "Auto Indent"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chkautoindent.hint
|
|
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chkscrollpastendline.caption
|
|
msgid "Caret past end of line"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chkscrollpastendline.hint
|
|
msgid "Allows caret to go into empty space beyond end-of-line position"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chkshowspecialchars.caption
|
|
msgid "Show special characters"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chkshowspecialchars.hint
|
|
msgid "Shows special characters for spaces and tabulations"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chksmarttabs.caption
|
|
msgid "Smart Tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chksmarttabs.hint
|
|
msgid "When using <Tab> key, caret will go to the next non-space character of the previous line"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktabindent.caption
|
|
msgid "Tab indents blocks"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktabindent.hint
|
|
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktabstospaces.caption
|
|
msgid "Use spaces instead tab characters"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktabstospaces.hint
|
|
msgid "Converts tab characters to a specified number of space characters (when entering)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktrimtrailingspaces.caption
|
|
msgid "Delete trailing spaces"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktrimtrailingspaces.hint
|
|
msgid "Auto delete trailing spaces, this applies only to edited lines"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.edtabwidth.hint
|
|
msgctxt "tfrmoptionseditor.edtabwidth.hint"
|
|
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.gbinternaleditor.caption
|
|
msgid "Internal editor options"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.lbltabwidth.caption
|
|
msgid "Tab width:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.lbltabwidth.hint
|
|
msgctxt "tfrmoptionseditor.lbltabwidth.hint"
|
|
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
|
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
|
msgid "Bac&kground"
|
|
msgstr "&Pozadina"
|
|
|
|
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
|
msgid "Bac&kground"
|
|
msgstr "&Pozadina"
|
|
|
|
#: tfrmoptionseditorcolors.btnresetmask.hint
|
|
msgid "Reset"
|
|
msgstr "Vrati na podrazumevano"
|
|
|
|
#: tfrmoptionseditorcolors.btnsavemask.hint
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
|
|
msgid "Save"
|
|
msgstr "Sačuvaj"
|
|
|
|
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
|
msgid "Element Attributes"
|
|
msgstr "Svojstva stavke"
|
|
|
|
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
|
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
|
msgid "Fo®round"
|
|
msgstr "Sučelje&"
|
|
|
|
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
|
msgid "Fo®round"
|
|
msgstr "Sučelje&"
|
|
|
|
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
|
msgid "&Text-mark"
|
|
msgstr "Oznaka tekstom&"
|
|
|
|
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
|
msgid "Use (and edit) &global scheme settings"
|
|
msgstr "Koristi (i uredi) opšte& postavke sheme"
|
|
|
|
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
|
msgid "Use &local scheme settings"
|
|
msgstr "Koristi mesne& postavke sheme"
|
|
|
|
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
|
msgid "&Bold"
|
|
msgstr "&Podebljan"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
|
|
msgid "In&vert"
|
|
msgstr "Iz&vrni"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
|
|
msgid "O&ff"
|
|
msgstr "&Isključi"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradioon.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
|
|
msgid "O&n"
|
|
msgstr "Uključi"
|
|
|
|
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
|
msgid "&Italic"
|
|
msgstr "&Iskošeno"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
|
|
msgid "In&vert"
|
|
msgstr "Iz&vrni"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
|
|
msgid "O&ff"
|
|
msgstr "&Isključi"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
|
|
msgid "O&n"
|
|
msgstr "&Uključi"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
|
msgid "&Strike Out"
|
|
msgstr "Pre&crtaj"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
|
|
msgid "In&vert"
|
|
msgstr "Iz&vrni"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
|
|
msgid "O&ff"
|
|
msgstr "&Isključi"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
|
|
msgid "O&n"
|
|
msgstr "U&ključi"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
|
msgid "&Underline"
|
|
msgstr "Podv&učeno"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
|
msgid "In&vert"
|
|
msgstr "Iz&vrni"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
|
msgid "O&ff"
|
|
msgstr "&Isključi"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
|
msgid "O&n"
|
|
msgstr "U&ključi"
|
|
|
|
#: tfrmoptionsfavoritetabs.btnadd.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
|
|
msgid "Add..."
|
|
msgstr "Dodavanje..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btndelete.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
|
|
msgid "Delete..."
|
|
msgstr "Brisanje..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
|
msgid "Import/Export"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.btninsert.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
|
|
msgid "Insert..."
|
|
msgstr "Umetanje..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btnrename.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
|
|
msgid "Rename"
|
|
msgstr "Preimenuj"
|
|
|
|
#: tfrmoptionsfavoritetabs.btnsort.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
|
|
msgid "Sort..."
|
|
msgstr "Razvrstavanje..."
|
|
|
|
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
|
msgid "None"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
|
|
msgid "Always expand tree"
|
|
msgstr "Uvek širi stablo fascikli"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
|
msgid "No"
|
|
msgstr "Ne"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
|
msgid "Left"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
|
msgid "Right"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
|
msgid "Favorite Tabs list (reorder by drag && drop)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
|
|
msgid "Other options"
|
|
msgstr "Ostale mogućnosti"
|
|
|
|
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
|
msgid "What to restore where for the selected entry:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
|
msgid "Existing tabs to keep:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
|
msgid "Save dir history:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
|
msgid "Tabs saved on left to be restored to:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
|
msgid "Tabs saved on right to be restored to:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
|
|
msgid "a separator"
|
|
msgstr "razdvajač"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
|
msgid "Add separator"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
|
|
msgid "sub-menu"
|
|
msgstr "podizbornik"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
|
|
msgid "Add sub-menu"
|
|
msgstr "Dodaj podizbornik"
|
|
|
|
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
|
|
msgid "Collapse all"
|
|
msgstr "Skupi sve"
|
|
|
|
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
|
|
msgid "...current level of item(s) selected only"
|
|
msgstr "...trenutni stupanj stavki koje su samo označene"
|
|
|
|
#: tfrmoptionsfavoritetabs.micutselection.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
|
|
msgid "Cut"
|
|
msgstr "Iseci"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
|
|
msgid "delete all!"
|
|
msgstr "obriši sve!"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
|
|
msgid "sub-menu and all its elements"
|
|
msgstr "podizbornik i svi njegovi činioce"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
|
|
msgid "just sub-menu but keep elements"
|
|
msgstr "samo podizbornik, ali zadrži činioce"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
|
|
msgid "selected item"
|
|
msgstr "označena stavka"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
|
|
msgid "Delete selected item"
|
|
msgstr "Obrišite označenu stavku"
|
|
|
|
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
|
msgid "Export selection to legacy .tab file(s)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
|
msgid "FavoriteTabsTestMenu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
|
msgid "Import legacy .tab file(s) according to default setting"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
|
|
msgid "Import legacy .tab file(s) at selected position"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
|
msgid "Import legacy .tab file(s) at selected position"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
|
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
|
msgid "Insert separator"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
|
msgid "Insert sub-menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
|
|
msgid "Open all branches"
|
|
msgstr "Otvori sve grane"
|
|
|
|
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
|
|
msgid "Paste"
|
|
msgstr "Prilepi"
|
|
|
|
#: tfrmoptionsfavoritetabs.mirename.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
|
|
msgid "Rename"
|
|
msgstr "Preimenuj"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
|
msgid "...everything, from A to Z!"
|
|
msgstr "...sve, od A do Š!"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
|
msgid "...single group of item(s) only"
|
|
msgstr "...pojedinačni skup stavki isključivo"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
|
msgid "Sort single group of item(s) only"
|
|
msgstr "Razvrstaj pojedinačni skup stavki isključivo"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
|
msgid "...content of submenu(s) selected, no sublevel"
|
|
msgstr "...sadržaj označenog podizbornika, bez podnivoa"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
|
msgid "...content of submenu(s) selected and all sublevels"
|
|
msgstr "...sadržaj označenog podizbornika i sve njegove podnivoe"
|
|
|
|
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
|
msgid "Test resulting menu"
|
|
msgstr "Proveri izlazni izbornik"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
|
|
msgid "Add"
|
|
msgstr "Dodaj"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
|
|
msgid "&Add"
|
|
msgstr "Dodaj&"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
|
|
msgid "A&dd"
|
|
msgstr "&Dodaj"
|
|
|
|
#: tfrmoptionsfileassoc.btncloneact.caption
|
|
msgid "Clone"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.btndownact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
|
|
msgid "&Down"
|
|
msgstr "&Dole"
|
|
|
|
#: tfrmoptionsfileassoc.btneditext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
|
|
msgid "Edit"
|
|
msgstr "Uredi"
|
|
|
|
#: tfrmoptionsfileassoc.btninsertact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
|
msgid "Insert"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.btninsertext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
|
|
msgid "Insert"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.btnremoveact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
|
|
msgid "Remo&ve"
|
|
msgstr "Ukloni&"
|
|
|
|
#: tfrmoptionsfileassoc.btnremoveext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
|
|
msgid "Re&move"
|
|
msgstr "Ukloni&"
|
|
|
|
#: tfrmoptionsfileassoc.btnremovetype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
|
|
msgid "&Remove"
|
|
msgstr "Ukloni&"
|
|
|
|
#: tfrmoptionsfileassoc.btnrenametype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
|
msgid "R&ename"
|
|
msgstr "Pre&imenuj"
|
|
|
|
#: tfrmoptionsfileassoc.btnupact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
|
|
msgid "&Up"
|
|
msgstr "&Gore"
|
|
|
|
#: tfrmoptionsfileassoc.destartpath.hint
|
|
msgid "Starting path of the command. Never quote this string."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.edbactionname.hint
|
|
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.edtparams.hint
|
|
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.fnecommand.hint
|
|
msgid "Command to execute. Long filename with space should be quoted."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
|
msgid "Action description:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.gbactions.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
|
msgid "Actions"
|
|
msgstr "Radnje"
|
|
|
|
#: tfrmoptionsfileassoc.gbexts.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
|
|
msgid "Extensions"
|
|
msgstr "Nastavci"
|
|
|
|
#: tfrmoptionsfileassoc.gbexts.hint
|
|
msgid "Can be sorted by drag & drop"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
|
msgid "File types"
|
|
msgstr "Vrste datoteka"
|
|
|
|
#: tfrmoptionsfileassoc.gbicon.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
|
|
msgid "Icon"
|
|
msgstr "Ikonica"
|
|
|
|
#: tfrmoptionsfileassoc.lbactions.hint
|
|
msgid "Actions may be sorted by drag & drop"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.lbexts.hint
|
|
msgid "Extensions may be sorted by drag & drop"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
|
msgid "File types may be sorted by drag & drop"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.lblaction.caption
|
|
#, fuzzy
|
|
#| msgid "Action:"
|
|
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
|
|
msgid "Action name:"
|
|
msgstr "Radnja:"
|
|
|
|
#: tfrmoptionsfileassoc.lblcommand.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
|
|
msgid "&Command:"
|
|
msgstr "&Naredba:"
|
|
|
|
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
|
msgid "Parameter&s:"
|
|
msgstr "Odrednica&:"
|
|
|
|
#: tfrmoptionsfileassoc.lblstartpath.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
|
msgid "Start pat&h:"
|
|
msgstr "Početna &putanja:"
|
|
|
|
#: tfrmoptionsfileassoc.menuitem1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfileassoc.menuitem3.caption
|
|
msgid "Custom with..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.micustom.caption
|
|
msgid "Custom"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.miedit.caption
|
|
msgctxt "tfrmoptionsfileassoc.miedit.caption"
|
|
msgid "Edit"
|
|
msgstr "Uredi"
|
|
|
|
#: tfrmoptionsfileassoc.mieditor.caption
|
|
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
|
|
msgid "Open in Editor"
|
|
msgstr "Otvori u uređivaču"
|
|
|
|
#: tfrmoptionsfileassoc.mieditwith.caption
|
|
msgid "Edit with..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
|
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
|
|
msgid "Get output from command"
|
|
msgstr "Dobavi izlaz iz naredbe"
|
|
|
|
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
|
msgid "Open in Internal Editor"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
|
msgid "Open in Internal Viewer"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.miopen.caption
|
|
msgctxt "tfrmoptionsfileassoc.miopen.caption"
|
|
msgid "Open"
|
|
msgstr "Otvori"
|
|
|
|
#: tfrmoptionsfileassoc.miopenwith.caption
|
|
msgid "Open with..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.miseparator.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfileassoc.mishell.caption
|
|
msgctxt "tfrmoptionsfileassoc.mishell.caption"
|
|
msgid "Run in terminal"
|
|
msgstr "Pokreni u terminalu"
|
|
|
|
#: tfrmoptionsfileassoc.miview.caption
|
|
msgctxt "tfrmoptionsfileassoc.miview.caption"
|
|
msgid "View"
|
|
msgstr "Pregled"
|
|
|
|
#: tfrmoptionsfileassoc.miviewer.caption
|
|
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
|
|
msgid "Open in Viewer"
|
|
msgstr "Otvori u pregledniku"
|
|
|
|
#: tfrmoptionsfileassoc.miviewwith.caption
|
|
msgid "View with..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassoc.sbtnicon.hint
|
|
msgid "Click me to change icon!"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
|
msgid "Execute via shell"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
|
msgid "Extended context menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
|
msgid "File association configuration"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
|
msgid "Offer to add selection to file association when not included already"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
|
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
|
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
|
msgid "Execute via terminal and close"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
|
msgid "Execute via terminal and stay open"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
|
msgid "Extended options items:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
|
|
msgid "Show confirmation window for:"
|
|
msgstr "Prikazuj prozor potvrde za:"
|
|
|
|
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
|
msgid "Cop&y operation"
|
|
msgstr "Umnoži& postupak"
|
|
|
|
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
|
msgid "&Delete operation"
|
|
msgstr "Izbriši& postupak"
|
|
|
|
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
|
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
|
msgstr "Premesti u smeće (dugme shift poništava ovu postavku)"
|
|
|
|
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
|
msgid "D&elete to trash operation"
|
|
msgstr "Radnja slanja u smeće"
|
|
|
|
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
|
|
msgid "D&rop readonly flag"
|
|
msgstr "Poništi oznaku samo za čitanje"
|
|
|
|
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
|
msgid "&Move operation"
|
|
msgstr "Radnja premeštanja&"
|
|
|
|
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
|
msgid "&Process comments with files/folders"
|
|
msgstr "&Obrađuj napomene sa datotekama i fasciklama"
|
|
|
|
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
|
msgid "Select &file name without extension when renaming"
|
|
msgstr "Označi ime datoteke& bez nastavka prilikom preimenovanja"
|
|
|
|
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
|
msgid "Sho&w tab select panel in copy/move dialog"
|
|
msgstr "Prikazuj karticu površi odabira u prozoru za umnožavanje premeštanje"
|
|
|
|
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
|
msgid "S&kip file operations errors and write them to log window"
|
|
msgstr "Zanemari greške radnji nad datotekama i upisuj ih u prozoru dnevnika"
|
|
|
|
#: tfrmoptionsfileoperations.cbverifychecksumconfirmation.caption
|
|
msgid "Verify checksum operation"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
|
msgid "Executing operations"
|
|
msgstr "Izvršavanje radnji"
|
|
|
|
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
|
msgid "User interface"
|
|
msgstr "Korisničko sučelje"
|
|
|
|
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
|
msgid "&Buffer size for file operations (in KB):"
|
|
msgstr "Veličina ostave za radnje nad datotekama (u KB):"
|
|
|
|
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
|
msgid "Buffer size for &hash calculation (in KB):"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
|
msgid "Show operations progress &initially in"
|
|
msgstr "Prikazuj početni napredak radnji u"
|
|
|
|
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
|
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
|
|
msgid "Duplicated name auto-rename style:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
|
msgid "&Number of wipe passes:"
|
|
msgstr "Broj prolaza potpunog brisanja:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
|
msgid "Reset to DC default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
|
|
msgid "Allow Overcolor"
|
|
msgstr "Omogući pojačano bojenje"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
|
msgid "Use &Frame Cursor"
|
|
msgstr "Koristi trepćući pokazivač"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
|
msgid "Use &Gradient Indicator"
|
|
msgstr "Koristi ukazivač sa prelivom"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
|
msgid "Use Inactive Sel Color"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
|
msgid "U&se Inverted Selection"
|
|
msgstr "Koristi obrnuti odabir"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
|
|
msgid "Cursor border"
|
|
msgstr "Okvir pokazivača"
|
|
|
|
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
|
|
msgid "Drive Free Space Indicator"
|
|
msgstr "Ukazivač slobodnog mesta na uređajima"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
|
msgid "Bac&kground:"
|
|
msgstr "P&ozadina:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
|
|
msgid "Backg&round 2:"
|
|
msgstr "P&ozadina 2:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
|
|
msgid "C&ursor Color:"
|
|
msgstr "Boja pokazivača&:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
|
|
msgid "Cursor Te&xt:"
|
|
msgstr "Pokazivač teksta&:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
|
|
msgid "Inactive Cursor Color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
|
|
msgid "Inactive Mark Color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
|
msgid "&Brightness level of inactive panel"
|
|
msgstr "Osvetljenje neradne kartice"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
|
msgid "In&dicator Back Color:"
|
|
msgstr "Pozadinska boja &ukazivača:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
|
msgid "&Indicator Fore Color:"
|
|
msgstr "Čeona boja &ukazivača:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
|
|
msgid "&Mark Color:"
|
|
msgstr "Boja označavanja&:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
|
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
|
|
msgid "T&ext Color:"
|
|
msgstr "Boja teksta&"
|
|
|
|
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
|
msgid "When launching file search, clear file mask filter"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
|
msgid "&Search for part of file name"
|
|
msgstr "Pretraga& po delu imena datoteke"
|
|
|
|
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
|
msgid "Show menu bar in \"Find files\""
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
|
msgid "Text search in files"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
|
|
msgid "File search"
|
|
msgstr "Pretraga datoteka"
|
|
|
|
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
|
msgid "Current filters with \"New search\" button:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
|
msgid "Default search template:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
|
msgid "Use memory mapping for search te&xt in files"
|
|
msgstr "Koristi kartu memorije za pretrage po tekstovima"
|
|
|
|
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
|
msgid "&Use stream for search text in files"
|
|
msgstr "Koristi tok za pretrage po tekstovima"
|
|
|
|
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "Dodaj&"
|
|
|
|
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
|
|
msgid "&Help"
|
|
msgstr "&Pomoć"
|
|
|
|
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
|
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
|
msgid "Do&n't load file list until a tab is activated"
|
|
msgstr "Nemoj da učitavaš spisak datoteka dok se kartica ne pokrene"
|
|
|
|
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
|
msgid "S&how square brackets around directories"
|
|
msgstr "Prikazuj& uglaste zagrade oko fascikli"
|
|
|
|
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
|
msgid "Hi&ghlight new and updated files"
|
|
msgstr "Istakni& nove i osvežene datoteke"
|
|
|
|
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
|
msgid "Enable inplace &renaming when clicking twice on a name"
|
|
msgstr "Omogući &preimenovanje na mestu pri dvokliku na ime"
|
|
|
|
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
|
|
msgid "Load &file list in separate thread"
|
|
msgstr "Učitaj spisak &datoteka u posebnom procesu"
|
|
|
|
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
|
|
msgid "Load icons af&ter file list"
|
|
msgstr "Učitavaj ikone nakon& spiska datoteka"
|
|
|
|
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
|
|
msgid "Show s&ystem and hidden files"
|
|
msgstr "Prikaži sistemske i skrivene datoteke"
|
|
|
|
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
|
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
|
msgstr "Prilikom odabira datoteka pomoću <SPACEBAR>, pređi na sledeću datoteku ( kao i sa <INSERT>)"
|
|
|
|
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
|
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
|
|
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
|
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
|
|
msgid "Use an independent attribute filter in mask input dialog each time"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.gbformatting.caption
|
|
msgid "Formatting"
|
|
msgstr "Oblikujem"
|
|
|
|
#: tfrmoptionsfilesviews.gbmarking.caption
|
|
msgid "Marking/Unmarking entries"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.gbsorting.caption
|
|
msgid "Sorting"
|
|
msgstr "Ređanje"
|
|
|
|
#: tfrmoptionsfilesviews.lbattributemask.caption
|
|
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
|
|
msgid "Default attribute mask value to use:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
|
msgid "Case s&ensitivity:"
|
|
msgstr "Osetljivo na &veličinu slova"
|
|
|
|
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
|
msgid "Incorrect format"
|
|
msgstr "Neispravan oblik"
|
|
|
|
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
|
msgid "&Date and time format:"
|
|
msgstr "Oblik datuma i vremena:"
|
|
|
|
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
|
msgid "File si&ze format:"
|
|
msgstr "Oblik veličine& datoteka:"
|
|
|
|
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
|
msgid "&Insert new files:"
|
|
msgstr "Umetni& nove datoteke:"
|
|
|
|
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
|
msgid "So&rting directories:"
|
|
msgstr "Raspored fascikli:"
|
|
|
|
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
|
msgid "&Sort method:"
|
|
msgstr "Način raspoređivanja:"
|
|
|
|
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
|
msgid "&Move updated files:"
|
|
msgstr "&Premesti osvežene datoteke:"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "&Dodaj"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "Primeni&"
|
|
|
|
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
|
msgid "D&elete"
|
|
msgstr "&Obriši"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
|
msgid "Template..."
|
|
msgstr "Obrazac..."
|
|
|
|
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
|
msgid "File types colors (sort by drag&&drop)"
|
|
msgstr "Boje vrsta datoteka (rasporedite ih povlačenjem i &spuštanjem)"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
|
msgid "Category a&ttributes:"
|
|
msgstr "Svojstva& vrste:"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
|
msgid "Category co&lor:"
|
|
msgstr "Boja vrste&:"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
|
msgid "Category &mask:"
|
|
msgstr "Maska vrste&:"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
|
|
msgid "Category &name:"
|
|
msgstr "Ime &vrste:"
|
|
|
|
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnseleditfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnsellogfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselmainfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselviewfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.lblconsolefont.caption
|
|
msgid "&Console font"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfonts.lbleditorfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
|
|
msgid "&Editor font"
|
|
msgstr "Slovni lik uređivača"
|
|
|
|
#: tfrmoptionsfonts.lbllogfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
|
|
msgid "&Log font"
|
|
msgstr "Slovni lik dnevnika&"
|
|
|
|
#: tfrmoptionsfonts.lblmainfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
|
|
msgid "Main &font"
|
|
msgstr "Glavni slovni lik&"
|
|
|
|
#: tfrmoptionsfonts.lblpatheditfont.caption
|
|
msgid "Path font"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
|
msgid "Search results font"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
|
|
msgid "Viewer&Book Font"
|
|
msgstr "Slovni lik preglednika& knjiga"
|
|
|
|
#: tfrmoptionsfonts.lblviewerfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
|
|
msgid "&Viewer font"
|
|
msgstr "Slovni lik preglednika&"
|
|
|
|
#: tfrmoptionshotkeys.actaddhotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
|
|
msgid "Add &hotkey"
|
|
msgstr "Dodaj prečicu&"
|
|
|
|
#: tfrmoptionshotkeys.actcopy.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actcopy.caption"
|
|
msgid "Copy"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmoptionshotkeys.actdelete.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actdelete.caption"
|
|
msgid "Delete"
|
|
msgstr "Obriši"
|
|
|
|
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
|
|
msgid "&Delete hotkey"
|
|
msgstr "Izbriši& prečicu"
|
|
|
|
#: tfrmoptionshotkeys.actedithotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
|
|
msgid "&Edit hotkey"
|
|
msgstr "Uredi& prečicu"
|
|
|
|
#: tfrmoptionshotkeys.actnextcategory.caption
|
|
msgid "Next category"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
|
msgid "Make popup the file related menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
|
msgid "Previous category"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actrename.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actrename.caption"
|
|
msgid "Rename"
|
|
msgstr "Preimenuj"
|
|
|
|
#: tfrmoptionshotkeys.actrestoredefault.caption
|
|
msgid "Restore DC default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsavenow.caption
|
|
msgid "Save now"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbycommand.caption
|
|
msgid "Sort by command name"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
|
msgid "Sort by hotkeys (grouped)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
|
msgid "Sort by hotkeys (one per row)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.lbfilter.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
|
|
msgid "&Filter"
|
|
msgstr "Propusnik&"
|
|
|
|
#: tfrmoptionshotkeys.lblcategories.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION"
|
|
msgid "C&ategories:"
|
|
msgstr "Vrste&:"
|
|
|
|
#: tfrmoptionshotkeys.lblcommands.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION"
|
|
msgid "Co&mmands:"
|
|
msgstr "Naredbe&:"
|
|
|
|
#: tfrmoptionshotkeys.lblscfiles.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
|
|
msgid "&Shortcut files:"
|
|
msgstr "Datoteke prečica&:"
|
|
|
|
#: tfrmoptionshotkeys.lblsortorder.caption
|
|
msgid "So&rt order:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.micategories.caption
|
|
msgid "Categories"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.micommands.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.micommands.caption"
|
|
msgid "Command"
|
|
msgstr "Naredba"
|
|
|
|
#: tfrmoptionshotkeys.miseparator1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionshotkeys.misortorder.caption
|
|
msgid "Sort order"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.cbiconsexclude.caption
|
|
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
|
msgid "For the following &paths and their subdirectories:"
|
|
msgstr "Za sledeće &putanje i njihove podfascikle:"
|
|
|
|
#: tfrmoptionsicons.cbiconsinmenus.caption
|
|
msgid "Show icons for actions in &menus"
|
|
msgstr "Prikazuj ikonice radnji u izbornicima&"
|
|
|
|
#: tfrmoptionsicons.cbiconsinmenussize.text
|
|
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
|
|
msgid "16x16"
|
|
msgstr "16x16"
|
|
|
|
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
|
msgid "Show icons on buttons"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
|
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
|
|
msgid "Show o&verlay icons, e.g. for links"
|
|
msgstr "Prikazuj preklapajuće& ikonice, npr. za veze"
|
|
|
|
#: tfrmoptionsicons.chkshowhiddendimmed.caption
|
|
msgid "&Dimmed hidden files (slower)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
|
msgid "Disable special icons"
|
|
msgstr "Onemogući naročite ikonice"
|
|
|
|
#: tfrmoptionsicons.gbiconssize.caption
|
|
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
|
|
msgid " Icon size "
|
|
msgstr " Veličina ikonica"
|
|
|
|
#: tfrmoptionsicons.gbicontheme.caption
|
|
msgid "Icon theme"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.gbshowicons.caption
|
|
msgid "Show icons"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.gbshowiconsmode.caption
|
|
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
|
|
msgid " Show icons to the left of the filename "
|
|
msgstr " Prikazuj ikonice levo od imena datoteka"
|
|
|
|
#: tfrmoptionsicons.lbldiskpanel.caption
|
|
msgid "Disk panel:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.lblfilepanel.caption
|
|
msgid "File panel:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.rbiconsshowall.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
|
msgid "A&ll"
|
|
msgstr "Sve&"
|
|
|
|
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
|
|
msgid "All associated + &EXE/LNK (slow)"
|
|
msgstr "Sve povezane + &EXE/LNK (sporo)"
|
|
|
|
#: tfrmoptionsicons.rbiconsshownone.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
|
|
msgid "&No icons"
|
|
msgstr "Bez& ikonica"
|
|
|
|
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
|
|
msgid "Only &standard icons"
|
|
msgstr "Samo &uobičajene ikonice"
|
|
|
|
#: tfrmoptionsignorelist.btnaddsel.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
|
|
msgid "A&dd selected names"
|
|
msgstr "Dodaj& označena imena"
|
|
|
|
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
|
|
msgid "Add selected names with &full path"
|
|
msgstr "Dodaj označena imena sa &potpunim putanjama"
|
|
|
|
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmoptionsignorelist.chkignoreenable.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
|
|
msgid "&Ignore (don't show) the following files and folders:"
|
|
msgstr "Zanemari& (ne prikazuj) sledeće datoteke i fascikle:"
|
|
|
|
#: tfrmoptionsignorelist.lblsavein.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
|
|
msgid "&Save in:"
|
|
msgstr "&Sačuvaj u:"
|
|
|
|
#: tfrmoptionskeyboard.cblynxlike.caption
|
|
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
|
msgstr "Leva& i desna strelica menja fasciklu (kretanje kao u Linksu)"
|
|
|
|
#: tfrmoptionskeyboard.gbtyping.caption
|
|
msgid "Typing"
|
|
msgstr "Kucanje"
|
|
|
|
#: tfrmoptionskeyboard.lblalt.caption
|
|
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
|
|
msgid "Alt+L&etters:"
|
|
msgstr "Menja+slova&:"
|
|
|
|
#: tfrmoptionskeyboard.lblctrlalt.caption
|
|
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
|
|
msgid "Ctrl+Alt+Le&tters:"
|
|
msgstr "Ktrl+menja+slova:"
|
|
|
|
#: tfrmoptionskeyboard.lblnomodifier.caption
|
|
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
|
|
msgid "&Letters:"
|
|
msgstr "&Slova:"
|
|
|
|
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
|
|
msgid "&Flat buttons"
|
|
msgstr "Ravna& dugmad"
|
|
|
|
#: tfrmoptionslayout.cbflatinterface.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
|
|
msgid "Flat i&nterface"
|
|
msgstr "Ravno &sučelje"
|
|
|
|
#: tfrmoptionslayout.cbflattoolbar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
|
|
msgid "Flat b&uttons"
|
|
msgstr "Ravna dugmad&"
|
|
|
|
#: tfrmoptionslayout.cbfreespaceind.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
|
|
msgid "Show fr&ee space indicator on drive label"
|
|
msgstr "Prikazuj ukazivač slobodnog prostora na natpisu uređaja"
|
|
|
|
#: tfrmoptionslayout.cblogwindow.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
|
|
msgid "Show lo&g window"
|
|
msgstr "Prikazuj prozor dnevnika&"
|
|
|
|
#: tfrmoptionslayout.cbpanelofoperations.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
|
|
msgid "Show panel of operation in background"
|
|
msgstr "Prikazuj površ radnje iz pozadine"
|
|
|
|
#: tfrmoptionslayout.cbproginmenubar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
|
|
msgid "Show common progress in menu bar"
|
|
msgstr "Prikazuj uobičajeni napredak u traci izbornika"
|
|
|
|
#: tfrmoptionslayout.cbshowcmdline.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
|
|
msgid "Show command l&ine"
|
|
msgstr "Prikazuj naredbenu liniju&"
|
|
|
|
#: tfrmoptionslayout.cbshowcurdir.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
|
|
msgid "Show current director&y"
|
|
msgstr "Prikazuj trenutnu fasciklu"
|
|
|
|
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
|
|
msgid "Show &drive buttons"
|
|
msgstr "Prikazuj dugmiće uređaja&"
|
|
|
|
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
|
|
msgid "Show free s&pace label"
|
|
msgstr "Prikazuj natpis slobodnog prostora&"
|
|
|
|
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
|
msgid "Show drives list bu&tton"
|
|
msgstr "Prikazuj dugme spiska uređaja"
|
|
|
|
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
|
|
msgid "Show function &key buttons"
|
|
msgstr "Prikazuj dugmiće radnji"
|
|
|
|
#: tfrmoptionslayout.cbshowmainmenu.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
|
|
msgid "Show &main menu"
|
|
msgstr "Prikazuj glavni& izbornik"
|
|
|
|
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
|
#, fuzzy
|
|
#| msgid "Show &button bar"
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
|
|
msgid "Show tool&bar"
|
|
msgstr "Prikazuj traku dugmadi"
|
|
|
|
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
|
msgid "Show short free space &label"
|
|
msgstr "Prikazuj natpis malog slobodnog prostora"
|
|
|
|
#: tfrmoptionslayout.cbshowstatusbar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
|
|
msgid "Show &status bar"
|
|
msgstr "Prikazuj traku stanja&"
|
|
|
|
#: tfrmoptionslayout.cbshowtabheader.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
|
|
msgid "S&how tabstop header"
|
|
msgstr "Prikazuj& zaglavlje kartice za zaustavljanje"
|
|
|
|
#: tfrmoptionslayout.cbshowtabs.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
|
|
msgid "Sho&w folder tabs"
|
|
msgstr "Prikazuj kartice fascikle"
|
|
|
|
#: tfrmoptionslayout.cbtermwindow.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
|
|
msgid "Show te&rminal window"
|
|
msgstr "Prikazuj prozor terminala&"
|
|
|
|
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
|
|
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
|
msgstr "Prikazuj dve trake dugmadi uređaja (stalne širine, iznad prozora)"
|
|
|
|
#: tfrmoptionslayout.gbscreenlayout.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
|
|
msgid " Screen layout "
|
|
msgstr "Raspored na ekranu"
|
|
|
|
#: tfrmoptionslog.btnrelativelogfile.hint
|
|
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmoptionslog.btnviewlogfile.hint
|
|
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
|
msgid "View log file content"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
|
msgid "Include date in log filename"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionslog.cblogarcop.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
|
|
msgid "&Pack/Unpack"
|
|
msgstr "&Sažmi/izvuci"
|
|
|
|
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
|
msgid "External command line execution"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionslog.cblogcpmvln.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
|
|
msgid "Cop&y/Move/Create link/symlink"
|
|
msgstr "Umnoži/premesti/napravi vezu/simboličku vezu"
|
|
|
|
#: tfrmoptionslog.cblogdelete.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Izbriši"
|
|
|
|
#: tfrmoptionslog.cblogdirop.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
|
|
msgid "Crea&te/Delete directories"
|
|
msgstr "&Napravi/Izbriši fascikle"
|
|
|
|
#: tfrmoptionslog.cblogerrors.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
|
|
msgid "Log &errors"
|
|
msgstr "Dnevnik grešaka"
|
|
|
|
#: tfrmoptionslog.cblogfile.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
|
|
msgid "C&reate a log file:"
|
|
msgstr "Napravi& datoteku dnevnika:"
|
|
|
|
#: tfrmoptionslog.cbloginfo.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
|
|
msgid "Log &information messages"
|
|
msgstr "Unosi u dnevnik poruke podataka&"
|
|
|
|
#: tfrmoptionslog.cblogstartshutdown.caption
|
|
msgid "Start/shutdown"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionslog.cblogsuccess.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
|
|
msgid "Log &successful operations"
|
|
msgstr "Unosi u dnevnik uspešne& radnje"
|
|
|
|
#: tfrmoptionslog.cblogvfs.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
|
|
msgid "&File system plugins"
|
|
msgstr "Priključci &sistema datoteka"
|
|
|
|
#: tfrmoptionslog.gblogfile.caption
|
|
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
|
|
msgid "File operation log file"
|
|
msgstr "Datoteka dnevnika radnji nad datotekama"
|
|
|
|
#: tfrmoptionslog.gblogfileop.caption
|
|
msgid "Log operations"
|
|
msgstr "Upisuj radnje u dnevnik"
|
|
|
|
#: tfrmoptionslog.gblogfilestatus.caption
|
|
msgid "Operation status"
|
|
msgstr "Stanje radnje"
|
|
|
|
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
|
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
|
msgid "&Remove thumbnails for no longer existing files"
|
|
msgstr "&Ukloni umanjene sličice nepostojećih datoteka"
|
|
|
|
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
|
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
|
|
msgid "View log file content"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
|
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
|
|
msgid "Create new with the encoding:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.chkgotoroot.caption
|
|
msgid "Always &go to the root of a drive when changing drives"
|
|
msgstr "Uvek idi u& koren uređaja prilikom menjanja uređaja"
|
|
|
|
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
|
msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION"
|
|
msgid "Show &warning messages (\"OK\" button only)"
|
|
msgstr "Prikazuj poruke upozorenja (samo dugme „U redu“)"
|
|
|
|
#: tfrmoptionsmisc.chkthumbsave.caption
|
|
msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION"
|
|
msgid "&Save thumbnails in cache"
|
|
msgstr "&Čuvaj umanjene sličice u ostavi"
|
|
|
|
#: tfrmoptionsmisc.dblthumbnails.caption
|
|
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
|
|
msgid "Thumbnails"
|
|
msgstr "Umanjene sličice"
|
|
|
|
#: tfrmoptionsmisc.gbfilecomments.caption
|
|
msgid "File comments (descript.ion)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.gbtcexportimport.caption
|
|
msgid "Regarding TC export/import:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
|
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
|
|
msgid "Default encoding:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.lbltcconfig.caption
|
|
msgid "Configuration file:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.lbltcexecutable.caption
|
|
msgid "TC executable:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
|
msgid "Toolbar output path:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.lblthumbpixels.caption
|
|
msgid "pixels"
|
|
msgstr "tačke"
|
|
|
|
#: tfrmoptionsmisc.lblthumbseparator.caption
|
|
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
|
|
msgid "X"
|
|
msgstr "H"
|
|
|
|
#: tfrmoptionsmisc.lblthumbsize.caption
|
|
msgid "&Thumbnail size:"
|
|
msgstr "Veličina &umanjenih sličica:"
|
|
|
|
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
|
msgid "&Selection by mouse"
|
|
msgstr "&Odabir mišem"
|
|
|
|
#: tfrmoptionsmouse.chkcursornofollow.caption
|
|
msgid "The text cursor no longer follows the mouse cursor"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
|
|
msgid "By clic&king on icon"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmouse.gbopenwith.caption
|
|
msgctxt "tfrmoptionsmouse.gbopenwith.caption"
|
|
msgid "Open with"
|
|
msgstr "Otvori sa"
|
|
|
|
#: tfrmoptionsmouse.gbscrolling.caption
|
|
msgid "Scrolling"
|
|
msgstr "Klizanje"
|
|
|
|
#: tfrmoptionsmouse.gbselection.caption
|
|
msgid "Selection"
|
|
msgstr "Izbor"
|
|
|
|
#: tfrmoptionsmouse.lblmousemode.caption
|
|
msgid "&Mode:"
|
|
msgstr "&Način:"
|
|
|
|
#: tfrmoptionsmouse.rbdoubleclick.caption
|
|
msgid "Double click"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
|
msgid "&Line by line"
|
|
msgstr "&Linija po linija"
|
|
|
|
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
|
msgid "Line by line &with cursor movement"
|
|
msgstr "Linija po linija &sa pomeranjem pokazivača"
|
|
|
|
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
|
msgid "&Page by page"
|
|
msgstr "&Stranica po stranica"
|
|
|
|
#: tfrmoptionsmouse.rbsingleclickboth.caption
|
|
msgid "Single click (opens files and folders)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmouse.rbsingleclickfolders.caption
|
|
msgid "Single click (opens folders, double click for files)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionspluginsbase.btnaddplugin.caption
|
|
msgctxt "tfrmoptionspluginsbase.btnaddplugin.caption"
|
|
msgid "A&dd"
|
|
msgstr "D&odaj"
|
|
|
|
#: tfrmoptionspluginsbase.btnconfigplugin.caption
|
|
msgctxt "tfrmoptionspluginsbase.btnconfigplugin.caption"
|
|
msgid "Con&figure"
|
|
msgstr "Podesi&"
|
|
|
|
#: tfrmoptionspluginsbase.btnenableplugin.caption
|
|
msgctxt "tfrmoptionspluginsbase.btnenableplugin.caption"
|
|
msgid "E&nable"
|
|
msgstr "&Omogući"
|
|
|
|
#: tfrmoptionspluginsbase.btnremoveplugin.caption
|
|
msgctxt "tfrmoptionspluginsbase.btnremoveplugin.caption"
|
|
msgid "&Remove"
|
|
msgstr "Ukloni&"
|
|
|
|
#: tfrmoptionspluginsbase.btntweakplugin.caption
|
|
msgctxt "tfrmoptionspluginsbase.btntweakplugin.caption"
|
|
msgid "&Tweak"
|
|
msgstr "&Lickaj"
|
|
|
|
#: tfrmoptionspluginsbase.lblplugindescription.caption
|
|
msgctxt "tfrmoptionspluginsbase.lblplugindescription.caption"
|
|
msgid "Description"
|
|
msgstr "Opis"
|
|
|
|
#: tfrmoptionspluginsbase.stgplugins.columns[0].title.caption
|
|
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[0].title.caption"
|
|
msgid "Active"
|
|
msgstr "Radno"
|
|
|
|
#: tfrmoptionspluginsbase.stgplugins.columns[1].title.caption
|
|
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[1].title.caption"
|
|
msgid "Plugin"
|
|
msgstr "Priključak"
|
|
|
|
#: tfrmoptionspluginsbase.stgplugins.columns[2].title.caption
|
|
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[2].title.caption"
|
|
msgid "Registered for"
|
|
msgstr "Prijavljeno za"
|
|
|
|
#: tfrmoptionspluginsbase.stgplugins.columns[3].title.caption
|
|
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[3].title.caption"
|
|
msgid "File name"
|
|
msgstr "Ime datoteke"
|
|
|
|
#: tfrmoptionspluginsdsx.lblplugindescription.caption
|
|
msgctxt "tfrmoptionspluginsdsx.lblplugindescription.caption"
|
|
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
|
msgstr "Priključci &pretrage omogućuju zamenske algoritme pretrage, ili spoljne alate (kao što je „locate“, itd.)"
|
|
|
|
#: tfrmoptionspluginsgroup.btnpathtoberelativetoall.caption
|
|
msgid "Apply current settings to all current configured plugins"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionspluginsgroup.ckbautotweak.caption
|
|
msgid "When adding a new plugin, automatically go in tweak window"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionspluginsgroup.gbconfiguration.caption
|
|
msgid "Configuration:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionspluginsgroup.lbpathtoberelativeto.caption
|
|
msgid "Path to be relative to:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionspluginsgroup.lbpluginfilenamestyle.caption
|
|
msgid "Plugin filename style when adding a new plugin:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionspluginswcx.lblplugindescription.caption
|
|
msgctxt "tfrmoptionspluginswcx.lblplugindescription.caption"
|
|
msgid "Pack&er plugins are used to work with archives"
|
|
msgstr "Priključci za sažimanje se upotrebljavaju za rad sa arhivama"
|
|
|
|
#: tfrmoptionspluginswcx.stgplugins.columns[0].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[0].title.caption"
|
|
msgid "Active"
|
|
msgstr "Radni"
|
|
|
|
#: tfrmoptionspluginswcx.stgplugins.columns[1].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[1].title.caption"
|
|
msgid "Plugin"
|
|
msgstr "Priključak"
|
|
|
|
#: tfrmoptionspluginswcx.stgplugins.columns[2].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[2].title.caption"
|
|
msgid "Registered for"
|
|
msgstr "Prijavljeno za"
|
|
|
|
#: tfrmoptionspluginswcx.stgplugins.columns[3].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[3].title.caption"
|
|
msgid "File name"
|
|
msgstr "Ime datoteke"
|
|
|
|
#: tfrmoptionspluginswdx.lblplugindescription.caption
|
|
msgctxt "tfrmoptionspluginswdx.lblplugindescription.caption"
|
|
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
|
msgstr "Priključci za sadržaje se upotrebljavaju za proširenje prikaza pojedinosti datoteka kao što su mp3 oznake ili svojstva slika u spiskovima datoteka, ili se koriste u priključcima pretrage i alatima za višestruko preimanovanje"
|
|
|
|
#: tfrmoptionspluginswfx.lblplugindescription.caption
|
|
msgctxt "tfrmoptionspluginswfx.lblplugindescription.caption"
|
|
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
|
msgstr "Priključci sistema datoteka& omogućavaju pristup radnjama sa diskovima koje nisu dostupne iz operativnog sistema ili spoljnjim uređajima ko što su Palm i džepni računar."
|
|
|
|
#: tfrmoptionspluginswlx.lblplugindescription.caption
|
|
msgctxt "tfrmoptionspluginswlx.lblplugindescription.caption"
|
|
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
|
msgstr "Priključci za pregled omogućavaju prikaz oblika datoteka kao što su slike, tabele, baze podataka itd. u pregledniku (F3, Ktrl+Ku)"
|
|
|
|
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
|
|
msgid "&Beginning (name must start with first typed character)"
|
|
msgstr "&Počinje sa (ime mora da počinje prvim otkucanim znakom)"
|
|
|
|
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
|
|
msgid "En&ding (last character before a typed dot . must match)"
|
|
msgstr "&Završava se sa (poslednji znak pre otkucane tačke . mora da se poklapa)"
|
|
|
|
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
|
msgid "Options"
|
|
msgstr "Mogućnosti"
|
|
|
|
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
|
msgid "Exact name match"
|
|
msgstr "Potpuno slaganje imena"
|
|
|
|
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
|
msgid "Search case"
|
|
msgstr "Veličina slova pretrage"
|
|
|
|
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
|
msgid "Search for these items"
|
|
msgstr "Traži ove stavke"
|
|
|
|
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
|
msgid "Keep renamed name when unlocking a tab"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
|
|
msgid "Activate target &panel when clicking on one of its Tabs"
|
|
msgstr "Pokreni ciljnu površ& pri kliku na jednu od njenih kartica"
|
|
|
|
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
|
|
msgid "&Show tab header also when there is only one tab"
|
|
msgstr "&Prikaži i zaglavlje kartice kada se prikazuje samo jedna kartica"
|
|
|
|
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
|
msgid "Close duplicate tabs when closing application"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
|
|
msgid "Con&firm close all tabs"
|
|
msgstr "&Potvrdi zatvaranje svih kartica"
|
|
|
|
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
|
msgid "Confirm close locked tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabs.cbtabslimitoption.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
|
|
msgid "&Limit tab title length to"
|
|
msgstr "&Ograniči dužinu naslova kartice na"
|
|
|
|
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
|
|
msgid "Show locked tabs &with an asterisk *"
|
|
msgstr "Prikazuj zaključane kartice &sa znakom *"
|
|
|
|
#: tfrmoptionstabs.cbtabsmultilines.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
|
|
msgid "&Tabs on multiple lines"
|
|
msgstr "&Kartice na višestrukim linijama"
|
|
|
|
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
|
|
msgid "Ctrl+&Up opens new tab in foreground"
|
|
msgstr "Ktrl+&gore otvara novu karticu u pozadini"
|
|
|
|
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
|
|
msgid "Open &new tabs near current tab"
|
|
msgstr "Otvori novu karticu pored trenutnr kartice"
|
|
|
|
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
|
msgid "Reuse existing tab when possible"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
|
|
msgid "Show ta&b close button"
|
|
msgstr "Prikazuj dugme za zatvaranje &kartice"
|
|
|
|
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
|
msgid "Always show drive letter in tab title"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabs.gbtabs.caption
|
|
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
|
|
msgid "Folder tabs headers"
|
|
msgstr "Zaglavlje kartice fascikli"
|
|
|
|
#: tfrmoptionstabs.lblchar.caption
|
|
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
|
|
msgid "characters"
|
|
msgstr "znaci"
|
|
|
|
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
|
msgid "Action to do when double click on a tab:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabs.lbltabsposition.caption
|
|
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
|
|
msgid "Ta&bs position"
|
|
msgstr "Položaj kartica&"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
|
msgid "None"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
|
msgid "No"
|
|
msgstr "Ne"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
|
msgid "Left"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
|
msgid "Right"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
|
msgid "Goto to Favorite Tabs Configuration after resaving"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
|
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
|
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
|
msgid "Default extra settings when saving new Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.gbtabs.caption
|
|
msgid "Folder tabs headers extra"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
|
msgid "When restoring tab, existing tabs to keep:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
|
msgid "Tabs saved on left will be restored to:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
|
msgid "Tabs saved on right will be restored to:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
|
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
|
msgid "Keep saving dir history with Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
|
msgid "Default position in menu when saving a new Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
|
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
|
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsterminal.edruntermparams.hint
|
|
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
|
msgid "Command for just running terminal:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
|
msgid "Command for running a command in terminal and close after:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
|
msgid "Command for running a command in terminal and stay open:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
|
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Naredba:"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Odrednice:"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
|
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Naredba:"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Odrednice:"
|
|
|
|
#: tfrmoptionsterminal.lbruntermcmd.caption
|
|
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Naredba:"
|
|
|
|
#: tfrmoptionsterminal.lbruntermparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Odrednice:"
|
|
|
|
#: tfrmoptionstoolbar.btnclonebutton.caption
|
|
msgid "C&lone button"
|
|
msgstr "Dugme potpuno istih umnožaka"
|
|
|
|
#: tfrmoptionstoolbar.btndeletebutton.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Izbriši"
|
|
|
|
#: tfrmoptionstoolbar.btnedithotkey.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION"
|
|
msgid "Edit hot&key"
|
|
msgstr "Uredi &prečicu"
|
|
|
|
#: tfrmoptionstoolbar.btninsertbutton.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION"
|
|
msgid "&Insert new button"
|
|
msgstr "&Unesi novo dugme"
|
|
|
|
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
|
msgid "Select"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.btnopenfile.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstoolbar.btnother.caption
|
|
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
|
msgid "Other..."
|
|
msgstr "Drugo..."
|
|
|
|
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION"
|
|
msgid "Remove hotke&y"
|
|
msgstr "Ukloni &prečicu"
|
|
|
|
#: tfrmoptionstoolbar.btnstartpath.caption
|
|
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
|
msgid "Suggest"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
|
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
|
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
|
msgid "&Flat buttons"
|
|
msgstr "Ravna& dugmad"
|
|
|
|
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
|
msgid "Report errors with commands"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
|
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
|
msgstr "Unesite odrednice naredbe, svaku u posebnoj liniji. Pritisnite F1 za pregled pomoći za odrednice."
|
|
|
|
#: tfrmoptionstoolbar.gbgroupbox.caption
|
|
msgid "Appearance"
|
|
msgstr "Prikaz"
|
|
|
|
#: tfrmoptionstoolbar.lblbarsize.caption
|
|
msgid "&Bar size:"
|
|
msgstr "Veličina &trake:"
|
|
|
|
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION"
|
|
msgid "Comman&d:"
|
|
msgstr "&Naredba:"
|
|
|
|
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
|
|
msgid "Parameter&s:"
|
|
msgstr "Odrednica&:"
|
|
|
|
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
|
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
|
|
msgid "Help"
|
|
msgstr "Pomoć"
|
|
|
|
#: tfrmoptionstoolbar.lblhotkey.caption
|
|
msgid "Hot key:"
|
|
msgstr "Prečica:"
|
|
|
|
#: tfrmoptionstoolbar.lbliconfile.caption
|
|
msgid "Ico&n:"
|
|
msgstr "Ikonica&:"
|
|
|
|
#: tfrmoptionstoolbar.lbliconsize.caption
|
|
msgid "Icon si&ze:"
|
|
msgstr "Veličina& ikonice:"
|
|
|
|
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
|
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
|
|
msgid "Co&mmand:"
|
|
msgstr "Naredba&:"
|
|
|
|
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
|
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
|
|
msgid "&Parameters:"
|
|
msgstr "Odrednice&:"
|
|
|
|
#: tfrmoptionstoolbar.lblstartpath.caption
|
|
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
|
msgid "Start pat&h:"
|
|
msgstr "Početna &putanja:"
|
|
|
|
#: tfrmoptionstoolbar.lbltooltip.caption
|
|
msgid "&Tooltip:"
|
|
msgstr "&Napomena:"
|
|
|
|
#: tfrmoptionstoolbar.miaddallcmds.caption
|
|
msgid "Add toolbar with ALL DC commands"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
|
msgid "for an external command"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
|
msgid "for an internal command"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
|
msgid "for a separator"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
|
msgid "for a sub-tool bar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.mibackup.caption
|
|
msgctxt "tfrmoptionstoolbar.mibackup.caption"
|
|
msgid "Backup..."
|
|
msgstr "Ostava..."
|
|
|
|
#: tfrmoptionstoolbar.miexport.caption
|
|
msgctxt "tfrmoptionstoolbar.miexport.caption"
|
|
msgid "Export..."
|
|
msgstr "Izvoz..."
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrent.caption
|
|
msgid "Current toolbar..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
|
|
msgid "to a Toolbar File (.toolbar)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
|
|
msgid "to a TC .BAR file (keep existing)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
|
|
msgid "to a TC .BAR file (erase existing)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
|
msgstr "u „wincmd.ini“ TC-a (zadrži postojeće)"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
|
msgstr "u „wincmd.ini“ TC-a (izbriši postojeće)"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator1.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator2.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator3.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator4.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexporttop.caption
|
|
msgid "Top toolbar..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
|
msgid "Save a backup of Toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
|
msgid "to a Toolbar File (.toolbar)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
|
msgid "to a TC .BAR file (keep existing)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
|
msgid "to a TC .BAR file (erase existing)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
|
msgstr "u „wincmd.ini“ TC-a (zadrži postojeće)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
|
msgstr "u „wincmd.ini“ TC-a (izbriši postojeće)"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimport.caption
|
|
msgctxt "tfrmoptionstoolbar.miimport.caption"
|
|
msgid "Import..."
|
|
msgstr "Uvoz..."
|
|
|
|
#: tfrmoptionstoolbar.miimportbackup.caption
|
|
msgid "Restore a backup of Toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbar.caption
|
|
msgid "from a Toolbar File (.toolbar)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimportseparator.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbar.caption
|
|
msgid "from a single TC .BAR file"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttcini.caption
|
|
msgid "from \"wincmd.ini\" of TC..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misearchandreplace.caption
|
|
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
|
|
msgid "Search and replace..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miseparator1.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator10.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator11.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator13.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator14.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator2.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator6.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator7.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator8.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator9.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
|
msgid "as first element"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
|
msgid "in all of all the above..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
|
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
|
msgid "in all commands..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
|
msgid "in all icon names..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
|
msgid "in all parameters..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
|
msgid "in all start path..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
|
msgid "Button type"
|
|
msgstr "Vrsta dugmeta"
|
|
|
|
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
|
msgid "&Keep terminal window open after executing program"
|
|
msgstr "&Zadržavaj otvorenim prozor terminala posle izvršenja programa"
|
|
|
|
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
|
msgid "&Execute in terminal"
|
|
msgstr "&Izvrši u terminalu"
|
|
|
|
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
|
msgid "&Use external program"
|
|
msgstr "&Koristi spoljni program"
|
|
|
|
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
|
msgid "A&dditional parameters"
|
|
msgstr "&Dodatne odrednice"
|
|
|
|
#: tfrmoptionstoolbase.lbltoolspath.caption
|
|
msgid "&Path to program to execute"
|
|
msgstr "&Putanja programa za izvršenje"
|
|
|
|
#: tfrmoptionstooltips.btnaddtooltipsfiletype.caption
|
|
msgctxt "tfrmoptionstooltips.btnaddtooltipsfiletype.caption"
|
|
msgid "A&dd"
|
|
msgstr "&Dodaj"
|
|
|
|
#: tfrmoptionstooltips.btnapplytooltipsfiletype.caption
|
|
msgctxt "tfrmoptionstooltips.btnapplytooltipsfiletype.caption"
|
|
msgid "A&pply"
|
|
msgstr "Primeni&"
|
|
|
|
#: tfrmoptionstooltips.btncopytooltipsfiletype.caption
|
|
msgctxt "tfrmoptionstooltips.btncopytooltipsfiletype.caption"
|
|
msgid "Cop&y"
|
|
msgstr "Umnoži"
|
|
|
|
#: tfrmoptionstooltips.btndeletetooltipsfiletype.caption
|
|
msgctxt "tfrmoptionstooltips.btndeletetooltipsfiletype.caption"
|
|
msgid "Delete"
|
|
msgstr "Izbriši&"
|
|
|
|
#: tfrmoptionstooltips.btnfieldslist.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
|
msgid "Template..."
|
|
msgstr "Obrazac..."
|
|
|
|
#: tfrmoptionstooltips.btnrenametooltipsfiletype.caption
|
|
msgctxt "tfrmoptionstooltips.btnrenametooltipsfiletype.caption"
|
|
msgid "&Rename"
|
|
msgstr "Preimenuj&"
|
|
|
|
#: tfrmoptionstooltips.btntooltipother.caption
|
|
msgctxt "tfrmoptionstooltips.btntooltipother.caption"
|
|
msgid "Oth&er..."
|
|
msgstr "Ostalo..."
|
|
|
|
#: tfrmoptionstooltips.bvltooltips1.caption
|
|
msgid "Tooltip configuration for selected file type:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstooltips.bvltooltips2.caption
|
|
msgid "General options about tooltips:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstooltips.chkshowtooltip.caption
|
|
#, fuzzy
|
|
#| msgid "Show tool tip"
|
|
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
|
|
msgid "&Show tooltip for files in the file panel"
|
|
msgstr "Prikaži napomenu"
|
|
|
|
#: tfrmoptionstooltips.lblfieldslist.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
|
|
msgid "Category &hint:"
|
|
msgstr "Vrsta napomene&:"
|
|
|
|
#: tfrmoptionstooltips.lblfieldsmask.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
|
msgid "Category &mask:"
|
|
msgstr "Vrsta maske&:"
|
|
|
|
#: tfrmoptionstooltips.lbltooltiphidingdelay.caption
|
|
msgid "Tooltip hiding delay:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstooltips.lbltooltipshowingmode.caption
|
|
msgid "Tooltip showing mode:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstooltips.lbltooltipslistbox.caption
|
|
msgid "&File types:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstooltips.mitooltipsfiletypediscardmodification.caption
|
|
msgid "Discard Modifications"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstooltips.mitooltipsfiletypeexport.caption
|
|
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeexport.caption"
|
|
msgid "Export..."
|
|
msgstr "Izvoz..."
|
|
|
|
#: tfrmoptionstooltips.mitooltipsfiletypeimport.caption
|
|
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeimport.caption"
|
|
msgid "Import..."
|
|
msgstr "Uvoz..."
|
|
|
|
#: tfrmoptionstooltips.mitooltipsfiletypesortfiletype.caption
|
|
msgid "Sort Tooltip File Types"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
|
msgid "With double-click on the bar on top of a file panel"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
|
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
|
msgid "With the menu and internal command"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
|
msgid "Double click in tree select and exit"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
|
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
|
|
msgid "With the menu and internal command"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
|
msgid "With double-click on a tab (if configured for it)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
|
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
|
msgid "Single mouse click in tree select and exit"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
|
msgid "Use it for Command Line History"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
|
msgid "Use it for the Dir History"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
|
msgid "Use it for the View History (Visited paths for active view)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
|
msgid "Behavior regarding selection:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
|
msgid "Tree View Menus related options:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
|
msgid "Where to use Tree View Menus:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblnote.caption
|
|
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
|
msgid "With Directory Hotlist:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
|
msgid "With Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
|
msgid "With History:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
|
msgid "Use and display keyboard shortcut for choosing items"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
|
msgid "Layout and colors options:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
|
msgid "Background color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
|
msgid "Cursor color:"
|
|
msgstr "Boja pokazivača:"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
|
msgid "Found text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
|
msgid "Found text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
|
msgid "Normal text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
|
msgid "Normal text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
|
msgid "Tree View Menu Preview:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
|
msgid "Secondary text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
|
msgid "Secondary text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
|
msgid "Shortcut color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
|
msgid "Shortcut under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
|
msgid "Unselectable text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
|
msgid "Unselectable under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
|
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
|
msgid "Viewer Book Mode"
|
|
msgstr "Način prikaza preglednika knjiga"
|
|
|
|
#: tfrmoptionsviewer.gbviewerexample.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
|
|
msgid "Example"
|
|
msgstr "Primer"
|
|
|
|
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
|
msgid "&Background color in book viewer"
|
|
msgstr "&Pozadinska boja u pregledniku knjiga"
|
|
|
|
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
|
msgid "&Font color in book viewer"
|
|
msgstr "&Slovni lik u pregledniku knjiga"
|
|
|
|
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
|
msgid "&Number of columns in book viewer"
|
|
msgstr "Broj stubaca u pregledniku knjiga"
|
|
|
|
#: tfrmpackdlg.btnconfig.caption
|
|
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
|
msgid "Con&figure"
|
|
msgstr "&Podesi"
|
|
|
|
#: tfrmpackdlg.caption
|
|
msgctxt "TFRMPACKDLG.CAPTION"
|
|
msgid "Pack files"
|
|
msgstr "Sažmi datoteke"
|
|
|
|
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
|
msgid "C&reate separate archives, one per selected file/dir"
|
|
msgstr "&Napravi odvojene skladišta, svako posebno za odabranu datoteku i fasciklu"
|
|
|
|
#: tfrmpackdlg.cbcreatesfx.caption
|
|
msgid "Create self e&xtracting archive"
|
|
msgstr "Napravi samoizdvajajuće skladište"
|
|
|
|
#: tfrmpackdlg.cbencrypt.caption
|
|
msgid "Encr&ypt"
|
|
msgstr "&Šifruj"
|
|
|
|
#: tfrmpackdlg.cbmovetoarchive.caption
|
|
msgid "Mo&ve to archive"
|
|
msgstr "Premesti& u skladište"
|
|
|
|
#: tfrmpackdlg.cbmultivolume.caption
|
|
msgid "&Multiple disk archive"
|
|
msgstr "&Višestruko skladište diskova"
|
|
|
|
#: tfrmpackdlg.cbotherplugins.caption
|
|
msgid "=>"
|
|
msgstr "=>"
|
|
|
|
#: tfrmpackdlg.cbputintarfirst.caption
|
|
msgid "P&ut in the TAR archive first"
|
|
msgstr "Prvo smesti& u TAR skladište"
|
|
|
|
#: tfrmpackdlg.cbstoredir.caption
|
|
msgid "Also &pack path names (only recursed)"
|
|
msgstr "Takođe sažmi& i imena putanje (samo rekurzivno)"
|
|
|
|
#: tfrmpackdlg.lblprompt.caption
|
|
msgid "Pack file(s) to the file:"
|
|
msgstr "Sažmi datoteku(e) u datoteku:"
|
|
|
|
#: tfrmpackdlg.rgpacker.caption
|
|
msgid "Packer"
|
|
msgstr "Sažimalac"
|
|
|
|
#: tfrmpackinfodlg.btnclose.caption
|
|
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Zatvori"
|
|
|
|
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
|
msgid "Unpack &all and execute"
|
|
msgstr "Izdvoji &sve i izvrši"
|
|
|
|
#: tfrmpackinfodlg.btnunpackandexec.caption
|
|
msgid "&Unpack and execute"
|
|
msgstr "&Izdvoji i izvrši"
|
|
|
|
#: tfrmpackinfodlg.caption
|
|
msgctxt "TFRMPACKINFODLG.CAPTION"
|
|
msgid "Properties of packed file"
|
|
msgstr "Svojstva sažmane datoteke"
|
|
|
|
#: tfrmpackinfodlg.lblattributes.caption
|
|
msgid "Attributes:"
|
|
msgstr "Svojstva:"
|
|
|
|
#: tfrmpackinfodlg.lblcompressionratio.caption
|
|
msgid "Compression ratio:"
|
|
msgstr "Stupanj sažimanja:"
|
|
|
|
#: tfrmpackinfodlg.lbldate.caption
|
|
msgid "Date:"
|
|
msgstr "Datum:"
|
|
|
|
#: tfrmpackinfodlg.lblmethod.caption
|
|
msgid "Method:"
|
|
msgstr "Način:"
|
|
|
|
#: tfrmpackinfodlg.lbloriginalsize.caption
|
|
msgid "Original size:"
|
|
msgstr "Izvorna veličina:"
|
|
|
|
#: tfrmpackinfodlg.lblpackedfile.caption
|
|
msgid "File:"
|
|
msgstr "Datoteka:"
|
|
|
|
#: tfrmpackinfodlg.lblpackedsize.caption
|
|
msgid "Packed size:"
|
|
msgstr "Veličina sažmane datoteke:"
|
|
|
|
#: tfrmpackinfodlg.lblpacker.caption
|
|
msgid "Packer:"
|
|
msgstr "Sažimalac:"
|
|
|
|
#: tfrmpackinfodlg.lbltime.caption
|
|
msgid "Time:"
|
|
msgstr "Vreme:"
|
|
|
|
#: tfrmquicksearch.btncancel.caption
|
|
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
|
|
msgid "X"
|
|
msgstr "H"
|
|
|
|
#: tfrmquicksearch.btncancel.hint
|
|
msgid "Close filter panel"
|
|
msgstr "Zatvori površ propusnika"
|
|
|
|
#: tfrmquicksearch.edtsearch.hint
|
|
msgid "Enter text to search for or filter by"
|
|
msgstr "Unesite tekst ili uslov pretrage"
|
|
|
|
#: tfrmquicksearch.sbcasesensitive.caption
|
|
msgid "Aa"
|
|
msgstr "Aa"
|
|
|
|
#: tfrmquicksearch.sbcasesensitive.hint
|
|
msgid "Case Sensitive"
|
|
msgstr "Osetljivo na veličinu slova"
|
|
|
|
#: tfrmquicksearch.sbdirectories.caption
|
|
msgid "D"
|
|
msgstr "D"
|
|
|
|
#: tfrmquicksearch.sbdirectories.hint
|
|
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
|
msgid "Directories"
|
|
msgstr "Fascikle"
|
|
|
|
#: tfrmquicksearch.sbfiles.caption
|
|
msgid "F"
|
|
msgstr "F"
|
|
|
|
#: tfrmquicksearch.sbfiles.hint
|
|
msgctxt "tfrmquicksearch.sbfiles.hint"
|
|
msgid "Files"
|
|
msgstr "Datoteke"
|
|
|
|
#: tfrmquicksearch.sbmatchbeginning.caption
|
|
msgid "{"
|
|
msgstr "{"
|
|
|
|
#: tfrmquicksearch.sbmatchbeginning.hint
|
|
msgid "Match Beginning"
|
|
msgstr "Početak poklapanja"
|
|
|
|
#: tfrmquicksearch.sbmatchending.caption
|
|
msgid "}"
|
|
msgstr "}"
|
|
|
|
#: tfrmquicksearch.sbmatchending.hint
|
|
msgid "Match Ending"
|
|
msgstr "Završetak poklapanja"
|
|
|
|
#: tfrmquicksearch.tglfilter.caption
|
|
msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION"
|
|
msgid "Filter"
|
|
msgstr "Uslov"
|
|
|
|
#: tfrmquicksearch.tglfilter.hint
|
|
msgid "Toggle between search or filter"
|
|
msgstr "Zamena pretrage i uslova"
|
|
|
|
#: tfrmsearchplugin.btnadd.caption
|
|
msgid "&More rules"
|
|
msgstr ""
|
|
|
|
#: tfrmsearchplugin.btndelete.caption
|
|
msgid "L&ess rules"
|
|
msgstr ""
|
|
|
|
#: tfrmsearchplugin.chkuseplugins.caption
|
|
msgid "Use &content plugins, combine with:"
|
|
msgstr ""
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[0].text
|
|
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
|
|
msgid "Plugin"
|
|
msgstr "Priključak"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[1].text
|
|
msgid "Field"
|
|
msgstr ""
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[2].text
|
|
msgid "Operator"
|
|
msgstr ""
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[3].text
|
|
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
|
msgid "Value"
|
|
msgstr "Vrednost"
|
|
|
|
#: tfrmsearchplugin.rband.caption
|
|
msgid "&AND (all match)"
|
|
msgstr ""
|
|
|
|
#: tfrmsearchplugin.rbor.caption
|
|
msgid "&OR (any match)"
|
|
msgstr ""
|
|
|
|
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Otkaži"
|
|
|
|
#: tfrmselecttextrange.btppanel.closebutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Zatvori"
|
|
|
|
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "&Pomoć"
|
|
|
|
#: tfrmselecttextrange.btppanel.okbutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmselecttextrange.lblselecttext.caption
|
|
msgid "&Select the characters to insert:"
|
|
msgstr "&Izaberite znakove za unos:"
|
|
|
|
#: tfrmsetfileproperties.btncancel.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmsetfileproperties.btnok.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmsetfileproperties.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
|
|
msgid "Change attributes"
|
|
msgstr "Izmeni svojstva"
|
|
|
|
#: tfrmsetfileproperties.cbsgid.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmsetfileproperties.cbsticky.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Lepljivo"
|
|
|
|
#: tfrmsetfileproperties.cbsuid.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmsetfileproperties.chkarchive.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
|
|
msgid "Archive"
|
|
msgstr "Skladište"
|
|
|
|
#: tfrmsetfileproperties.chkcreationtime.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
|
|
msgid "Created:"
|
|
msgstr "Napravljeno:"
|
|
|
|
#: tfrmsetfileproperties.chkhidden.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
|
|
msgid "Hidden"
|
|
msgstr "Skriveno"
|
|
|
|
#: tfrmsetfileproperties.chklastaccesstime.caption
|
|
msgid "Accessed:"
|
|
msgstr "Pristupano:"
|
|
|
|
#: tfrmsetfileproperties.chklastwritetime.caption
|
|
msgid "Modified:"
|
|
msgstr "Izmenjeno:"
|
|
|
|
#: tfrmsetfileproperties.chkreadonly.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
|
|
msgid "Read only"
|
|
msgstr "Samo za čitanje"
|
|
|
|
#: tfrmsetfileproperties.chkrecursive.caption
|
|
msgid "Including subfolders"
|
|
msgstr "Uključujući podfascikle"
|
|
|
|
#: tfrmsetfileproperties.chksystem.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
|
|
msgid "System"
|
|
msgstr "Sistem"
|
|
|
|
#: tfrmsetfileproperties.gbtimesamp.caption
|
|
msgid "Timestamp properties"
|
|
msgstr "Svojstva vremenske oznake"
|
|
|
|
#: tfrmsetfileproperties.gbunixattributes.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Svojstva"
|
|
|
|
#: tfrmsetfileproperties.gbwinattributes.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Svojstva"
|
|
|
|
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bita:"
|
|
|
|
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Udruženje"
|
|
|
|
#: tfrmsetfileproperties.lblattrinfo.caption
|
|
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
|
msgid "(gray field means unchanged value)"
|
|
msgstr "(siva polja označavaju neizmenjene vrednosti)"
|
|
|
|
#: tfrmsetfileproperties.lblattrotherstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Drugo"
|
|
|
|
#: tfrmsetfileproperties.lblattrownerstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Vlasnik"
|
|
|
|
#: tfrmsetfileproperties.lblattrtext.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
|
msgid "-----------"
|
|
msgstr "-----------"
|
|
|
|
#: tfrmsetfileproperties.lblattrtextstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
|
msgid "Text:"
|
|
msgstr "Tekst:"
|
|
|
|
#: tfrmsetfileproperties.lblexec.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Izvrši"
|
|
|
|
#: tfrmsetfileproperties.lblmodeinfo.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
|
|
msgid "(gray field means unchanged value)"
|
|
msgstr "(siva polja označavaju neizmenjene vrednosti)"
|
|
|
|
#: tfrmsetfileproperties.lbloctal.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
|
msgid "Octal:"
|
|
msgstr "Oktalno:"
|
|
|
|
#: tfrmsetfileproperties.lblread.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Čitaj"
|
|
|
|
#: tfrmsetfileproperties.lblwrite.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Piši"
|
|
|
|
#: tfrmsplitter.btncancel.caption
|
|
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmsplitter.btnftchoice.caption
|
|
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmsplitter.btnok.caption
|
|
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmsplitter.btnrelativeftchoice.hint
|
|
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmsplitter.caption
|
|
msgctxt "TFRMSPLITTER.CAPTION"
|
|
msgid "Splitter"
|
|
msgstr "Delilac"
|
|
|
|
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
|
msgid "Require a CRC32 verification file"
|
|
msgstr ""
|
|
|
|
#: tfrmsplitter.cmbxsize.text
|
|
msgid "1457664B - 3.5\""
|
|
msgstr "1457664B - 3.5\""
|
|
|
|
#: tfrmsplitter.grbxfile.caption
|
|
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Ime datoteke"
|
|
|
|
#: tfrmsplitter.grbxsize.caption
|
|
msgid "Size and number of parts"
|
|
msgstr "Veličina i broj delova"
|
|
|
|
#: tfrmsplitter.lbdirtarget.caption
|
|
msgid "Directory &target"
|
|
msgstr "Ciljna fascikla&"
|
|
|
|
#: tfrmsplitter.lbfilesource.caption
|
|
msgid "File &source"
|
|
msgstr "Izvorna& fascikla"
|
|
|
|
#: tfrmsplitter.lblnumberparts.caption
|
|
msgid "&Number of parts"
|
|
msgstr "&Broje delova"
|
|
|
|
#: tfrmsplitter.rbtnbyte.caption
|
|
msgid "&Bytes"
|
|
msgstr ""
|
|
|
|
#: tfrmsplitter.rbtngigab.caption
|
|
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
|
|
msgid "&Gigabytes"
|
|
msgstr "&Gigabajta"
|
|
|
|
#: tfrmsplitter.rbtnkilob.caption
|
|
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
|
|
msgid "&Kilobytes"
|
|
msgstr "&Kilobajta"
|
|
|
|
#: tfrmsplitter.rbtnmegab.caption
|
|
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
|
|
msgid "&Megabytes"
|
|
msgstr "&Megabajta"
|
|
|
|
#: tfrmstartingsplash.caption
|
|
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmstartingsplash.lblbuild.caption
|
|
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
|
|
msgid "Build"
|
|
msgstr "Izgrađen"
|
|
|
|
#: tfrmstartingsplash.lblfreepascalver.caption
|
|
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
|
|
msgid "Free Pascal"
|
|
msgstr "Slobodni Paskal"
|
|
|
|
#: tfrmstartingsplash.lbllazarusver.caption
|
|
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: tfrmstartingsplash.lbloperatingsystem.caption
|
|
msgid "Operating System"
|
|
msgstr "Operativni sistem"
|
|
|
|
#: tfrmstartingsplash.lblplatform.caption
|
|
msgid "Platform"
|
|
msgstr "Platforma"
|
|
|
|
#: tfrmstartingsplash.lblrevision.caption
|
|
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
|
|
msgid "Revision"
|
|
msgstr "Prepravka"
|
|
|
|
#: tfrmstartingsplash.lbltitle.caption
|
|
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmstartingsplash.lblversion.caption
|
|
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
|
|
msgid "Version"
|
|
msgstr "Izdanje"
|
|
|
|
#: tfrmstartingsplash.lblwidgetsetver.caption
|
|
msgid "WidgetsetVer"
|
|
msgstr ""
|
|
|
|
#: tfrmsymlink.btncancel.caption
|
|
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmsymlink.btnok.caption
|
|
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmsymlink.caption
|
|
msgid "Create symbolic link"
|
|
msgstr "Napravi simboličku vezu"
|
|
|
|
#: tfrmsymlink.chkuserelativepath.caption
|
|
msgid "Use &relative path when possible"
|
|
msgstr ""
|
|
|
|
#: tfrmsymlink.lblexistingfile.caption
|
|
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
|
msgid "&Destination that the link will point to"
|
|
msgstr "&Odredište na koje će ukazivati veza"
|
|
|
|
#: tfrmsymlink.lbllinktocreate.caption
|
|
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
|
msgid "&Link name"
|
|
msgstr "Ime &veze"
|
|
|
|
#: tfrmsyncdirsdlg.actselectclear.caption
|
|
msgid "Remove selection"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectcopydefault.caption
|
|
msgid "Select for copying (default direction)"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
|
|
msgid "Select for copying -> (left to right)"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
|
|
msgid "Reverse copy direction"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
|
|
msgid "Select for copying <- (right to left)"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectdeleteright.caption
|
|
msgid "Select for deleting -> (right)"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.btnclose.caption
|
|
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
|
|
msgid "Close"
|
|
msgstr "Zatvori"
|
|
|
|
#: tfrmsyncdirsdlg.btncompare.caption
|
|
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
|
|
msgid "Compare"
|
|
msgstr "Uporedi"
|
|
|
|
#: tfrmsyncdirsdlg.btnseldir1.caption
|
|
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmsyncdirsdlg.btnseldir2.caption
|
|
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
|
msgid "Synchronize"
|
|
msgstr "Uskladi"
|
|
|
|
#: tfrmsyncdirsdlg.caption
|
|
msgid "Synchronize directories"
|
|
msgstr "Usklađene fascikle"
|
|
|
|
#: tfrmsyncdirsdlg.cbextfilter.text
|
|
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
|
|
msgid "*.*"
|
|
msgstr "*.*"
|
|
|
|
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
|
msgid "asymmetric"
|
|
msgstr "nesimetrično"
|
|
|
|
#: tfrmsyncdirsdlg.chkbycontent.caption
|
|
msgid "by content"
|
|
msgstr "po sadržaju"
|
|
|
|
#: tfrmsyncdirsdlg.chkignoredate.caption
|
|
msgid "ignore date"
|
|
msgstr "zanemari datum"
|
|
|
|
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
|
msgid "only selected"
|
|
msgstr "samo odabrano"
|
|
|
|
#: tfrmsyncdirsdlg.chksubdirs.caption
|
|
msgid "Subdirs"
|
|
msgstr "Podfascikle"
|
|
|
|
#: tfrmsyncdirsdlg.groupbox1.caption
|
|
msgid "Show:"
|
|
msgstr "Prikazuj:"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
|
|
msgid "Name"
|
|
msgstr "Ime"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
|
|
msgid "Size"
|
|
msgstr "Veličina"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
|
|
msgid "Date"
|
|
msgstr "Datum"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
|
msgid "<=>"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
|
|
msgid "Date"
|
|
msgstr "Datum"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
|
|
msgid "Size"
|
|
msgstr "Veličina"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
|
|
msgid "Name"
|
|
msgstr "Ime"
|
|
|
|
#: tfrmsyncdirsdlg.label1.caption
|
|
msgid "(in main window)"
|
|
msgstr "(u glavnom prozoru)"
|
|
|
|
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
|
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
|
|
msgid "Compare"
|
|
msgstr "Uporedi"
|
|
|
|
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
|
msgid "View left"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
|
msgid "View right"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
|
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
|
|
msgid "<"
|
|
msgstr "<"
|
|
|
|
#: tfrmsyncdirsdlg.sbcopyright.caption
|
|
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
|
|
msgid ">"
|
|
msgstr ">"
|
|
|
|
#: tfrmsyncdirsdlg.sbduplicates.caption
|
|
msgid "duplicates"
|
|
msgstr "blizanci"
|
|
|
|
#: tfrmsyncdirsdlg.sbequal.caption
|
|
msgid "="
|
|
msgstr "="
|
|
|
|
#: tfrmsyncdirsdlg.sbnotequal.caption
|
|
msgid "!="
|
|
msgstr "!="
|
|
|
|
#: tfrmsyncdirsdlg.sbsingles.caption
|
|
msgid "singles"
|
|
msgstr "pojedinačni"
|
|
|
|
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
|
msgid "Please press \"Compare\" to start"
|
|
msgstr "Molim, pritisnite „Uporedi“ za početak"
|
|
|
|
#: tfrmsyncdirsperformdlg.caption
|
|
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
|
|
msgid "Synchronize"
|
|
msgstr "Uskladi"
|
|
|
|
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
|
msgid "Confirm overwrites"
|
|
msgstr "Potvrdi prepisivanje"
|
|
|
|
#: tfrmtreeviewmenu.caption
|
|
msgctxt "tfrmtreeviewmenu.caption"
|
|
msgid "Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
|
msgid "Select your hot directory:"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
|
msgid "Search is case sensitive"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
|
msgid "Full collapse"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmifullexpand.caption
|
|
msgid "Full expand"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
|
msgid "Search ignore accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
|
msgid "Search is not case sensitive"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
|
msgid "Search is strict regarding accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
|
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
|
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
|
msgid "Close Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
|
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
|
|
msgid "Configuration of Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
|
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
|
|
msgid "Configuration of Tree View Menu Colors"
|
|
msgstr ""
|
|
|
|
#: tfrmtweakplugin.btnadd.caption
|
|
msgid "A&dd new"
|
|
msgstr "&Dodaj novo"
|
|
|
|
#: tfrmtweakplugin.btncancel.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: tfrmtweakplugin.btnchange.caption
|
|
msgid "C&hange"
|
|
msgstr "&Izmeni"
|
|
|
|
#: tfrmtweakplugin.btndefault.caption
|
|
msgid "De&fault"
|
|
msgstr "&Podrazumevano"
|
|
|
|
#: tfrmtweakplugin.btnok.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: tfrmtweakplugin.btnrelativeplugin1.hint
|
|
msgctxt "tfrmtweakplugin.btnrelativeplugin1.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmtweakplugin.btnrelativeplugin2.hint
|
|
msgctxt "tfrmtweakplugin.btnrelativeplugin2.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Neke radnje za odabir odgovarajuće putanje"
|
|
|
|
#: tfrmtweakplugin.btnremove.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
|
msgid "&Remove"
|
|
msgstr "Ukloni&"
|
|
|
|
#: tfrmtweakplugin.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
|
|
msgid "Tweak plugin"
|
|
msgstr "Priključak za lickanje"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
|
msgid "De&tect archive type by content"
|
|
msgstr "&Prepoznaj vrstu skladišta po sadržaju"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
|
msgid "Can de&lete files"
|
|
msgstr "Nisam uspeo da &izbrišem datoteke"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
|
msgid "Supports e&ncryption"
|
|
msgstr "Podržava &šifrovanje"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
|
msgid "Sho&w as normal files (hide packer icon)"
|
|
msgstr "Prikazuj& kao obične datoteke (sakrij ikonicu sažimanja)"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
|
msgid "Supports pac&king in memory"
|
|
msgstr "Podržava &sažimanje u memoriji"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
|
msgid "Can &modify existing archives"
|
|
msgstr "Nisam uspeo da izmenim postojeća skladišta"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
|
msgid "&Archive can contain multiple files"
|
|
msgstr "&Skladište može da sadrži višestruke datoteke"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_new.caption
|
|
msgid "Can create new archi&ves"
|
|
msgstr "Nisam uspeo da napravim nova skladišta&"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_options.caption
|
|
msgid "S&upports the options dialogbox"
|
|
msgstr "Podržava& prozor za prikaz mogućnosti"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
|
msgid "Allow searchin&g for text in archives"
|
|
msgstr "Omogućava pretragu& teksta u skladištima"
|
|
|
|
#: tfrmtweakplugin.lbldescription.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
|
|
msgid "&Description:"
|
|
msgstr "Opis&:"
|
|
|
|
#: tfrmtweakplugin.lbldetectstr.caption
|
|
msgid "D&etect string:"
|
|
msgstr "Prepoznaj& nisku:"
|
|
|
|
#: tfrmtweakplugin.lblextension.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
|
|
msgid "&Extension:"
|
|
msgstr "Nastavci&:"
|
|
|
|
#: tfrmtweakplugin.lblflags.caption
|
|
msgid "Flags:"
|
|
msgstr "Oznake:"
|
|
|
|
#: tfrmtweakplugin.lblname.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
|
|
msgid "&Name:"
|
|
msgstr "Ime&:"
|
|
|
|
#: tfrmtweakplugin.lblplugin.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
|
msgid "&Plugin:"
|
|
msgstr "&Priključak:"
|
|
|
|
#: tfrmtweakplugin.lblplugin2.caption
|
|
msgctxt "tfrmtweakplugin.lblplugin2.caption"
|
|
msgid "&Plugin:"
|
|
msgstr "&Priključak:"
|
|
|
|
#: tfrmviewer.actabout.caption
|
|
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
|
|
msgid "About Viewer..."
|
|
msgstr "O pregledniku..."
|
|
|
|
#: tfrmviewer.actabout.hint
|
|
msgid "Displays the About message"
|
|
msgstr "Prikazuje poruku o programu"
|
|
|
|
#: tfrmviewer.actchangeencoding.caption
|
|
msgid "Change encoding"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actcopyfile.caption
|
|
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
|
msgid "Copy File"
|
|
msgstr "Umnoži datoteku"
|
|
|
|
#: tfrmviewer.actcopyfile.hint
|
|
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
|
msgid "Copy File"
|
|
msgstr "Umnoži datoteku"
|
|
|
|
#: tfrmviewer.actcopytoclipboard.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
|
msgid "Copy To Clipboard"
|
|
msgstr "Umnoži u ostavu isečaka"
|
|
|
|
#: tfrmviewer.actcopytoclipboardformatted.caption
|
|
msgid "Copy To Clipboard Formatted"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actdeletefile.caption
|
|
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
|
msgid "Delete File"
|
|
msgstr "Izbriši datoteku"
|
|
|
|
#: tfrmviewer.actdeletefile.hint
|
|
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
|
msgid "Delete File"
|
|
msgstr "Izbriši datoteku"
|
|
|
|
#: tfrmviewer.actexitviewer.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actexitviewer.caption"
|
|
msgid "E&xit"
|
|
msgstr "Izlaz&"
|
|
|
|
#: tfrmviewer.actfind.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actfind.caption"
|
|
msgid "Find"
|
|
msgstr "Pronađi"
|
|
|
|
#: tfrmviewer.actfindnext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actfindnext.caption"
|
|
msgid "Find next"
|
|
msgstr "Nađi sledeće"
|
|
|
|
#: tfrmviewer.actfindprev.caption
|
|
msgctxt "tfrmviewer.actfindprev.caption"
|
|
msgid "Find previous"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actfullscreen.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actfullscreen.caption"
|
|
msgid "Full Screen"
|
|
msgstr "Preko celog ekrana"
|
|
|
|
#: tfrmviewer.actimagecenter.caption
|
|
msgctxt "tfrmviewer.actimagecenter.caption"
|
|
msgid "Center"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actloadnextfile.caption
|
|
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
|
|
msgid "&Next"
|
|
msgstr "&Sledeća"
|
|
|
|
#: tfrmviewer.actloadnextfile.hint
|
|
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT"
|
|
msgid "Load Next File"
|
|
msgstr "Učitaj sledeću datoteku"
|
|
|
|
#: tfrmviewer.actloadprevfile.caption
|
|
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
|
|
msgid "&Previous"
|
|
msgstr "&Prethodna"
|
|
|
|
#: tfrmviewer.actloadprevfile.hint
|
|
msgid "Load Previous File"
|
|
msgstr "Učitaj prethodnu datoteku"
|
|
|
|
#: tfrmviewer.actmirrorhorz.caption
|
|
msgid "Mirror Horizontally"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actmirrorhorz.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actmirrorhorz.hint"
|
|
msgid "Mirror"
|
|
msgstr "Ogledalo"
|
|
|
|
#: tfrmviewer.actmirrorvert.caption
|
|
msgid "Mirror Vertically"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actmovefile.caption
|
|
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
|
msgid "Move File"
|
|
msgstr "Premesti datoteku"
|
|
|
|
#: tfrmviewer.actmovefile.hint
|
|
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
|
msgid "Move File"
|
|
msgstr "Premesti datoteku"
|
|
|
|
#: tfrmviewer.actpreview.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actpreview.caption"
|
|
msgid "Preview"
|
|
msgstr "Pregled"
|
|
|
|
#: tfrmviewer.actreload.caption
|
|
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
|
msgid "Reload"
|
|
msgstr "Učitaj ponovo"
|
|
|
|
#: tfrmviewer.actreload.hint
|
|
msgid "Reload current file"
|
|
msgstr "Ponovo učitaj trenutnu datoteku"
|
|
|
|
#: tfrmviewer.actrotate180.caption
|
|
#, fuzzy
|
|
#| msgid "Rotate 180"
|
|
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
|
|
msgid "+ 180"
|
|
msgstr "Obrni za 180"
|
|
|
|
#: tfrmviewer.actrotate180.hint
|
|
#, fuzzy
|
|
#| msgid "Rotate 180"
|
|
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
|
|
msgid "Rotate 180 degrees"
|
|
msgstr "Obrni za 180"
|
|
|
|
#: tfrmviewer.actrotate270.caption
|
|
#, fuzzy
|
|
#| msgid "Rotate 270"
|
|
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
|
|
msgid "- 90"
|
|
msgstr "Obrni za 270"
|
|
|
|
#: tfrmviewer.actrotate270.hint
|
|
#, fuzzy
|
|
#| msgid "Rotate 270"
|
|
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
|
|
msgid "Rotate -90 degrees"
|
|
msgstr "Obrni za 270"
|
|
|
|
#: tfrmviewer.actrotate90.caption
|
|
#, fuzzy
|
|
#| msgid "Rotate 90"
|
|
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
|
|
msgid "+ 90"
|
|
msgstr "Obrni za 90"
|
|
|
|
#: tfrmviewer.actrotate90.hint
|
|
#, fuzzy
|
|
#| msgid "Rotate 90"
|
|
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
|
|
msgid "Rotate +90 degrees"
|
|
msgstr "Obrni za 90"
|
|
|
|
#: tfrmviewer.actsave.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actsave.caption"
|
|
msgid "Save"
|
|
msgstr "Sačuvaj"
|
|
|
|
#: tfrmviewer.actsaveas.caption
|
|
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
|
|
msgid "Save As..."
|
|
msgstr "Sačuvaj kao..."
|
|
|
|
#: tfrmviewer.actsaveas.hint
|
|
msgid "Save File As..."
|
|
msgstr "Sačuvaj datoteku kao..."
|
|
|
|
#: tfrmviewer.actscreenshot.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actscreenshot.caption"
|
|
msgid "Screenshot"
|
|
msgstr "Slika ekrana"
|
|
|
|
#: tfrmviewer.actscreenshotdelay3sec.caption
|
|
msgid "Delay 3 sec"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actscreenshotdelay5sec.caption
|
|
msgid "Delay 5 sec"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actselectall.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actselectall.caption"
|
|
msgid "Select All"
|
|
msgstr "Označi sve"
|
|
|
|
#: tfrmviewer.actshowasbin.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowasbin.caption"
|
|
msgid "Show as &Bin"
|
|
msgstr "Prikaži binarno&"
|
|
|
|
#: tfrmviewer.actshowasbook.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowasbook.caption"
|
|
msgid "Show as B&ook"
|
|
msgstr "Prikaži kao knjigu&"
|
|
|
|
#: tfrmviewer.actshowasdec.caption
|
|
msgid "Show as &Dec"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actshowashex.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowashex.caption"
|
|
msgid "Show as &Hex"
|
|
msgstr "Prikaži heksadecimalno&"
|
|
|
|
#: tfrmviewer.actshowastext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowastext.caption"
|
|
msgid "Show as &Text"
|
|
msgstr "Prikaži kao &tekst"
|
|
|
|
#: tfrmviewer.actshowaswraptext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowaswraptext.caption"
|
|
msgid "Show as &Wrap text"
|
|
msgstr "Prikaži kao &uvučen tekst"
|
|
|
|
#: tfrmviewer.actshowgraphics.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowgraphics.caption"
|
|
msgid "Graphics"
|
|
msgstr "Grafika"
|
|
|
|
#: tfrmviewer.actshowplugins.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowplugins.caption"
|
|
msgid "Plugins"
|
|
msgstr "Priključci"
|
|
|
|
#: tfrmviewer.actstretchimage.caption
|
|
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
|
|
msgid "Stretch"
|
|
msgstr "Razvuci"
|
|
|
|
#: tfrmviewer.actstretchimage.hint
|
|
msgid "Stretch Image"
|
|
msgstr "Razvuci sliku"
|
|
|
|
#: tfrmviewer.actstretchonlylarge.caption
|
|
msgctxt "tfrmviewer.actstretchonlylarge.caption"
|
|
msgid "Stretch only large"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actzoom.caption
|
|
msgid "Zoom"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actzoomin.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actzoomin.caption"
|
|
msgid "Zoom In"
|
|
msgstr "Približi"
|
|
|
|
#: tfrmviewer.actzoomout.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actzoomout.caption"
|
|
msgid "Zoom Out"
|
|
msgstr "Udalji"
|
|
|
|
#: tfrmviewer.btncuttuimage.hint
|
|
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
|
|
msgid "Crop"
|
|
msgstr "Opseci"
|
|
|
|
#: tfrmviewer.btnfullscreen.hint
|
|
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
|
msgid "Full Screen"
|
|
msgstr "Preko celog ekrana"
|
|
|
|
#: tfrmviewer.btngifmove.caption
|
|
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
|
msgid "||"
|
|
msgstr "||"
|
|
|
|
#: tfrmviewer.btngiftobmp.caption
|
|
msgid "S"
|
|
msgstr "S"
|
|
|
|
#: tfrmviewer.btnhightlight.hint
|
|
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
|
msgid "Highlight"
|
|
msgstr "Isticanje"
|
|
|
|
#: tfrmviewer.btnnextgifframe.caption
|
|
msgid "||>"
|
|
msgstr "||>"
|
|
|
|
#: tfrmviewer.btnpaint.hint
|
|
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
|
msgid "Paint"
|
|
msgstr "Oboji"
|
|
|
|
#: tfrmviewer.btnprevgifframe.caption
|
|
msgid "<||"
|
|
msgstr "<||"
|
|
|
|
#: tfrmviewer.btnredeye.hint
|
|
msgid "Red Eyes"
|
|
msgstr "Crvene oči"
|
|
|
|
#: tfrmviewer.btnresize.hint
|
|
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
|
|
msgid "Resize"
|
|
msgstr "Promeni veličinu"
|
|
|
|
#: tfrmviewer.btnundo.hint
|
|
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
|
msgid "Undo"
|
|
msgstr "Vrati"
|
|
|
|
#: tfrmviewer.caption
|
|
msgctxt "TFRMVIEWER.CAPTION"
|
|
msgid "Viewer"
|
|
msgstr "Preglednik"
|
|
|
|
#: tfrmviewer.cbslideshow.caption
|
|
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
|
msgid "Slide Show"
|
|
msgstr "Pokretne slike"
|
|
|
|
#: tfrmviewer.comboboxpaint.text
|
|
msgid "Pen"
|
|
msgstr "Olovka"
|
|
|
|
#: tfrmviewer.comboboxwidth.text
|
|
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmviewer.gboxhightlight.caption
|
|
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
|
msgid "Highlight"
|
|
msgstr "Isticanje"
|
|
|
|
#: tfrmviewer.gboxpaint.caption
|
|
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
|
msgid "Paint"
|
|
msgstr "Bojenje"
|
|
|
|
#: tfrmviewer.gboxslideshow.caption
|
|
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
|
msgid "Slide Show"
|
|
msgstr "Pokretni prikaz"
|
|
|
|
#: tfrmviewer.gboxview.caption
|
|
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
|
msgid "View"
|
|
msgstr "Pregled"
|
|
|
|
#: tfrmviewer.lblhightlight.caption
|
|
msgid "0x0"
|
|
msgstr "0x0"
|
|
|
|
#: tfrmviewer.miabout.caption
|
|
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "O programu"
|
|
|
|
#: tfrmviewer.miedit.caption
|
|
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Uredi"
|
|
|
|
#: tfrmviewer.miencoding.caption
|
|
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
|
msgid "En&coding"
|
|
msgstr "&Šifrovanje"
|
|
|
|
#: tfrmviewer.mifile.caption
|
|
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
|
msgid "&File"
|
|
msgstr "&Datoteka"
|
|
|
|
#: tfrmviewer.miimage.caption
|
|
msgid "&Image"
|
|
msgstr "&Slika"
|
|
|
|
#: tfrmviewer.miprint.caption
|
|
msgid "Print..."
|
|
msgstr "Štampaj..."
|
|
|
|
#: tfrmviewer.mirotate.caption
|
|
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
|
|
msgid "Rotate"
|
|
msgstr "Obrni"
|
|
|
|
#: tfrmviewer.miscreenshot.caption
|
|
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
|
msgid "Screenshot"
|
|
msgstr "Slika ekrana"
|
|
|
|
#: tfrmviewer.miview.caption
|
|
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
|
msgid "&View"
|
|
msgstr "&Pregled"
|
|
|
|
#: tfrmviewer.pmiselectall.caption
|
|
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
|
msgid "Select All"
|
|
msgstr "Označi sve"
|
|
|
|
#: tfrmviewoperations.btnstartpause.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.btnstartpause.caption"
|
|
msgid "&Start"
|
|
msgstr "Početak&"
|
|
|
|
#: tfrmviewoperations.btnstop.caption
|
|
msgid "S&top"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.caption"
|
|
msgid "File operations"
|
|
msgstr "Radnje nad datotekama"
|
|
|
|
#: tfrmviewoperations.cbalwaysontop.caption
|
|
msgid "Always on top"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.lblusedragdrop.caption
|
|
msgid "&Use \"drag && drop\" to move operations between queues"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnucanceloperation.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
|
|
msgid "Cancel"
|
|
msgstr "Otkaži"
|
|
|
|
#: tfrmviewoperations.mnucancelqueue.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
|
|
msgid "Cancel"
|
|
msgstr "Otkaži"
|
|
|
|
#: tfrmviewoperations.mnunewqueue.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnunewqueue.caption"
|
|
msgid "New queue"
|
|
msgstr "Novo zakazivanje"
|
|
|
|
#: tfrmviewoperations.mnuoperationshowdetached.caption
|
|
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
|
|
msgid "Show in detached window"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnuputfirstinqueue.caption
|
|
msgid "Put first in queue"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnuputlastinqueue.caption
|
|
msgid "Put last in queue"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnuqueue.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue.caption"
|
|
msgid "Queue"
|
|
msgstr "Zakazano"
|
|
|
|
#: tfrmviewoperations.mnuqueue0.caption
|
|
msgid "Out of queue"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnuqueue1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue1.caption"
|
|
msgid "Queue 1"
|
|
msgstr "Zakazano 1"
|
|
|
|
#: tfrmviewoperations.mnuqueue2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue2.caption"
|
|
msgid "Queue 2"
|
|
msgstr "Zakazano 2"
|
|
|
|
#: tfrmviewoperations.mnuqueue3.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue3.caption"
|
|
msgid "Queue 3"
|
|
msgstr "Zakazano 3"
|
|
|
|
#: tfrmviewoperations.mnuqueue4.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue4.caption"
|
|
msgid "Queue 4"
|
|
msgstr "Zakazano 4"
|
|
|
|
#: tfrmviewoperations.mnuqueue5.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue5.caption"
|
|
msgid "Queue 5"
|
|
msgstr "Zakazano 5"
|
|
|
|
#: tfrmviewoperations.mnuqueueshowdetached.caption
|
|
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
|
|
msgid "Show in detached window"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.tbpauseall.caption
|
|
msgid "&Pause all"
|
|
msgstr ""
|
|
|
|
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When file exists"
|
|
msgstr "Kada datoteka postoji"
|
|
|
|
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When file exists"
|
|
msgstr "Kada datoteka postoji"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
|
#, fuzzy
|
|
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
|
|
msgid "Copy d&ate/time"
|
|
msgstr "Umnoži v&reme i datum"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
|
msgid "Work in background (separate connection)"
|
|
msgstr "Radi u pozadini (posebna veza)"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When file exists"
|
|
msgstr "Kada datoteka postoji"
|
|
|
|
#: uexifreader.rsdatetimeoriginal
|
|
msgid "Date taken"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsimageheight
|
|
#, fuzzy
|
|
msgctxt "uexifreader.rsimageheight"
|
|
msgid "Height"
|
|
msgstr "Visina"
|
|
|
|
#: uexifreader.rsimagewidth
|
|
#, fuzzy
|
|
msgctxt "uexifreader.rsimagewidth"
|
|
msgid "Width"
|
|
msgstr "Širina"
|
|
|
|
#: uexifreader.rsmake
|
|
msgid "Manufacturer"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsmodel
|
|
msgid "Camera model"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsorientation
|
|
msgid "Orientation"
|
|
msgstr ""
|
|
|
|
#: ulng.msgtrytolocatecrcfile
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "This file cannot be found and could help to validate final combination of files:\n"
|
|
#| "%s\n"
|
|
#| "\n"
|
|
#| "Could you make it available and press \"OK\" when ready,\n"
|
|
#| "or press \"CANCEL\" to continue without it?\n"
|
|
msgid ""
|
|
"This file cannot be found and could help to validate final combination of files:\n"
|
|
"%s\n"
|
|
"\n"
|
|
"Could you make it available and press \"OK\" when ready,\n"
|
|
"or press \"CANCEL\" to continue without it?\n"
|
|
msgstr ""
|
|
"Nisam uspeo da pronađem datoteku i da pomognem pri proveri konačnog sklopa datoteka:\n"
|
|
"%s\n"
|
|
"\n"
|
|
"Da li možete da omogućite to i pritisnite „U redu“ kada bude spremno,\n"
|
|
"ili pritisnite „OTKAŽI“ za nastavak bez toga?\n"
|
|
|
|
#: ulng.rscancelfilter
|
|
msgid "Cancel Quick Filter"
|
|
msgstr "Otkaži brzi uslov"
|
|
|
|
#: ulng.rscanceloperation
|
|
msgid "Cancel Current Operation"
|
|
msgstr "Otkaži trenutnu radnju"
|
|
|
|
#: ulng.rscaptionforaskingfilename
|
|
msgid "Enter filename, with extension, for dropped text"
|
|
msgstr ""
|
|
|
|
#: ulng.rscaptionfortextformattoimport
|
|
msgid "Text format to import"
|
|
msgstr ""
|
|
|
|
#: ulng.rschecksumverifybroken
|
|
msgid "Broken:"
|
|
msgstr "Oštećeno:"
|
|
|
|
#: ulng.rschecksumverifygeneral
|
|
msgid "General:"
|
|
msgstr "Opšte:"
|
|
|
|
#: ulng.rschecksumverifymissing
|
|
msgid "Missing:"
|
|
msgstr "Nedostaje:"
|
|
|
|
#: ulng.rschecksumverifyreaderror
|
|
msgid "Read error:"
|
|
msgstr "Greška čitanja:"
|
|
|
|
#: ulng.rschecksumverifysuccess
|
|
msgid "Success:"
|
|
msgstr "Uspeh:"
|
|
|
|
#: ulng.rschecksumverifytext
|
|
msgid "Enter checksum and select algorithm:"
|
|
msgstr "Unesi zbir za proveru i izaberi algoritam:"
|
|
|
|
#: ulng.rschecksumverifytitle
|
|
msgid "Verify checksum"
|
|
msgstr "Proveri zbir"
|
|
|
|
#: ulng.rschecksumverifytotal
|
|
msgid "Total:"
|
|
msgstr "Ukupno:"
|
|
|
|
#: ulng.rsclearfiltersornot
|
|
msgid "Do you want to clear filters for this new search?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
|
msgid "Clipboard doesn't contain any valid toolbar data."
|
|
msgstr "Ostava isečaka ne sadrži ispravne podatke trake alata."
|
|
|
|
#: ulng.rscmdcategorylistinorder
|
|
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
|
msgstr ""
|
|
|
|
#: ulng.rscmdkindofsort
|
|
msgid "Legacy sorted;A-Z sorted"
|
|
msgstr ""
|
|
|
|
#: ulng.rscolattr
|
|
msgid "Attr"
|
|
msgstr "Svojstvo"
|
|
|
|
#: ulng.rscoldate
|
|
msgctxt "ulng.rscoldate"
|
|
msgid "Date"
|
|
msgstr "Datum"
|
|
|
|
#: ulng.rscolext
|
|
msgid "Ext"
|
|
msgstr "Nastavak"
|
|
|
|
#: ulng.rscolname
|
|
msgctxt "ulng.rscolname"
|
|
msgid "Name"
|
|
msgstr "Ime"
|
|
|
|
#: ulng.rscolsize
|
|
msgctxt "ulng.rscolsize"
|
|
msgid "Size"
|
|
msgstr "Veličina"
|
|
|
|
#: ulng.rsconfcolalign
|
|
msgid "Align"
|
|
msgstr "Podvuci"
|
|
|
|
#: ulng.rsconfcolcaption
|
|
msgid "Caption"
|
|
msgstr "Naslov"
|
|
|
|
#: ulng.rsconfcoldelete
|
|
msgctxt "ulng.rsconfcoldelete"
|
|
msgid "Delete"
|
|
msgstr "Izbriši"
|
|
|
|
#: ulng.rsconfcolfieldcont
|
|
msgid "Field contents"
|
|
msgstr "Sadržaj polja"
|
|
|
|
#: ulng.rsconfcolmove
|
|
msgctxt "ulng.rsconfcolmove"
|
|
msgid "Move"
|
|
msgstr "Premesti"
|
|
|
|
#: ulng.rsconfcolwidth
|
|
msgctxt "ulng.rsconfcolwidth"
|
|
msgid "Width"
|
|
msgstr "Širina"
|
|
|
|
#: ulng.rsconfcustheader
|
|
msgid "Customize column"
|
|
msgstr "Prilagodi kolonu"
|
|
|
|
#: ulng.rsconfigurationfileassociation
|
|
msgid "Configure file association"
|
|
msgstr ""
|
|
|
|
#: ulng.rsconfirmexecution
|
|
msgid "Confirming command line and parameters"
|
|
msgstr ""
|
|
|
|
#: ulng.rscopynametemplate
|
|
msgid "Copy (%d) %s"
|
|
msgstr "Umnoži (%d) %s"
|
|
|
|
#: ulng.rsdefaultimporteddctoolbarhint
|
|
msgid "Imported DC toolbar"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdefaultimportedtctoolbarhint
|
|
msgid "Imported TC toolbar"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtext
|
|
msgid "_DroppedText"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
|
msgid "_DroppedHTMLtext"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
|
msgid "_DroppedRichtext"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
|
msgid "_DroppedSimpleText"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
|
msgid "_DroppedUnicodeUTF16text"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
|
msgid "_DroppedUnicodeUTF8text"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdiffadds
|
|
msgid " Adds: "
|
|
msgstr ""
|
|
|
|
#: ulng.rsdiffdeletes
|
|
msgid " Deletes: "
|
|
msgstr ""
|
|
|
|
#: ulng.rsdifffilesidentical
|
|
msgid "The two files are identical!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdiffmatches
|
|
msgid " Matches: "
|
|
msgstr ""
|
|
|
|
#: ulng.rsdiffmodifies
|
|
msgid " Modifies: "
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttonabort
|
|
msgid "Ab&ort"
|
|
msgstr "&Prekini"
|
|
|
|
#: ulng.rsdlgbuttonall
|
|
msgctxt "ulng.rsdlgbuttonall"
|
|
msgid "A&ll"
|
|
msgstr "&Sve"
|
|
|
|
#: ulng.rsdlgbuttonappend
|
|
msgid "A&ppend"
|
|
msgstr "&Nastavi"
|
|
|
|
#: ulng.rsdlgbuttonautorenamesource
|
|
msgid "A&uto-rename source files"
|
|
msgstr "&Samostalno preimenuj izvorne datoteke"
|
|
|
|
#: ulng.rsdlgbuttoncancel
|
|
msgctxt "ulng.rsdlgbuttoncancel"
|
|
msgid "&Cancel"
|
|
msgstr "&Otkaži"
|
|
|
|
#: ulng.rsdlgbuttoncompare
|
|
msgid "Compare &by content"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttoncontinue
|
|
msgid "&Continue"
|
|
msgstr "&Nastavi"
|
|
|
|
#: ulng.rsdlgbuttoncopyinto
|
|
#, fuzzy
|
|
#| msgid "Copy &Into"
|
|
msgid "&Merge"
|
|
msgstr "Umnoži &u"
|
|
|
|
#: ulng.rsdlgbuttoncopyintoall
|
|
#, fuzzy
|
|
#| msgid "Copy Into &All"
|
|
msgid "Mer&ge All"
|
|
msgstr "Umnoži u &sve"
|
|
|
|
#: ulng.rsdlgbuttonexitprogram
|
|
msgid "E&xit program"
|
|
msgstr "Napusti& program"
|
|
|
|
#: ulng.rsdlgbuttonignore
|
|
msgid "Ig&nore"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttonignoreall
|
|
msgid "I&gnore All"
|
|
msgstr "Zanemari& sve"
|
|
|
|
#: ulng.rsdlgbuttonno
|
|
msgid "&No"
|
|
msgstr "&Ne"
|
|
|
|
#: ulng.rsdlgbuttonnone
|
|
msgid "Non&e"
|
|
msgstr "&Ništa"
|
|
|
|
#: ulng.rsdlgbuttonok
|
|
msgctxt "ulng.rsdlgbuttonok"
|
|
msgid "&OK"
|
|
msgstr "&U redu"
|
|
|
|
#: ulng.rsdlgbuttonother
|
|
msgid "Ot&her"
|
|
msgstr "drugo&"
|
|
|
|
#: ulng.rsdlgbuttonoverwrite
|
|
msgid "&Overwrite"
|
|
msgstr "&Prepiši"
|
|
|
|
#: ulng.rsdlgbuttonoverwriteall
|
|
msgid "Overwrite &All"
|
|
msgstr "Prepiši &sve"
|
|
|
|
#: ulng.rsdlgbuttonoverwritelarger
|
|
msgid "Overwrite All &Larger"
|
|
msgstr "Prepiši sve &veće"
|
|
|
|
#: ulng.rsdlgbuttonoverwriteolder
|
|
msgid "Overwrite All Ol&der"
|
|
msgstr "Prepiši sve &starije"
|
|
|
|
#: ulng.rsdlgbuttonoverwritesmaller
|
|
msgid "Overwrite All S&maller"
|
|
msgstr "Prepiši sve &Manje"
|
|
|
|
#: ulng.rsdlgbuttonrename
|
|
msgctxt "ulng.rsdlgbuttonrename"
|
|
msgid "R&ename"
|
|
msgstr "P&reimenuj"
|
|
|
|
#: ulng.rsdlgbuttonresume
|
|
msgid "&Resume"
|
|
msgstr "&Nastavi"
|
|
|
|
#: ulng.rsdlgbuttonretry
|
|
msgid "Re&try"
|
|
msgstr "Po&novo pokušaj"
|
|
|
|
#: ulng.rsdlgbuttonretryadmin
|
|
msgid "As Ad&ministrator"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttonskip
|
|
msgid "&Skip"
|
|
msgstr "&Preskoči"
|
|
|
|
#: ulng.rsdlgbuttonskipall
|
|
msgid "S&kip All"
|
|
msgstr "Preskoči& sve"
|
|
|
|
#: ulng.rsdlgbuttonunlock
|
|
msgid "&Unlock"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttonyes
|
|
msgid "&Yes"
|
|
msgstr "&Da"
|
|
|
|
#: ulng.rsdlgcp
|
|
msgctxt "ulng.rsdlgcp"
|
|
msgid "Copy file(s)"
|
|
msgstr "Umnoži datoteku(e)"
|
|
|
|
#: ulng.rsdlgmv
|
|
msgid "Move file(s)"
|
|
msgstr "Premesti datoteku(e)"
|
|
|
|
#: ulng.rsdlgoppause
|
|
msgctxt "ulng.rsdlgoppause"
|
|
msgid "Pau&se"
|
|
msgstr "Zastanak&"
|
|
|
|
#: ulng.rsdlgopstart
|
|
msgctxt "ulng.rsdlgopstart"
|
|
msgid "&Start"
|
|
msgstr "Početak&"
|
|
|
|
#: ulng.rsdlgqueue
|
|
msgctxt "ulng.rsdlgqueue"
|
|
msgid "Queue"
|
|
msgstr "Zakazano"
|
|
|
|
#: ulng.rsdlgspeed
|
|
msgid "Speed %s/s"
|
|
msgstr "Brzina %s/s"
|
|
|
|
#: ulng.rsdlgspeedtime
|
|
msgid "Speed %s/s, time remaining %s"
|
|
msgstr "Brzina %s/s, preostalo vreme %s"
|
|
|
|
#: ulng.rsdraganddroptextformat
|
|
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdrivenolabel
|
|
msgid "<no label>"
|
|
msgstr "<bez oznake>"
|
|
|
|
#: ulng.rsdrivenomedia
|
|
msgid "<no media>"
|
|
msgstr "<nema uređaja>"
|
|
|
|
#: ulng.rseditabouttext
|
|
msgid "Internal Editor of Double Commander."
|
|
msgstr "Unutrašnji uređivač Double Commander-a."
|
|
|
|
#: ulng.rseditgotolinequery
|
|
msgid "Goto line:"
|
|
msgstr "Idi na liniju:"
|
|
|
|
#: ulng.rseditgotolinetitle
|
|
msgctxt "ulng.rseditgotolinetitle"
|
|
msgid "Goto Line"
|
|
msgstr "Idi na liniju"
|
|
|
|
#: ulng.rseditnewfile
|
|
msgid "new.txt"
|
|
msgstr "novi.txt"
|
|
|
|
#: ulng.rseditnewfilename
|
|
msgid "Filename:"
|
|
msgstr "Ime datoteke:"
|
|
|
|
#: ulng.rseditnewopen
|
|
msgid "Open file"
|
|
msgstr "Otvori datoteku"
|
|
|
|
#: ulng.rseditsearchback
|
|
msgid "&Backward"
|
|
msgstr "&Unazad"
|
|
|
|
#: ulng.rseditsearchcaption
|
|
msgctxt "ulng.rseditsearchcaption"
|
|
msgid "Search"
|
|
msgstr "Traži"
|
|
|
|
#: ulng.rseditsearchfrw
|
|
msgid "&Forward"
|
|
msgstr "&Unapred"
|
|
|
|
#: ulng.rseditsearchreplace
|
|
msgctxt "ulng.rseditsearchreplace"
|
|
msgid "Replace"
|
|
msgstr "Zameni"
|
|
|
|
#: ulng.rseditwithexternaleditor
|
|
msgid "with external editor"
|
|
msgstr ""
|
|
|
|
#: ulng.rseditwithinternaleditor
|
|
msgid "with internal editor"
|
|
msgstr ""
|
|
|
|
#: ulng.rsexecuteviashell
|
|
msgctxt "ulng.rsexecuteviashell"
|
|
msgid "Execute via shell"
|
|
msgstr ""
|
|
|
|
#: ulng.rsexecuteviaterminalclose
|
|
msgctxt "ulng.rsexecuteviaterminalclose"
|
|
msgid "Execute via terminal and close"
|
|
msgstr ""
|
|
|
|
#: ulng.rsexecuteviaterminalstayopen
|
|
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
|
msgid "Execute via terminal and stay open"
|
|
msgstr ""
|
|
|
|
#: ulng.rsfavtabspanelsideselection
|
|
msgid "Left;Right;Active;Inactive;Both;None"
|
|
msgstr ""
|
|
|
|
#: ulng.rsfavtabssavedirhistory
|
|
msgid "No;Yes"
|
|
msgstr ""
|
|
|
|
#: ulng.rsfilenameexportedtcbarprefix
|
|
msgid "Exported_from_DC"
|
|
msgstr ""
|
|
|
|
#: ulng.rsfileopdirectoryexistsoptions
|
|
#, fuzzy
|
|
#| msgid "Ask;Overwrite;Copy into;Skip"
|
|
msgid "Ask;Merge;Skip"
|
|
msgstr "Pitaj;Prepiši;Umnoži;Preskoči"
|
|
|
|
#: ulng.rsfileopfileexistsoptions
|
|
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
|
msgstr "Pitaj;Prepiši;Prepiši starije;Preskoči"
|
|
|
|
#: ulng.rsfileopsetpropertyerroroptions
|
|
msgctxt "ulng.rsfileopsetpropertyerroroptions"
|
|
msgid "Ask;Don't set anymore;Ignore errors"
|
|
msgstr "Pitaj;Ne postavljaj više;Zanemari greške"
|
|
|
|
#: ulng.rsfilterstatus
|
|
msgid "FILTER"
|
|
msgstr "Uslov"
|
|
|
|
#: ulng.rsfinddefinetemplate
|
|
msgid "Define template"
|
|
msgstr "Odredi obrazac"
|
|
|
|
#: ulng.rsfinddepth
|
|
msgid "%s level(s)"
|
|
msgstr "%s stupanj(s)"
|
|
|
|
#: ulng.rsfinddepthall
|
|
msgid "all (unlimited depth)"
|
|
msgstr "sve (neograničena dubina)"
|
|
|
|
#: ulng.rsfinddepthcurdir
|
|
msgid "current dir only"
|
|
msgstr "samo trenutnu fasciklu"
|
|
|
|
#: ulng.rsfinddirnoex
|
|
msgid "Directory %s does not exist!"
|
|
msgstr "Fascikla %s ne postoji. "
|
|
|
|
#: ulng.rsfindfound
|
|
msgctxt "ulng.rsfindfound"
|
|
msgid "Found: %d"
|
|
msgstr "Pronašao sam: %d"
|
|
|
|
#: ulng.rsfindsavetemplatecaption
|
|
msgid "Save search template"
|
|
msgstr "Sačuvaj obrazac pretrage"
|
|
|
|
#: ulng.rsfindsavetemplatetitle
|
|
msgid "Template name:"
|
|
msgstr "Ime obrasca:"
|
|
|
|
#: ulng.rsfindscanned
|
|
msgctxt "ulng.rsfindscanned"
|
|
msgid "Scanned: %d"
|
|
msgstr "Pregledano je: %d"
|
|
|
|
#: ulng.rsfindscanning
|
|
msgid "Scanning"
|
|
msgstr "Pregledam"
|
|
|
|
#: ulng.rsfindsearchfiles
|
|
msgctxt "ulng.rsfindsearchfiles"
|
|
msgid "Find files"
|
|
msgstr "Nađi datoteke"
|
|
|
|
#: ulng.rsfindtimeofscan
|
|
msgid "Time of scan: "
|
|
msgstr ""
|
|
|
|
#: ulng.rsfindwherebeg
|
|
msgid "Begin at"
|
|
msgstr "Počni sa"
|
|
|
|
#: ulng.rsfreemsg
|
|
msgid "Free %s from %s bytes"
|
|
msgstr "Slobodno je %s od %s bajta"
|
|
|
|
#: ulng.rsfreemsgshort
|
|
msgid "%s bytes free"
|
|
msgstr "%s bajta je slobodno"
|
|
|
|
#: ulng.rsfuncatime
|
|
msgid "Access date/time"
|
|
msgstr "Datum i vreme pristupa"
|
|
|
|
#: ulng.rsfuncattr
|
|
msgctxt "ulng.rsfuncattr"
|
|
msgid "Attributes"
|
|
msgstr "Svojstva"
|
|
|
|
#: ulng.rsfunccomment
|
|
msgctxt "ulng.rsfunccomment"
|
|
msgid "Comment"
|
|
msgstr "Napomena"
|
|
|
|
#: ulng.rsfunccompressedsize
|
|
msgid "Compressed size"
|
|
msgstr "Veličina skladišta"
|
|
|
|
#: ulng.rsfuncctime
|
|
msgid "Creation date/time"
|
|
msgstr "Datum i vreme nastanka"
|
|
|
|
#: ulng.rsfuncext
|
|
msgid "Extension"
|
|
msgstr "Nastavak"
|
|
|
|
#: ulng.rsfuncgroup
|
|
msgctxt "ulng.rsfuncgroup"
|
|
msgid "Group"
|
|
msgstr "Udruženje"
|
|
|
|
#: ulng.rsfunchtime
|
|
msgid "Change date/time"
|
|
msgstr ""
|
|
|
|
#: ulng.rsfunclinkto
|
|
msgid "Link to"
|
|
msgstr "Veza do"
|
|
|
|
#: ulng.rsfuncmtime
|
|
msgid "Modification date/time"
|
|
msgstr "Datum i vreme izmene"
|
|
|
|
#: ulng.rsfuncname
|
|
msgctxt "ulng.rsfuncname"
|
|
msgid "Name"
|
|
msgstr "Ime"
|
|
|
|
#: ulng.rsfuncnamenoext
|
|
msgid "Name without extension"
|
|
msgstr "Ime bez nastavka"
|
|
|
|
#: ulng.rsfuncowner
|
|
msgctxt "ulng.rsfuncowner"
|
|
msgid "Owner"
|
|
msgstr "Vlasnik"
|
|
|
|
#: ulng.rsfuncpath
|
|
msgctxt "ulng.rsfuncpath"
|
|
msgid "Path"
|
|
msgstr "Putanja"
|
|
|
|
#: ulng.rsfuncsize
|
|
msgctxt "ulng.rsfuncsize"
|
|
msgid "Size"
|
|
msgstr "Veličina"
|
|
|
|
#: ulng.rsfunctype
|
|
msgid "Type"
|
|
msgstr "Vrsta"
|
|
|
|
#: ulng.rsharderrcreate
|
|
msgid "Error creating hardlink."
|
|
msgstr "Desila se greška pri stvaranju čvrste veze"
|
|
|
|
#: ulng.rshotdirforcesortingorderchoices
|
|
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotdirwarningabortrestorebackup
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
|
#| "\n"
|
|
#| "Are you sure you want to proceed?\n"
|
|
msgid ""
|
|
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
|
"\n"
|
|
"Are you sure you want to proceed?\n"
|
|
msgstr ""
|
|
"Upozorenje: Pri vraćanju datoteke .hotlist iz ostave, trenutni spisak će biti izbrisan i zamenjen uvezenim.\n"
|
|
"\n"
|
|
"Da li sigurno želite da nastavite?\n"
|
|
|
|
#: ulng.rshotkeycategorycopymovedialog
|
|
msgid "Copy/Move Dialog"
|
|
msgstr "Prozorče umnožavanja i premeštanja"
|
|
|
|
#: ulng.rshotkeycategorydiffer
|
|
msgctxt "ulng.rshotkeycategorydiffer"
|
|
msgid "Differ"
|
|
msgstr "Program za razlike"
|
|
|
|
#: ulng.rshotkeycategoryeditcommentdialog
|
|
msgid "Edit Comment Dialog"
|
|
msgstr "Uredite napomenu"
|
|
|
|
#: ulng.rshotkeycategoryeditor
|
|
#, fuzzy
|
|
msgctxt "ulng.rshotkeycategoryeditor"
|
|
msgid "Editor"
|
|
msgstr "Uređivač"
|
|
|
|
#: ulng.rshotkeycategoryfindfiles
|
|
#, fuzzy
|
|
msgctxt "ulng.rshotkeycategoryfindfiles"
|
|
msgid "Find files"
|
|
msgstr "Nađi datoteke"
|
|
|
|
#: ulng.rshotkeycategorymain
|
|
msgid "Main"
|
|
msgstr "Glavni"
|
|
|
|
#: ulng.rshotkeycategorysyncdirs
|
|
msgid "Synchronize Directories"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeycategoryviewer
|
|
msgctxt "ulng.rshotkeycategoryviewer"
|
|
msgid "Viewer"
|
|
msgstr "Preglednik"
|
|
|
|
#: ulng.rshotkeyfilealreadyexists
|
|
msgid ""
|
|
"A setup with that name already exists.\n"
|
|
"Do you want to overwrite it?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileconfirmdefault
|
|
msgid "Are you sure you want to restore default?"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileconfirmerasure
|
|
msgid "Are you sure you want to erase setup \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilecopyof
|
|
msgid "Copy of %s"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileinputnewname
|
|
msgid "Input your new name"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilemustkeepone
|
|
msgid "You must keep at least one shortcut file."
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilenewname
|
|
msgid "New name"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilesavemodified
|
|
msgid ""
|
|
"\"%s\" setup has been modified.\n"
|
|
"Do you want to save it now?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeynoscenter
|
|
msgid "No shortcut with \"ENTER\""
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeysortorder
|
|
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsimporttoolbarproblem
|
|
msgid "Cannot find reference to default bar file"
|
|
msgstr ""
|
|
|
|
#: ulng.rslistoffindfileswindows
|
|
msgid "List of \"Find files\" windows"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmarkminus
|
|
msgid "Unselect mask"
|
|
msgstr "Odznači masku"
|
|
|
|
#: ulng.rsmarkplus
|
|
msgid "Select mask"
|
|
msgstr "Označi masku"
|
|
|
|
#: ulng.rsmaskinput
|
|
msgid "Input mask:"
|
|
msgstr "Unesi masku:"
|
|
|
|
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
|
msgid "A columns view with that name already exists."
|
|
msgstr ""
|
|
|
|
#: ulng.rsmenuconfigurecolumnssavetochange
|
|
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmenuconfigurecustomcolumns
|
|
msgid "Configure custom columns"
|
|
msgstr "Podesite prilagođene stupce"
|
|
|
|
#: ulng.rsmenuconfigureentercustomcolumnname
|
|
msgid "Enter new custom columns name"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnuactions
|
|
msgctxt "ulng.rsmnuactions"
|
|
msgid "Actions"
|
|
msgstr "Radnje"
|
|
|
|
#: ulng.rsmnucontentdefault
|
|
msgid "<Default>"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnucontentoctal
|
|
msgid "Octal"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnucopynetnamestoclip
|
|
msgid "Copy names with UNC path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnudisconnectnetworkdrive
|
|
msgid "Disconnect Network Drive..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnuedit
|
|
msgctxt "ulng.rsmnuedit"
|
|
msgid "Edit"
|
|
msgstr "Uredi"
|
|
|
|
#: ulng.rsmnueject
|
|
msgid "Eject"
|
|
msgstr "Izbaci"
|
|
|
|
#: ulng.rsmnuextracthere
|
|
msgid "Extract here..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnumapnetworkdrive
|
|
msgid "Map Network Drive..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnumount
|
|
msgid "Mount"
|
|
msgstr "Prikači"
|
|
|
|
#: ulng.rsmnunew
|
|
msgctxt "ulng.rsmnunew"
|
|
msgid "New"
|
|
msgstr "Nova"
|
|
|
|
#: ulng.rsmnunomedia
|
|
msgid "No media available"
|
|
msgstr "Nema dostupnih uređaja"
|
|
|
|
#: ulng.rsmnuopen
|
|
#, fuzzy
|
|
msgctxt "ulng.rsmnuopen"
|
|
msgid "Open"
|
|
msgstr "Otvori"
|
|
|
|
#: ulng.rsmnuopenwith
|
|
msgctxt "ulng.rsmnuopenwith"
|
|
msgid "Open with"
|
|
msgstr "Otvori sa"
|
|
|
|
#: ulng.rsmnuopenwithother
|
|
msgctxt "ulng.rsmnuopenwithother"
|
|
msgid "Other..."
|
|
msgstr "Drugo..."
|
|
|
|
#: ulng.rsmnupackhere
|
|
msgid "Pack here..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnusortby
|
|
msgid "Sort by"
|
|
msgstr "Razvrstaj po"
|
|
|
|
#: ulng.rsmnuumount
|
|
msgid "Unmount"
|
|
msgstr "Otkači"
|
|
|
|
#: ulng.rsmnuview
|
|
msgctxt "ulng.rsmnuview"
|
|
msgid "View"
|
|
msgstr "Prikaži"
|
|
|
|
#: ulng.rsmsgaccount
|
|
msgid "Account:"
|
|
msgstr "Nalog:"
|
|
|
|
#: ulng.rsmsgalldcintcmds
|
|
msgid "All Double Commander internal commands"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgapplicationname
|
|
msgid "Description: %s"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgarchivercustomparams
|
|
msgid "Additional parameters for archiver command-line:"
|
|
msgstr "Dodatne odrednice za naredbenu liniju programa sažimanja:"
|
|
|
|
#: ulng.rsmsgaskquoteornot
|
|
msgid "Do you want to enclose between quotes?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgbadcrc32
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "Bad CRC32 for resulting file:\n"
|
|
#| "\"%s\"\n"
|
|
#| "\n"
|
|
#| "Do you want to keep the resulting corrupted file anyway?\n"
|
|
msgid ""
|
|
"Bad CRC32 for resulting file:\n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Do you want to keep the resulting corrupted file anyway?\n"
|
|
msgstr ""
|
|
"Izlazna datoteka CRC32 je neispravna:\n"
|
|
"„%s“\n"
|
|
"\n"
|
|
"Da li želite da zadržite neispravnu datoteku?\n"
|
|
|
|
#: ulng.rsmsgcannotcopymoveitself
|
|
msgid "You can not copy/move a file \"%s\" to itself!"
|
|
msgstr "Ne možete umnožavati i premeštati u samu datoteku „%s“!"
|
|
|
|
#: ulng.rsmsgcannotdeletedirectory
|
|
msgid "Cannot delete directory %s"
|
|
msgstr "Ne možete izbrisati %s"
|
|
|
|
#: ulng.rsmsgcannotoverwritedirectory
|
|
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgchdirfailed
|
|
msgid "ChDir to [%s] failed!"
|
|
msgstr "Nisam uspeo da pređem na fasciklu [%s]."
|
|
|
|
#: ulng.rsmsgcloseallinactivetabs
|
|
msgid "Remove all inactive tabs?"
|
|
msgstr "Da li da uklonim sve kartice koje se ne koriste?"
|
|
|
|
#: ulng.rsmsgcloselockedtab
|
|
msgid "This tab (%s) is locked! Close anyway?"
|
|
msgstr "Kartica (%s) je zaključana. Da li da je uprkos tome zatvorim?"
|
|
|
|
#: ulng.rsmsgcofirmuserparam
|
|
msgid "Confirmation of parameter"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgconfirmquit
|
|
msgid "Are you sure you want to quit?"
|
|
msgstr "Da li ste sigurni da želite napustiti program?"
|
|
|
|
#: ulng.rsmsgcopybackward
|
|
msgid "The file %s has changed. Do you want to copy it backward?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgcouldnotcopybackward
|
|
msgid "Could not copy backward - do you want to keep the changed file?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgcpfldr
|
|
msgid "Copy %d selected files/directories?"
|
|
msgstr "Da li da umnožim %d odabranih datoteka/fascikli?"
|
|
|
|
#: ulng.rsmsgcpsel
|
|
msgid "Copy selected \"%s\"?"
|
|
msgstr "Da umnožim odabrano „%s“?"
|
|
|
|
#: ulng.rsmsgcreateanewfiletype
|
|
msgid "< Create a new file type \"%s files\" >"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgdctoolbarwheretosave
|
|
msgid "Enter location and filename where to save a DC Toolbar file"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgdefaultcustomactionname
|
|
msgid "Custom action"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgdeletepartiallycopied
|
|
msgid "Delete the partially copied file ?"
|
|
msgstr "Da li da izbrišem delimično umnoženu datoteku ?"
|
|
|
|
#: ulng.rsmsgdelfldr
|
|
msgid "Delete %d selected files/directories?"
|
|
msgstr "Da li da izbrišem %d odabranih datoteka/fascikli?"
|
|
|
|
#: ulng.rsmsgdelfldrt
|
|
msgid "Delete %d selected files/directories into trash can?"
|
|
msgstr "Da li da premestim %d odabrane datoteke/fascikle u smeće?"
|
|
|
|
#: ulng.rsmsgdelsel
|
|
msgid "Delete selected \"%s\"?"
|
|
msgstr "Da li da izbrišem odabrani „%s“?"
|
|
|
|
#: ulng.rsmsgdelselt
|
|
msgid "Delete selected \"%s\" into trash can?"
|
|
msgstr "Da li da premestim odabrano „%s“ u smeće?"
|
|
|
|
#: ulng.rsmsgdeltotrashforce
|
|
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
|
msgstr "Nisam uspeo da premestim „%s“ u smeće. Da li da ga izbrišem?"
|
|
|
|
#: ulng.rsmsgdisknotavail
|
|
msgid "Disk is not available"
|
|
msgstr "Disk nije dostupan"
|
|
|
|
#: ulng.rsmsgentercustomaction
|
|
msgid "Enter custom action name:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgenterfileext
|
|
msgid "Enter file extension:"
|
|
msgstr "Unesite nastavak datoteke:"
|
|
|
|
#: ulng.rsmsgentername
|
|
msgid "Enter name:"
|
|
msgstr "Unesite ime:"
|
|
|
|
#: ulng.rsmsgenternewfiletypename
|
|
msgid "Enter name of new file type to create for extension \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgerrbadarchive
|
|
msgid "CRC error in archive data"
|
|
msgstr "Desila se CRC greška u podacima skladišta"
|
|
|
|
#: ulng.rsmsgerrbaddata
|
|
msgid "Data is bad"
|
|
msgstr "Podaci su oštećeni"
|
|
|
|
#: ulng.rsmsgerrcannotconnect
|
|
msgid "Can not connect to server: \"%s\""
|
|
msgstr "Nisam uspeo da se povežem sa služiteljem „%s“"
|
|
|
|
#: ulng.rsmsgerrcannotcopyfile
|
|
msgid "Cannot copy file %s to %s"
|
|
msgstr "Nisam uspeo da umnožim datoteku %s u %s"
|
|
|
|
#: ulng.rsmsgerrcreatefiledirectoryexists
|
|
msgid "There already exists a directory named \"%s\"."
|
|
msgstr "Datoteka pod imenom „%s“ već postoji."
|
|
|
|
#: ulng.rsmsgerrdatenotsupported
|
|
msgid "Date %s is not supported"
|
|
msgstr "Datum %s nije podržan"
|
|
|
|
#: ulng.rsmsgerrdirexists
|
|
msgid "Directory %s exists!"
|
|
msgstr "Fascikla %s već postoji."
|
|
|
|
#: ulng.rsmsgerreaborted
|
|
msgid "Function aborted by user"
|
|
msgstr "Korisnik je prekinuo tekuću radnju"
|
|
|
|
#: ulng.rsmsgerreclose
|
|
msgid "Error closing file"
|
|
msgstr "Desila se greška pri zatvaranju datoteke"
|
|
|
|
#: ulng.rsmsgerrecreate
|
|
msgid "Cannot create file"
|
|
msgstr "Nisam uspeo da obrazujem datoteku"
|
|
|
|
#: ulng.rsmsgerrendarchive
|
|
msgid "No more files in archive"
|
|
msgstr "Nema više datoteka u arhivi"
|
|
|
|
#: ulng.rsmsgerreopen
|
|
msgid "Cannot open existing file"
|
|
msgstr "Nisam uspeo da otvorim postojeću datoteku"
|
|
|
|
#: ulng.rsmsgerreread
|
|
msgid "Error reading from file"
|
|
msgstr "Desila se greška pri čitanju datoteke"
|
|
|
|
#: ulng.rsmsgerrewrite
|
|
msgid "Error writing to file"
|
|
msgstr "Desila se greška pri upisu u datoteku"
|
|
|
|
#: ulng.rsmsgerrforcedir
|
|
msgid "Can not create directory %s!"
|
|
msgstr "Nisam uspeo da obrazujem fasciklu %s."
|
|
|
|
#: ulng.rsmsgerrinvalidlink
|
|
msgid "Invalid link"
|
|
msgstr "Veza nije ispravna"
|
|
|
|
#: ulng.rsmsgerrnofiles
|
|
msgid "No files found"
|
|
msgstr "Nisam pronašao datoteke"
|
|
|
|
#: ulng.rsmsgerrnomemory
|
|
msgid "Not enough memory"
|
|
msgstr "Nema dovoljno memorije"
|
|
|
|
#: ulng.rsmsgerrnotsupported
|
|
msgid "Function not supported!"
|
|
msgstr "Radnja nije podržana."
|
|
|
|
#: ulng.rsmsgerrorincontextmenucommand
|
|
msgid "Error in context menu command"
|
|
msgstr "Desila se greška u priručnom izborniku"
|
|
|
|
#: ulng.rsmsgerrorloadingconfiguration
|
|
msgid "Error when loading configuration"
|
|
msgstr "Desila se greška prilikom učitavanja postavki"
|
|
|
|
#: ulng.rsmsgerrregexpsyntax
|
|
msgid "Syntax error in regular expression!"
|
|
msgstr "Postoji sintaksna greška u regularnom izrazu"
|
|
|
|
#: ulng.rsmsgerrrename
|
|
msgid "Cannot rename file %s to %s"
|
|
msgstr "Nisam uspeo da promenim naziv datoteke %s u %s"
|
|
|
|
#: ulng.rsmsgerrsaveassociation
|
|
msgid "Can not save association!"
|
|
msgstr "Nisam uspeo da sačuvam pridruživanje datoteka programima."
|
|
|
|
#: ulng.rsmsgerrsavefile
|
|
msgid "Cannot save file"
|
|
msgstr "Nisam uspeo da sačuvam datoteku"
|
|
|
|
#: ulng.rsmsgerrsetattribute
|
|
msgid "Can not set attributes for \"%s\""
|
|
msgstr "Nisam uspeo da postavim svojstva datoteci „%s“"
|
|
|
|
#: ulng.rsmsgerrsetdatetime
|
|
msgid "Can not set date/time for \"%s\""
|
|
msgstr "Nisam uspeo da postavim datum i vreme datoteci „%s“"
|
|
|
|
#: ulng.rsmsgerrsetownership
|
|
msgid "Can not set owner/group for \"%s\""
|
|
msgstr "Nisam uspeo da postavim vlasnika/udruženje datoteci %s“"
|
|
|
|
#: ulng.rsmsgerrsetpermissions
|
|
msgid "Can not set permissions for \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgerrsmallbuf
|
|
msgid "Buffer too small"
|
|
msgstr "Prihvatna memorija je premala"
|
|
|
|
#: ulng.rsmsgerrtoomanyfiles
|
|
msgid "Too many files to pack"
|
|
msgstr "Previše datoteka je izabrano za sažimanje"
|
|
|
|
#: ulng.rsmsgerrunknownformat
|
|
msgid "Archive format unknown"
|
|
msgstr "Nije poznat oblik željene datoteke za sažimanje"
|
|
|
|
#: ulng.rsmsgexecutablepath
|
|
msgid "Executable: %s"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsdeleteallentries
|
|
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsdraghereentry
|
|
msgid "Drag here other entries"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsentername
|
|
msgid "Enter a name for this new Favorite Tabs entry:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsenternametitle
|
|
msgid "Saving a new Favorite Tabs entry"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
|
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsextramode
|
|
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
|
msgid "Number of file(s) imported successfully: %d on %d"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
|
msgid "Legacy tabs imported"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsimporttitle
|
|
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
|
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabssimplemode
|
|
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
|
msgid "Keep saving dir history with Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavoritetabssubmenuname
|
|
#, fuzzy
|
|
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
|
msgid "Submenu name"
|
|
msgstr "Ime podizbornika"
|
|
|
|
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
|
msgid "This will load the Favorite Tabs: \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfavortietabssaveoverexisting
|
|
msgid "Save current tabs over existing Favorite Tabs entry"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfilechangedsave
|
|
msgid "File %s changed, save?"
|
|
msgstr "Datoteka %s je izmenjena. Da li da je sačuvam?"
|
|
|
|
#: ulng.rsmsgfileexistsfileinfo
|
|
msgid "%s bytes, %s"
|
|
msgstr "%s bajta, %s"
|
|
|
|
#: ulng.rsmsgfileexistsoverwrite
|
|
msgid "Overwrite:"
|
|
msgstr "Prepiši:"
|
|
|
|
#: ulng.rsmsgfileexistsrwrt
|
|
msgid "File %s exists, overwrite?"
|
|
msgstr "Datoteka %s već postoji, da li da je prepišem?"
|
|
|
|
#: ulng.rsmsgfileexistswithfile
|
|
msgid "With file:"
|
|
msgstr "Datotekom:"
|
|
|
|
#: ulng.rsmsgfilenotfound
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Nisam uspeo da pronađem datoteku „%s“."
|
|
|
|
#: ulng.rsmsgfileoperationsactive
|
|
msgid "File operations active"
|
|
msgstr "U pogonu je radnja nad datotekama"
|
|
|
|
#: ulng.rsmsgfileoperationsactivelong
|
|
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
|
msgstr "Neke radnje nad datotekama nisu dovršene. Zatvaranje Double Commander-a može dovesti do gubljenja podataka."
|
|
|
|
#: ulng.rsmsgfilepathovermaxpath
|
|
msgid ""
|
|
"The target name length (%d) is more than %d characters!\n"
|
|
"%s\n"
|
|
"Most programs will not be able to access a file/directory with such a long name!\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfilereadonly
|
|
#, fuzzy
|
|
#| msgid "File %s is marked as read-only. Delete it?"
|
|
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
|
msgstr "Datoteka %s je samo za čitanje. Da li da je izbrišem?"
|
|
|
|
#: ulng.rsmsgfilereloadwarning
|
|
msgid "Are you sure you want to reload the current file and lose the changes?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfilesizetoobig
|
|
msgid "The file size of \"%s\" is too big for destination file system!"
|
|
msgstr "Datoteka veličine „%s“ je prevelika za odredišni sistem datoteka."
|
|
|
|
#: ulng.rsmsgfolderexistsrwrt
|
|
#, fuzzy
|
|
#| msgid "Folder %s exists, overwrite?"
|
|
msgid "Folder %s exists, merge?"
|
|
msgstr "Datoteka %s postoji. Da li da je prepišem?"
|
|
|
|
#: ulng.rsmsgfollowsymlink
|
|
msgid "Follow symlink \"%s\"?"
|
|
msgstr "Da li da pratim simboličku vezu „%s“?"
|
|
|
|
#: ulng.rsmsgfortextformattoimport
|
|
msgid "Select the text format to import"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsghotdiraddselecteddirectories
|
|
msgid "Add %d selected dirs"
|
|
msgstr "Dodaj %d označenih fascikli"
|
|
|
|
#: ulng.rsmsghotdiraddselecteddirectory
|
|
msgid "Add selected dir: "
|
|
msgstr "Dodaj označenu fasciklu: "
|
|
|
|
#: ulng.rsmsghotdiraddthisdirectory
|
|
msgid "Add current dir: "
|
|
msgstr "Dodaj trenutnu fasciklu: "
|
|
|
|
#: ulng.rsmsghotdircommandname
|
|
msgid "Do command"
|
|
msgstr "Naredba za izvršenje"
|
|
|
|
#: ulng.rsmsghotdircommandsample
|
|
msgid "cm_somthing"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsghotdirconfighotlist
|
|
msgctxt "ulng.rsmsghotdirconfighotlist"
|
|
msgid "Configuration of Directory Hotlist"
|
|
msgstr "Postavke brzog spiska fascikli"
|
|
|
|
#: ulng.rsmsghotdirdeleteallentries
|
|
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
|
msgstr "Da li ste sigurni da želite ukloniti sve unose iz brzog spiska fascikli? (Opoziv ove radnje je nemoguć!)"
|
|
|
|
#: ulng.rsmsghotdirdemocommand
|
|
msgid "This will execute the following command:"
|
|
msgstr "Ovo će izvršiti sledeću naredbu:"
|
|
|
|
#: ulng.rsmsghotdirdemoname
|
|
msgid "This is hot dir named "
|
|
msgstr "Ovo je imenovano kao brza fascikla."
|
|
|
|
#: ulng.rsmsghotdirdemopath
|
|
msgid "This will change active frame to the following path:"
|
|
msgstr "Ovo će izmeniti radni okvir na sledeću putanju:"
|
|
|
|
#: ulng.rsmsghotdirdemotarget
|
|
msgid "And inactive frame would change to the following path:"
|
|
msgstr "I neradni okvir će se izmeniti na sledeću putanju:"
|
|
|
|
#: ulng.rsmsghotdirerrorbackuping
|
|
msgid "Error backuping entries..."
|
|
msgstr "Desila se greška prilikom smeštaja stavki u ostavu..."
|
|
|
|
#: ulng.rsmsghotdirerrorexporting
|
|
msgid "Error exporting entries..."
|
|
msgstr "Desila se greška prilikom izvoza stavki..."
|
|
|
|
#: ulng.rsmsghotdirexportall
|
|
msgid "Export all!"
|
|
msgstr "Izvezi sve!"
|
|
|
|
#: ulng.rsmsghotdirexporthotlist
|
|
msgid "Export Directory Hotlist - Select the entries you want to export"
|
|
msgstr "Izvezi brzi spisak fascikli - Izaberite stavke koje želite da izvezete"
|
|
|
|
#: ulng.rsmsghotdirexportsel
|
|
msgid "Export selected"
|
|
msgstr "Izvezi odabrane"
|
|
|
|
#: ulng.rsmsghotdirimportall
|
|
msgctxt "ulng.rsmsghotdirimportall"
|
|
msgid "Import all!"
|
|
msgstr "Uvezi sve!"
|
|
|
|
#: ulng.rsmsghotdirimporthotlist
|
|
msgid "Import Directory Hotlist - Select the entries you want to import"
|
|
msgstr "Uvezi brzi spisak fascikli - Izaberite stavke koje želite da uvezete"
|
|
|
|
#: ulng.rsmsghotdirimportsel
|
|
msgctxt "ulng.rsmsghotdirimportsel"
|
|
msgid "Import selected"
|
|
msgstr "Uvezi izabrano"
|
|
|
|
#: ulng.rsmsghotdirjustpath
|
|
msgctxt "ulng.rsmsghotdirjustpath"
|
|
msgid "&Path:"
|
|
msgstr "Putanja"
|
|
|
|
#: ulng.rsmsghotdirlocatehotlistfile
|
|
msgid "Locate \".hotlist\" file to import"
|
|
msgstr "Pronađite datoteku „.hotlist“ za uvoz"
|
|
|
|
#: ulng.rsmsghotdirname
|
|
msgid "Hotdir name"
|
|
msgstr "Ime brze fascikle"
|
|
|
|
#: ulng.rsmsghotdirnbnewentries
|
|
msgid "Number of new entries: %d"
|
|
msgstr "Broj novih stavki: %d"
|
|
|
|
#: ulng.rsmsghotdirnothingtoexport
|
|
msgid "Nothing selected to export!"
|
|
msgstr "Nema ničeg za izvoz!"
|
|
|
|
#: ulng.rsmsghotdirpath
|
|
msgid "Hotdir path"
|
|
msgstr "Putanja brze fascikle"
|
|
|
|
#: ulng.rsmsghotdirreaddselecteddirectory
|
|
msgid "Re-Add selected dir: "
|
|
msgstr "Ponovno dodaj izabranu fasciklu: "
|
|
|
|
#: ulng.rsmsghotdirreaddthisdirectory
|
|
msgid "Re-Add current dir: "
|
|
msgstr "Ponovo dodaj trenutnu fasciklu: "
|
|
|
|
#: ulng.rsmsghotdirrestorewhat
|
|
msgid "Enter location and filename of Directory Hotlist to restore"
|
|
msgstr "Unesite putanju i ime datoteke brzog spiska fascikli za oporavak"
|
|
|
|
#: ulng.rsmsghotdirsimplecommand
|
|
msgctxt "ulng.rsmsghotdirsimplecommand"
|
|
msgid "Command:"
|
|
msgstr "Naredba:"
|
|
|
|
#: ulng.rsmsghotdirsimpleendofmenu
|
|
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
|
msgid "(end of sub menu)"
|
|
msgstr "(kraj podizbornika)"
|
|
|
|
#: ulng.rsmsghotdirsimplemenu
|
|
msgctxt "ulng.rsmsghotdirsimplemenu"
|
|
msgid "Menu &name:"
|
|
msgstr "Naziv izbornika:"
|
|
|
|
#: ulng.rsmsghotdirsimplename
|
|
msgctxt "ulng.rsmsghotdirsimplename"
|
|
msgid "&Name:"
|
|
msgstr "Ime:"
|
|
|
|
#: ulng.rsmsghotdirsimpleseparator
|
|
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
|
msgid "(separator)"
|
|
msgstr "(razdvajač)"
|
|
|
|
#: ulng.rsmsghotdirsubmenuname
|
|
msgctxt "ulng.rsmsghotdirsubmenuname"
|
|
msgid "Submenu name"
|
|
msgstr "Ime podizbornika"
|
|
|
|
#: ulng.rsmsghotdirtarget
|
|
msgid "Hotdir target"
|
|
msgstr "Cilj podizbornika"
|
|
|
|
#: ulng.rsmsghotdirtiporderpath
|
|
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
|
msgstr "Određuje da li želite da razvrstate radni okvir određenim redosledom posle izmene fascikle"
|
|
|
|
#: ulng.rsmsghotdirtipordertarget
|
|
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
|
msgstr "Određuje da li želite da ne razvrstavate radni okvir određenim redosledom posle izmene fascikle"
|
|
|
|
#: ulng.rsmsghotdirtipspecialdirbut
|
|
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
|
msgstr "Neke radnje za izbor određene putanje odnosne, apsolutne, naročite fascikle Vindouza, itd."
|
|
|
|
#: ulng.rsmsghotdirtotalbackuped
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "Total entries saved: %d\n"
|
|
#| "\n"
|
|
#| "Backup filename: %s\n"
|
|
msgid ""
|
|
"Total entries saved: %d\n"
|
|
"\n"
|
|
"Backup filename: %s\n"
|
|
msgstr ""
|
|
"Ukupan broj sačuvanih stavki: %d\n"
|
|
"\n"
|
|
"Ime ostave: %s\n"
|
|
|
|
#: ulng.rsmsghotdirtotalexported
|
|
msgid "Total entries exported: "
|
|
msgstr "Ukupna broj izvezenih stavki: "
|
|
|
|
#: ulng.rsmsghotdirwhattodelete
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "Do you want to delete all elements inside the sub-menu [%s]?\n"
|
|
#| "Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
|
msgid ""
|
|
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
|
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
|
msgstr ""
|
|
"Da li želite da izbrišete sve činioce podizbornika [%s]?\n"
|
|
"Odgovorom NE ćete izbrisati samo ograničenje izbornika, ali će se zadržati činilac unutar podizbornika.\n"
|
|
|
|
#: ulng.rsmsghotdirwheretosave
|
|
msgid "Enter location and filename where to save a Directory Hotlist file"
|
|
msgstr "Unesite putanju i ime mesta za čuvanje datoteke brzog spiska fascikli"
|
|
|
|
#: ulng.rsmsgincorrectfilelength
|
|
msgid "Incorrect resulting filelength for file : \"%s\""
|
|
msgstr "Netačna je izlazna dužina datoteke : „%s“"
|
|
|
|
#: ulng.rsmsginsertnextdisk
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "Please insert next disk or something similar.\n"
|
|
#| "\n"
|
|
#| "It is to allow writing this file:\n"
|
|
#| "\"%s\"\n"
|
|
#| "\n"
|
|
#| "Number of bytes still to write: %d\n"
|
|
msgid ""
|
|
"Please insert next disk or something similar.\n"
|
|
"\n"
|
|
"It is to allow writing this file:\n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Number of bytes still to write: %d\n"
|
|
msgstr ""
|
|
"Molim, ubacite sledeći disk ili nešto slično.\n"
|
|
"\n"
|
|
"To će vam omogućiti da upišete sledeću datoteku:\n"
|
|
"„%s“\n"
|
|
"\n"
|
|
"Broj bajta preostao za upis: %d\n"
|
|
|
|
#: ulng.rsmsginvalidcommandline
|
|
msgid "Error in command line"
|
|
msgstr "Greška u naredbenoj liniji"
|
|
|
|
#: ulng.rsmsginvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Neispravan naziv datoteke"
|
|
|
|
#: ulng.rsmsginvalidformatofconfigurationfile
|
|
msgid "Invalid format of configuration file"
|
|
msgstr "Neispravan oblik u datoteci podešavanja"
|
|
|
|
#: ulng.rsmsginvalidhexnumber
|
|
msgid "Invalid hexadecimal number: \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsginvalidpath
|
|
msgid "Invalid path"
|
|
msgstr "Neispravna putanja"
|
|
|
|
#: ulng.rsmsginvalidpathlong
|
|
msgid "Path %s contains forbidden characters."
|
|
msgstr "Putanja %s sadrži nedozvoljene znakove"
|
|
|
|
#: ulng.rsmsginvalidplugin
|
|
msgid "This is not a valid plugin!"
|
|
msgstr "Ovo nije ispravan priključak."
|
|
|
|
#: ulng.rsmsginvalidpluginarchitecture
|
|
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
|
msgstr "Ovaj priključak je napisan za Double Commander %s.%sNe može da radi sa Double Commander-om %s."
|
|
|
|
#: ulng.rsmsginvalidquoting
|
|
msgid "Invalid quoting"
|
|
msgstr "Neispravan navod"
|
|
|
|
#: ulng.rsmsginvalidselection
|
|
msgid "Invalid selection."
|
|
msgstr "Neispravan izbor."
|
|
|
|
#: ulng.rsmsgloadingfilelist
|
|
msgid "Loading file list..."
|
|
msgstr "Učitavam spisak datoteka..."
|
|
|
|
#: ulng.rsmsglocatetcconfiguation
|
|
msgid "Locate TC configuration file (wincmd.ini)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsglocatetcexecutable
|
|
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsglogcopy
|
|
msgid "Copy file %s"
|
|
msgstr "Umnoži datoteku %s"
|
|
|
|
#: ulng.rsmsglogdelete
|
|
msgid "Delete file %s"
|
|
msgstr "Obriši datoteku %s"
|
|
|
|
#: ulng.rsmsglogerror
|
|
msgid "Error: "
|
|
msgstr "Greška: "
|
|
|
|
#: ulng.rsmsglogextcmdlaunch
|
|
msgid "Launch external"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsglogextcmdresult
|
|
msgid "Result external"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsglogextract
|
|
msgid "Extract file %s"
|
|
msgstr "Raspakujem datoteku %s"
|
|
|
|
#: ulng.rsmsgloginfo
|
|
msgid "Info: "
|
|
msgstr "Podaci: "
|
|
|
|
#: ulng.rsmsgloglink
|
|
msgid "Create link %s"
|
|
msgstr "Napravi vezu %s"
|
|
|
|
#: ulng.rsmsglogmkdir
|
|
msgid "Create directory %s"
|
|
msgstr "Napravi fasciklu %s"
|
|
|
|
#: ulng.rsmsglogmove
|
|
msgid "Move file %s"
|
|
msgstr "Premesti datoteku %s"
|
|
|
|
#: ulng.rsmsglogpack
|
|
msgid "Pack to file %s"
|
|
msgstr "Putanja do datoteke %s"
|
|
|
|
#: ulng.rsmsglogrmdir
|
|
msgid "Remove directory %s"
|
|
msgstr "Ukloni fasciklu %s"
|
|
|
|
#: ulng.rsmsglogsuccess
|
|
msgid "Done: "
|
|
msgstr "Urađeno: "
|
|
|
|
#: ulng.rsmsglogsymlink
|
|
msgid "Create symlink %s"
|
|
msgstr "Napravi vezu %s"
|
|
|
|
#: ulng.rsmsglogtest
|
|
msgid "Test file integrity %s"
|
|
msgstr "Proveri ispravnost datoteke %s"
|
|
|
|
#: ulng.rsmsglogwipe
|
|
msgid "Wipe file %s"
|
|
msgstr "Izbriši potpuno datoteku %s"
|
|
|
|
#: ulng.rsmsglogwipedir
|
|
msgid "Wipe directory %s"
|
|
msgstr "Izbriši potpuno fasciklu %s"
|
|
|
|
#: ulng.rsmsgmasterpassword
|
|
msgid "Master Password"
|
|
msgstr "Glavna lozinka"
|
|
|
|
#: ulng.rsmsgmasterpasswordenter
|
|
msgid "Please enter the master password:"
|
|
msgstr "Unesite ponovo glavnu lozinku:"
|
|
|
|
#: ulng.rsmsgnewfile
|
|
msgid "New file"
|
|
msgstr "Nova datoteka"
|
|
|
|
#: ulng.rsmsgnextvolunpack
|
|
msgid "Next volume will be unpacked"
|
|
msgstr "Sledeći sadržaj će biti izdvojen"
|
|
|
|
#: ulng.rsmsgnofiles
|
|
msgid "No files"
|
|
msgstr "Nema datoteka"
|
|
|
|
#: ulng.rsmsgnofilesselected
|
|
msgid "No files selected."
|
|
msgstr "Nije izabrana nijedna datoteka."
|
|
|
|
#: ulng.rsmsgnofreespacecont
|
|
msgid "No enough free space on target drive, Continue?"
|
|
msgstr "Nema dovoljno mesta u odredištu. Da li da nastavim?"
|
|
|
|
#: ulng.rsmsgnofreespaceretry
|
|
msgid "No enough free space on target drive, Retry?"
|
|
msgstr "Nema dovoljno slobodnog mesta na odredišnom uređaju. Da li da pokušam ponovo?"
|
|
|
|
#: ulng.rsmsgnotdelete
|
|
msgid "Can not delete file %s"
|
|
msgstr "Nisam uspeo da izbrišem datoteku %s"
|
|
|
|
#: ulng.rsmsgnotimplemented
|
|
msgid "Not implemented."
|
|
msgstr "Nije primenjeno."
|
|
|
|
#: ulng.rsmsgobjectnotexists
|
|
msgid "Object does not exist!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgopeninanotherprogram
|
|
msgid "The action cannot be completed because the file is open in another program:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgpanelpreview
|
|
msgctxt "ulng.rsmsgpanelpreview"
|
|
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgpassword
|
|
msgid "Password:"
|
|
msgstr "Lozinka:"
|
|
|
|
#: ulng.rsmsgpassworddiff
|
|
msgid "Passwords are different!"
|
|
msgstr "Lozinke se razlikuju!"
|
|
|
|
#: ulng.rsmsgpasswordenter
|
|
msgid "Please enter the password:"
|
|
msgstr "Unesite vašu lozinku:"
|
|
|
|
#: ulng.rsmsgpasswordfirewall
|
|
msgid "Password (Firewall):"
|
|
msgstr "Lozinka (vatreni zid):"
|
|
|
|
#: ulng.rsmsgpasswordverify
|
|
msgid "Please re-enter the password for verification:"
|
|
msgstr "Unesite ponovo lozinku za sistem provere:"
|
|
|
|
#: ulng.rsmsgpopuphotdelete
|
|
msgid "&Delete %s"
|
|
msgstr "Obriši %s"
|
|
|
|
#: ulng.rsmsgpresetalreadyexists
|
|
msgid "Preset \"%s\" already exists. Overwrite?"
|
|
msgstr "Datoteka „%s“ već postoji. Da je prepišem?"
|
|
|
|
#: ulng.rsmsgproblemexecutingcommand
|
|
msgid "Problem executing command (%s)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgprocessid
|
|
msgid "PID: %d"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgpromptaskingfilename
|
|
msgid "Filename for dropped text:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgprovidethisfile
|
|
msgid "Please, make this file available. Retry?"
|
|
msgstr "Molim, pobrinite se da ova datoteka bude dostupna. Pokušati ponovo?"
|
|
|
|
#: ulng.rsmsgrenamefavtabs
|
|
msgid "Enter new friendly name for this Favorite Tabs"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgrenamefavtabsmenu
|
|
msgid "Enter new name for this menu"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgrenfldr
|
|
msgid "Rename/move %d selected files/directories?"
|
|
msgstr "Preimenuj/premesti %d označenih datoteka/fascikli?"
|
|
|
|
#: ulng.rsmsgrensel
|
|
msgid "Rename/move selected \"%s\"?"
|
|
msgstr "Preimenuj/premesti označeno „%s“?"
|
|
|
|
#: ulng.rsmsgreplacethistext
|
|
msgid "Do you want to replace this text?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgrestartforapplychanges
|
|
msgid "Please, restart Double Commander in order to apply changes"
|
|
msgstr "Molim, ponovo pokrenite Double Commander-a da bi se primenile izmene"
|
|
|
|
#: ulng.rsmsgsekectfiletype
|
|
msgid "Select to which file type to add extension \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgselectedinfo
|
|
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
|
msgstr "Označeno: %s od %s, datoteka: %d od %d, fascikli: %d od %d"
|
|
|
|
#: ulng.rsmsgselectexecutablefile
|
|
msgid "Select executable file for"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgselectonlychecksumfiles
|
|
msgid "Please select only checksum files!"
|
|
msgstr "Molim, odaberite samo datoteke za proveru zbira."
|
|
|
|
#: ulng.rsmsgsellocnextvol
|
|
msgid "Please select location of next volume"
|
|
msgstr "Izaberite položaj sledećeg sadržaja/uređaja"
|
|
|
|
#: ulng.rsmsgsetvolumelabel
|
|
msgid "Set volume label"
|
|
msgstr "Postavi oznaku uređaju"
|
|
|
|
#: ulng.rsmsgspecialdir
|
|
msgid "Special Dirs"
|
|
msgstr "Naročite fascikle"
|
|
|
|
#: ulng.rsmsgspecialdiraddacti
|
|
msgid "Add path from active frame"
|
|
msgstr "Dodajte putanju radnom okviru"
|
|
|
|
#: ulng.rsmsgspecialdiraddnonacti
|
|
msgid "Add path from inactive frame"
|
|
msgstr "Dodajte putanju iz neradnog okvira"
|
|
|
|
#: ulng.rsmsgspecialdirbrowssel
|
|
msgid "Browse and use selected path"
|
|
msgstr "Pregledaj i koristi odabranu putanju"
|
|
|
|
#: ulng.rsmsgspecialdirenvvar
|
|
msgid "Use environment variable..."
|
|
msgstr "Koristi promenljive okruženja..."
|
|
|
|
#: ulng.rsmsgspecialdirgotodc
|
|
msgid "Go to Double Commander special path..."
|
|
msgstr "Idi na naročitu putanju Double Commander-a..."
|
|
|
|
#: ulng.rsmsgspecialdirgotoenvvar
|
|
msgid "Go to environment variable..."
|
|
msgstr "Idi na promenljivu okruženja..."
|
|
|
|
#: ulng.rsmsgspecialdirgotoother
|
|
msgid "Go to other Windows special folder..."
|
|
msgstr "Idi na drugu naročitu fasciklu Windows-a..."
|
|
|
|
#: ulng.rsmsgspecialdirgototc
|
|
msgid "Go to Windows special folder (TC)..."
|
|
msgstr "Idi na naročitu fasciklu Windows-a (TC)..."
|
|
|
|
#: ulng.rsmsgspecialdirmakereltohotdir
|
|
msgid "Make relative to hotdir path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgspecialdirmkabso
|
|
msgid "Make path absolute"
|
|
msgstr "Učini putanju apsolutnom"
|
|
|
|
#: ulng.rsmsgspecialdirmkdcrel
|
|
msgid "Make relative to Double Commander special path..."
|
|
msgstr "Učini odnosnom na naročitu putanju Double Commander-a..."
|
|
|
|
#: ulng.rsmsgspecialdirmkenvrel
|
|
msgid "Make relative to environment variable..."
|
|
msgstr "Učini odnosnom na promenljivu okruženja..."
|
|
|
|
#: ulng.rsmsgspecialdirmktctel
|
|
msgid "Make relative to Windows special folder (TC)..."
|
|
msgstr "Učini odnosnom na naročitu faciklu Windows-a (TC)..."
|
|
|
|
#: ulng.rsmsgspecialdirmkwnrel
|
|
msgid "Make relative to other Windows special folder..."
|
|
msgstr "Učini odnosnom na drugu naročitu fasciklu Windows-a..."
|
|
|
|
#: ulng.rsmsgspecialdirusedc
|
|
msgid "Use Double Commander special path..."
|
|
msgstr "Koristi naročitu putanju Double Commander-a..."
|
|
|
|
#: ulng.rsmsgspecialdirusehotdir
|
|
msgid "Use hotdir path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgspecialdiruseother
|
|
msgid "Use other Windows special folder..."
|
|
msgstr "Koristi drugu naročitu putanju Windows-a..."
|
|
|
|
#: ulng.rsmsgspecialdirusetc
|
|
msgid "Use Windows special folder (TC)..."
|
|
msgstr "Koristi naročitu fasciklu Windows-a (TC)..."
|
|
|
|
#: ulng.rsmsgtabforopeninginnewtab
|
|
msgid "This tab (%s) is locked! Open directory in another tab?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtabrenamecaption
|
|
msgid "Rename tab"
|
|
msgstr "Preimenuj karticu"
|
|
|
|
#: ulng.rsmsgtabrenameprompt
|
|
msgid "New tab name:"
|
|
msgstr "Novi naziv kartice:"
|
|
|
|
#: ulng.rsmsgtargetdir
|
|
msgid "Target path:"
|
|
msgstr "Putanja do odredišta:"
|
|
|
|
#: ulng.rsmsgtcconfignotfound
|
|
msgid ""
|
|
"Error! Cannot find the TC configuration file:\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtcexecutablenotfound
|
|
msgid ""
|
|
"Error! Cannot find the TC configuration executable:\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtcisrunning
|
|
msgid ""
|
|
"Error! TC is still running but it should be closed for this operation.\n"
|
|
"Close it and press OK or press CANCEL to abort.\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtctoolbarnotfound
|
|
msgid ""
|
|
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtctoolbarwheretosave
|
|
msgid "Enter location and filename where to save a TC Toolbar file"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgterminateprocess
|
|
msgid "WARNING: Terminating a process can cause undesired results including loss of data and system instability. The process will not be given the chance to save its state or data before it is terminated. Are you sure you want to terminate the process?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgthisisnowinclipboard
|
|
msgid "\"%s\" is now in the clipboard"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtitleextnotinfiletype
|
|
msgid "Extension of selected file is not in any recognized file types"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
|
msgid "Locate \".toolbar\" file to import"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
|
msgid "Locate \".BAR\" file to import"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtoolbarrestorewhat
|
|
msgid "Enter location and filename of Toolbar to restore"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtoolbarsaved
|
|
msgid ""
|
|
"Saved!\n"
|
|
"Toolbar filename: %s\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgtoomanyfilesselected
|
|
msgid "Too many files selected."
|
|
msgstr "Previše datoteka je odabrano."
|
|
|
|
#: ulng.rsmsgundeterminednumberoffile
|
|
msgid "Undetermined"
|
|
msgstr "Neodređeno"
|
|
|
|
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
|
msgid "ERROR: Unexpected Tree View Menu usage!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgurl
|
|
msgid "URL:"
|
|
msgstr "Adresa:"
|
|
|
|
#: ulng.rsmsguserdidnotsetextension
|
|
msgid "<NO EXT>"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsguserdidnotsetname
|
|
msgid "<NO NAME>"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgusername
|
|
msgid "User name:"
|
|
msgstr "Korisničko ime:"
|
|
|
|
#: ulng.rsmsgusernamefirewall
|
|
msgid "User name (Firewall):"
|
|
msgstr "korisničko ime (vatreni zid):"
|
|
|
|
#: ulng.rsmsgverify
|
|
msgid "VERIFICATION:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgverifychecksum
|
|
msgid "Do you want to verify selected checksums?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgverifywrong
|
|
msgid "The target file is corrupted, checksum mismatch!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgvolumelabel
|
|
msgid "Volume label:"
|
|
msgstr "Oznaka uređaja:"
|
|
|
|
#: ulng.rsmsgvolumesizeenter
|
|
msgid "Please enter the volume size:"
|
|
msgstr "Unesite veličinu uređaja:"
|
|
|
|
#: ulng.rsmsgwipefldr
|
|
msgid "Wipe %d selected files/directories?"
|
|
msgstr "Da li da potpuno izbrišem %d označenih datoteka/fascikli?"
|
|
|
|
#: ulng.rsmsgwipesel
|
|
msgid "Wipe selected \"%s\"?"
|
|
msgstr "Da li da potpuno izbrišem odabrano „%s“?"
|
|
|
|
#: ulng.rsmsgwithactionwith
|
|
msgid "with"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgwrongpasswordtryagain
|
|
msgid ""
|
|
"Wrong password!\n"
|
|
"Please try again!\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmulrenautorename
|
|
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmulrenfilenamestylelist
|
|
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
|
msgstr "Bez izmena;VELIKA SLOVA;mala slova;Prvi znak veliki;Prvi Znak Svake Reči Veliki;"
|
|
|
|
#: ulng.rsmulrenwarningduplicate
|
|
msgid "Warning, duplicate names!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmulrenwronglinesnumber
|
|
msgid "File contains wrong number of lines: %d, should be %d!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnewsearchclearfilteroptions
|
|
msgid "Keep;Clear;Prompt"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnoequivalentinternalcommand
|
|
msgid "No internal equivalent command"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnofindfileswindowyet
|
|
msgid "Sorry, no \"Find files\" window yet..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsnootherfindfileswindowtoclose
|
|
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithdevelopment
|
|
msgid "Development"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwitheducation
|
|
msgid "Education"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithgames
|
|
msgid "Games"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithgraphics
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopenwithgraphics"
|
|
msgid "Graphics"
|
|
msgstr "Grafika"
|
|
|
|
#: ulng.rsopenwithmultimedia
|
|
msgid "Multimedia"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithnetwork
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopenwithnetwork"
|
|
msgid "Network"
|
|
msgstr "Mreža"
|
|
|
|
#: ulng.rsopenwithoffice
|
|
msgid "Office"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithother
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopenwithother"
|
|
msgid "Other"
|
|
msgstr "Ostalo"
|
|
|
|
#: ulng.rsopenwithscience
|
|
msgid "Science"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithsettings
|
|
msgid "Settings"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithsystem
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopenwithsystem"
|
|
msgid "System"
|
|
msgstr "Sistem"
|
|
|
|
#: ulng.rsopenwithutility
|
|
msgid "Accessories"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoperaborted
|
|
msgid "Aborted"
|
|
msgstr "Obustavljeno"
|
|
|
|
#: ulng.rsopercalculatingchecksum
|
|
msgid "Calculating checksum"
|
|
msgstr "Izračunavam zbirnu proveru"
|
|
|
|
#: ulng.rsopercalculatingchecksumin
|
|
msgid "Calculating checksum in \"%s\""
|
|
msgstr "Računam zbirnu proveru u „%s“"
|
|
|
|
#: ulng.rsopercalculatingchecksumof
|
|
msgid "Calculating checksum of \"%s\""
|
|
msgstr "Računam zbirnu proveru „%s“"
|
|
|
|
#: ulng.rsopercalculatingstatictics
|
|
msgctxt "ulng.rsopercalculatingstatictics"
|
|
msgid "Calculating"
|
|
msgstr "Računam"
|
|
|
|
#: ulng.rsopercalculatingstatisticsin
|
|
msgid "Calculating \"%s\""
|
|
msgstr "Računam „%s“"
|
|
|
|
#: ulng.rsopercombining
|
|
msgid "Joining"
|
|
msgstr "Spajam"
|
|
|
|
#: ulng.rsopercombiningfromto
|
|
msgid "Joining files in \"%s\" to \"%s\""
|
|
msgstr "Spajam datoteke iz „%s“ na „%s“"
|
|
|
|
#: ulng.rsopercopying
|
|
msgid "Copying"
|
|
msgstr "Umnožavam"
|
|
|
|
#: ulng.rsopercopyingfromto
|
|
msgid "Copying from \"%s\" to \"%s\""
|
|
msgstr "Umnožavam iz „%s“ u „%s“ "
|
|
|
|
#: ulng.rsopercopyingsomethingto
|
|
msgid "Copying \"%s\" to \"%s\""
|
|
msgstr "Umnožavam „%s“ na „%s“"
|
|
|
|
#: ulng.rsopercreatingdirectory
|
|
msgid "Creating directory"
|
|
msgstr "Stvaram fasciklu"
|
|
|
|
#: ulng.rsopercreatingsomedirectory
|
|
msgid "Creating directory \"%s\""
|
|
msgstr "Stvaram fasciklu „%s“"
|
|
|
|
#: ulng.rsoperdeleting
|
|
msgctxt "ulng.rsoperdeleting"
|
|
msgid "Deleting"
|
|
msgstr "Brišem"
|
|
|
|
#: ulng.rsoperdeletingin
|
|
msgid "Deleting in \"%s\""
|
|
msgstr "Brišem iz „%s“"
|
|
|
|
#: ulng.rsoperdeletingsomething
|
|
msgid "Deleting \"%s\""
|
|
msgstr "Brišem „%s“"
|
|
|
|
#: ulng.rsoperexecuting
|
|
msgid "Executing"
|
|
msgstr "Izvršavam"
|
|
|
|
#: ulng.rsoperexecutingsomething
|
|
msgid "Executing \"%s\""
|
|
msgstr "Izvršavam „%s“"
|
|
|
|
#: ulng.rsoperextracting
|
|
msgid "Extracting"
|
|
msgstr "Izdvajam"
|
|
|
|
#: ulng.rsoperextractingfromto
|
|
msgid "Extracting from \"%s\" to \"%s\""
|
|
msgstr "Izdvajam iz „%s“ u „%s“"
|
|
|
|
#: ulng.rsoperfinished
|
|
msgid "Finished"
|
|
msgstr "Gotovo"
|
|
|
|
#: ulng.rsoperlisting
|
|
msgid "Listing"
|
|
msgstr "Listam"
|
|
|
|
#: ulng.rsoperlistingin
|
|
msgid "Listing \"%s\""
|
|
msgstr "Listam „%s“"
|
|
|
|
#: ulng.rsopermoving
|
|
msgid "Moving"
|
|
msgstr "Premeštam"
|
|
|
|
#: ulng.rsopermovingfromto
|
|
msgid "Moving from \"%s\" to \"%s\""
|
|
msgstr "Premeštam iz „%s“ u „%s“"
|
|
|
|
#: ulng.rsopermovingsomethingto
|
|
msgid "Moving \"%s\" to \"%s\""
|
|
msgstr "Premeštam „%s“ na „%s“"
|
|
|
|
#: ulng.rsopernotstarted
|
|
msgid "Not started"
|
|
msgstr "Nije pokrenuto"
|
|
|
|
#: ulng.rsoperpacking
|
|
msgid "Packing"
|
|
msgstr "Sažimam"
|
|
|
|
#: ulng.rsoperpackingfromto
|
|
msgid "Packing from \"%s\" to \"%s\""
|
|
msgstr "Sažimam iz „%s“ u „%s“"
|
|
|
|
#: ulng.rsoperpackingsomethingto
|
|
msgid "Packing \"%s\" to \"%s\""
|
|
msgstr "Sažimam „%s“ u „%s“"
|
|
|
|
#: ulng.rsoperpaused
|
|
msgid "Paused"
|
|
msgstr "Zastanak"
|
|
|
|
#: ulng.rsoperpausing
|
|
msgid "Pausing"
|
|
msgstr "Zastanak"
|
|
|
|
#: ulng.rsoperrunning
|
|
msgid "Running"
|
|
msgstr "Pokrenuto"
|
|
|
|
#: ulng.rsopersettingproperty
|
|
msgid "Setting property"
|
|
msgstr "Postavljam svojstva"
|
|
|
|
#: ulng.rsopersettingpropertyin
|
|
msgid "Setting property in \"%s\""
|
|
msgstr "Postavljam svojstva u „%s“"
|
|
|
|
#: ulng.rsopersettingpropertyof
|
|
msgid "Setting property of \"%s\""
|
|
msgstr "Postavljam svojstva datoteci „%s“"
|
|
|
|
#: ulng.rsopersplitting
|
|
msgid "Splitting"
|
|
msgstr "Deljenje"
|
|
|
|
#: ulng.rsopersplittingfromto
|
|
msgid "Splitting \"%s\" to \"%s\""
|
|
msgstr "Delim „%s“ na „%s“"
|
|
|
|
#: ulng.rsoperstarting
|
|
msgid "Starting"
|
|
msgstr "Pokrećem"
|
|
|
|
#: ulng.rsoperstopped
|
|
msgid "Stopped"
|
|
msgstr "Zaustavljeno"
|
|
|
|
#: ulng.rsoperstopping
|
|
msgid "Stopping"
|
|
msgstr "Prekidam"
|
|
|
|
#: ulng.rsopertesting
|
|
msgid "Testing"
|
|
msgstr "Probanje"
|
|
|
|
#: ulng.rsopertestingin
|
|
msgid "Testing in \"%s\""
|
|
msgstr "Probam u „%s“"
|
|
|
|
#: ulng.rsopertestingsomething
|
|
msgid "Testing \"%s\""
|
|
msgstr "Probam „%s“"
|
|
|
|
#: ulng.rsoperverifyingchecksum
|
|
msgid "Verifying checksum"
|
|
msgstr "Proveravam zbir"
|
|
|
|
#: ulng.rsoperverifyingchecksumin
|
|
msgid "Verifying checksum in \"%s\""
|
|
msgstr "Proveravam zbir u „%s“"
|
|
|
|
#: ulng.rsoperverifyingchecksumof
|
|
msgid "Verifying checksum of \"%s\""
|
|
msgstr "Proveravam zbir „%s“"
|
|
|
|
#: ulng.rsoperwaitingforconnection
|
|
msgid "Waiting for access to file source"
|
|
msgstr "Čekam na pristup izvornoj datoteci"
|
|
|
|
#: ulng.rsoperwaitingforfeedback
|
|
msgid "Waiting for user response"
|
|
msgstr "Čekam na odziv korisnika"
|
|
|
|
#: ulng.rsoperwiping
|
|
msgid "Wiping"
|
|
msgstr "Brisanje"
|
|
|
|
#: ulng.rsoperwipingin
|
|
msgid "Wiping in \"%s\""
|
|
msgstr "Brisanje u „%s“"
|
|
|
|
#: ulng.rsoperwipingsomething
|
|
msgid "Wiping \"%s\""
|
|
msgstr "Brisanje „%s“"
|
|
|
|
#: ulng.rsoperworking
|
|
msgid "Working"
|
|
msgstr "Rad"
|
|
|
|
#: ulng.rsoptaddfrommainpanel
|
|
msgid "Add at &beginning;Add at the end;Smart add"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptaddingtooltipfiletype
|
|
msgid "Adding new tooltip file type"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveconfiguresavetochange
|
|
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveradditonalcmd
|
|
msgid "Mode dependent, additional command"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveraddonlynotempty
|
|
msgid "Add if it is non-empty"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverarchivel
|
|
msgid "Archive File (long name)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverarchiver
|
|
msgid "Select archiver executable"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverarchives
|
|
msgid "Archive file (short name)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverchangeencoding
|
|
msgid "Change Archiver Listing Encoding"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverconfirmdelete
|
|
msgctxt "ulng.rsoptarchiverconfirmdelete"
|
|
msgid "Are you sure you want to delete: \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverdefaultexportfilename
|
|
msgid "Exported Archiver Configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchivererrorlevel
|
|
msgid "errorlevel"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverexportcaption
|
|
msgid "Export archiver configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverexportdone
|
|
msgctxt "ulng.rsoptarchiverexportdone"
|
|
msgid "Exportation of %d elements to file \"%s\" completed."
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverexportprompt
|
|
msgctxt "ulng.rsoptarchiverexportprompt"
|
|
msgid "Select the one(s) you want to export"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverfilelistl
|
|
msgid "Filelist (long names)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverfilelists
|
|
msgid "Filelist (short names)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverimportcaption
|
|
msgid "Import archiver configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverimportdone
|
|
msgctxt "ulng.rsoptarchiverimportdone"
|
|
msgid "Importation of %d elements from file \"%s\" completed."
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverimportfile
|
|
msgid "Select the file to import archiver configuration(s)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverimportprompt
|
|
msgctxt "ulng.rsoptarchiverimportprompt"
|
|
msgid "Select the one(s) you want to import"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverjustname
|
|
msgid "Use name only, without path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverjustpath
|
|
msgid "Use path only, without name"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverprograml
|
|
msgid "Archive Program (long name)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverprograms
|
|
msgid "Archive Program (short name)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverquoteall
|
|
msgid "Quote all names"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverquotewithspace
|
|
msgid "Quote names with spaces"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiversinglefprocess
|
|
msgid "Single filename to process"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchivertargetsubdir
|
|
msgid "Target subdirecory"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveruseansi
|
|
msgid "Use ANSI encoding"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveruseutf8
|
|
msgid "Use UTF8 encoding"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverwheretosave
|
|
msgid "Enter location and filename where to save archiver configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchivetypename
|
|
msgid "Archive type name:"
|
|
msgstr "Naziv vrste skladišta:"
|
|
|
|
#: ulng.rsoptassocpluginwith
|
|
msgid "Associate plugin \"%s\" with:"
|
|
msgstr "Pridruži priključak „%s“ sa:"
|
|
|
|
#: ulng.rsoptautosizecolumn
|
|
msgid "First;Last;"
|
|
msgstr "Prvi;poslednji;"
|
|
|
|
#: ulng.rsoptconfigsortorder
|
|
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptconfigtreestate
|
|
msgid "Full expand;Full collapse"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptdifferframeposition
|
|
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptenterext
|
|
msgid "Enter extension"
|
|
msgstr "Unesite nastavak"
|
|
|
|
#: ulng.rsoptfavoritetabswheretoaddinlist
|
|
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptfileoperationsprogresskind
|
|
msgid "separate window;minimized separate window;operations panel"
|
|
msgstr "Odvojen prozor;umanjen odvojen prozor;površ radnji"
|
|
|
|
#: ulng.rsoptfilesizeformat
|
|
msgid "float;B;K;M;G"
|
|
msgstr "pokretna tačka;B;K;M;G"
|
|
|
|
#: ulng.rsopthotkeysadddeleteshortcutlong
|
|
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
|
msgstr "Prečica %s za „cm_Delete“ će biti prijavljena, tako da može biti korišćena za vraćanje ove postavke."
|
|
|
|
#: ulng.rsopthotkeysaddhotkey
|
|
msgid "Add hotkey for %s"
|
|
msgstr "Dodaj prečicu za %s"
|
|
|
|
#: ulng.rsopthotkeysaddshortcutbutton
|
|
msgid "Add shortcut"
|
|
msgstr "Dodaj prečicu"
|
|
|
|
#: ulng.rsopthotkeyscannotsetshortcut
|
|
msgid "Cannot set shortcut"
|
|
msgstr "Nisam uspeo da postavim prečicu"
|
|
|
|
#: ulng.rsopthotkeyschangeshortcut
|
|
msgid "Change shortcut"
|
|
msgstr "Izmeni prečicu"
|
|
|
|
#: ulng.rsopthotkeyscommand
|
|
msgctxt "ulng.rsopthotkeyscommand"
|
|
msgid "Command"
|
|
msgstr "Naredba"
|
|
|
|
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
|
#, fuzzy,badformat
|
|
msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides"
|
|
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
|
msgstr "Prečica za „cm_Delete“ ima odrednicu koja zaobilazi ove postavke. Da li želite da izmenite odrednicu i koristite opšte postavke?"
|
|
|
|
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
|
msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists"
|
|
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
|
msgstr "Prečici %s za „cm_Delete“ treba da se promeni odrednica d bi se slagala sa prečicom %s. Da li želite da je promenite?"
|
|
|
|
#: ulng.rsopthotkeysdescription
|
|
msgctxt "ulng.rsopthotkeysdescription"
|
|
msgid "Description"
|
|
msgstr "Opis"
|
|
|
|
#: ulng.rsopthotkeysedithotkey
|
|
msgid "Edit hotkey for %s"
|
|
msgstr "Uredi prečicu za %s"
|
|
|
|
#: ulng.rsopthotkeysfixparameter
|
|
msgid "Fix parameter"
|
|
msgstr "Ispravi odrednicu"
|
|
|
|
#: ulng.rsopthotkeyshotkey
|
|
msgctxt "ulng.rsopthotkeyshotkey"
|
|
msgid "Hotkey"
|
|
msgstr "Prečica"
|
|
|
|
#: ulng.rsopthotkeyshotkeys
|
|
msgctxt "ulng.rsopthotkeyshotkeys"
|
|
msgid "Hotkeys"
|
|
msgstr "Prečice"
|
|
|
|
#: ulng.rsopthotkeysnohotkey
|
|
msgid "<none>"
|
|
msgstr "<ništa>"
|
|
|
|
#: ulng.rsopthotkeysparameters
|
|
msgctxt "ulng.rsopthotkeysparameters"
|
|
msgid "Parameters"
|
|
msgstr "Odrednice"
|
|
|
|
#: ulng.rsopthotkeyssetdeleteshortcut
|
|
msgid "Set shortcut to delete file"
|
|
msgstr "Postavi prečicu za brisanje datoteke"
|
|
|
|
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
|
#, fuzzy,badformat
|
|
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
|
msgstr "Da bi ove postavke radile sa prečicom %s, prečica mora da bude dodeljena „cm_Delete“, ali je već dodeljena za %s. Da li želite da je promenite?"
|
|
|
|
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
|
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
|
msgstr "Prečica %s za „cm_Delete“ je niz za koji dugme Šift ne može biti dodeljeno. Najverovatnije neće raditi."
|
|
|
|
#: ulng.rsopthotkeysshortcutused
|
|
msgid "Shortcut in use"
|
|
msgstr "Prečica je u upotrebi"
|
|
|
|
#: ulng.rsopthotkeysshortcutusedtext1
|
|
msgid "Shortcut %s is already used."
|
|
msgstr "Prečica %s već postoji."
|
|
|
|
#: ulng.rsopthotkeysshortcutusedtext2
|
|
msgid "Change it to %s?"
|
|
msgstr "Da li je dodeliti %s?"
|
|
|
|
#: ulng.rsopthotkeysusedby
|
|
msgid "used for %s in %s"
|
|
msgstr "koristi se za %s u %s"
|
|
|
|
#: ulng.rsopthotkeysusedwithdifferentparams
|
|
msgid "used for this command but with different parameters"
|
|
msgstr "koristi za ovu naredbu sa drugačijim odrednicama"
|
|
|
|
#: ulng.rsoptionseditorarchivers
|
|
msgctxt "ulng.rsoptionseditorarchivers"
|
|
msgid "Archivers"
|
|
msgstr "Programi za sažimanje"
|
|
|
|
#: ulng.rsoptionseditorautorefresh
|
|
msgctxt "ulng.rsoptionseditorautorefresh"
|
|
msgid "Auto refresh"
|
|
msgstr "Samoosvežavanje"
|
|
|
|
#: ulng.rsoptionseditorbehavior
|
|
msgctxt "ulng.rsoptionseditorbehavior"
|
|
msgid "Behaviors"
|
|
msgstr "Ponašanje"
|
|
|
|
#: ulng.rsoptionseditorbriefview
|
|
msgctxt "ulng.rsoptionseditorbriefview"
|
|
msgid "Brief"
|
|
msgstr "Sažeto"
|
|
|
|
#: ulng.rsoptionseditorcolors
|
|
msgctxt "ulng.rsoptionseditorcolors"
|
|
msgid "Colors"
|
|
msgstr "Boje"
|
|
|
|
#: ulng.rsoptionseditorcolumnsview
|
|
msgid "Columns"
|
|
msgstr "Stupci"
|
|
|
|
#: ulng.rsoptionseditorconfiguration
|
|
msgctxt "ulng.rsoptionseditorconfiguration"
|
|
msgid "Configuration"
|
|
msgstr "Postavke"
|
|
|
|
#: ulng.rsoptionseditorcustomcolumns
|
|
msgid "Custom columns"
|
|
msgstr "Prilagođene boje"
|
|
|
|
#: ulng.rsoptionseditordirectoryhotlist
|
|
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Brzi spisak fascikli"
|
|
|
|
#: ulng.rsoptionseditordraganddrop
|
|
msgid "Drag & drop"
|
|
msgstr "Prevuci i spusti"
|
|
|
|
#: ulng.rsoptionseditordriveslistbutton
|
|
msgid "Drives list button"
|
|
msgstr "Dugme za spisak uređaja"
|
|
|
|
#: ulng.rsoptionseditorfavoritetabs
|
|
msgid "Favorite Tabs"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptionseditorfileassicextra
|
|
msgid "File associations extra"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptionseditorfileassoc
|
|
msgctxt "ulng.rsoptionseditorfileassoc"
|
|
msgid "File associations"
|
|
msgstr "Pridruživanje datoteka"
|
|
|
|
#: ulng.rsoptionseditorfilenewfiletypes
|
|
#, fuzzy
|
|
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
|
msgid "New"
|
|
msgstr "Novo"
|
|
|
|
#: ulng.rsoptionseditorfileoperations
|
|
msgctxt "ulng.rsoptionseditorfileoperations"
|
|
msgid "File operations"
|
|
msgstr "Radnje nad datotekama"
|
|
|
|
#: ulng.rsoptionseditorfilepanels
|
|
msgctxt "ulng.rsoptionseditorfilepanels"
|
|
msgid "File panels"
|
|
msgstr "Površi datoteka"
|
|
|
|
#: ulng.rsoptionseditorfilesearch
|
|
#, fuzzy
|
|
msgctxt "ulng.rsoptionseditorfilesearch"
|
|
msgid "File search"
|
|
msgstr "Pretraga datoteka"
|
|
|
|
#: ulng.rsoptionseditorfilesviews
|
|
msgid "Files views"
|
|
msgstr "Pregledi datoteka"
|
|
|
|
#: ulng.rsoptionseditorfiletypes
|
|
msgctxt "ulng.rsoptionseditorfiletypes"
|
|
msgid "File types"
|
|
msgstr "Vrste datoteka"
|
|
|
|
#: ulng.rsoptionseditorfoldertabs
|
|
msgctxt "ulng.rsoptionseditorfoldertabs"
|
|
msgid "Folder tabs"
|
|
msgstr "Kartice datoteka"
|
|
|
|
#: ulng.rsoptionseditorfoldertabsextra
|
|
msgid "Folder tabs extra"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptionseditorfonts
|
|
msgctxt "ulng.rsoptionseditorfonts"
|
|
msgid "Fonts"
|
|
msgstr "Slovni likovi"
|
|
|
|
#: ulng.rsoptionseditorhighlighters
|
|
msgid "Highlighters"
|
|
msgstr "Isticanje"
|
|
|
|
#: ulng.rsoptionseditorhotkeys
|
|
msgctxt "ulng.rsoptionseditorhotkeys"
|
|
msgid "Hot keys"
|
|
msgstr "Prečice"
|
|
|
|
#: ulng.rsoptionseditoricons
|
|
msgctxt "ulng.rsoptionseditoricons"
|
|
msgid "Icons"
|
|
msgstr "Ikonice"
|
|
|
|
#: ulng.rsoptionseditorignorelist
|
|
msgctxt "ulng.rsoptionseditorignorelist"
|
|
msgid "Ignore list"
|
|
msgstr "Zanemari spisak"
|
|
|
|
#: ulng.rsoptionseditorkeyboard
|
|
msgid "Keys"
|
|
msgstr "Tasteri"
|
|
|
|
#: ulng.rsoptionseditorlanguage
|
|
msgctxt "ulng.rsoptionseditorlanguage"
|
|
msgid "Language"
|
|
msgstr "Jezik"
|
|
|
|
#: ulng.rsoptionseditorlayout
|
|
msgctxt "ulng.rsoptionseditorlayout"
|
|
msgid "Layout"
|
|
msgstr "Raspored"
|
|
|
|
#: ulng.rsoptionseditorlog
|
|
msgctxt "ulng.rsoptionseditorlog"
|
|
msgid "Log"
|
|
msgstr "Dnevnik"
|
|
|
|
#: ulng.rsoptionseditormiscellaneous
|
|
msgctxt "ulng.rsoptionseditormiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Razno"
|
|
|
|
#: ulng.rsoptionseditormouse
|
|
msgid "Mouse"
|
|
msgstr "Miš"
|
|
|
|
#: ulng.rsoptionseditoroptionschanged
|
|
msgid ""
|
|
"Options have changed in \"%s\"\n"
|
|
"\n"
|
|
"Do you want to save modifications?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptionseditorplugins
|
|
msgctxt "ulng.rsoptionseditorplugins"
|
|
msgid "Plugins"
|
|
msgstr "Priključci"
|
|
|
|
#: ulng.rsoptionseditorquicksearch
|
|
msgctxt "ulng.rsoptionseditorquicksearch"
|
|
msgid "Quick search/filter"
|
|
msgstr "Brza pretraga/uslov"
|
|
|
|
#: ulng.rsoptionseditorterminal
|
|
msgctxt "ulng.rsoptionseditorterminal"
|
|
msgid "Terminal"
|
|
msgstr "Terminal"
|
|
|
|
#: ulng.rsoptionseditortoolbar
|
|
msgid "Toolbar"
|
|
msgstr "Traka alata"
|
|
|
|
#: ulng.rsoptionseditortools
|
|
msgctxt "ulng.rsoptionseditortools"
|
|
msgid "Tools"
|
|
msgstr "Alatke"
|
|
|
|
#: ulng.rsoptionseditortooltips
|
|
msgctxt "ulng.rsoptionseditortooltips"
|
|
msgid "Tooltips"
|
|
msgstr "Napomene"
|
|
|
|
#: ulng.rsoptionseditortreeviewmenu
|
|
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
|
msgid "Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptionseditortreeviewmenucolors
|
|
msgid "Tree View Menu Colors"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptletters
|
|
msgid "None;Command Line;Quick Search;Quick Filter"
|
|
msgstr "Ništa;Naredbena linija;Brza pretraga;Brzi uslov"
|
|
|
|
#: ulng.rsoptmouseselectionbutton
|
|
msgid "Left button;Right button;"
|
|
msgstr "Levo dugme;Desno dugme;"
|
|
|
|
#: ulng.rsoptnewfilesposition
|
|
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
|
msgstr "na vrhu spiska datoteka:posle fascikli (ako se fascikle prikazuju pre datoteka); na određenom položaju;na dnu spiska datoteka"
|
|
|
|
#: ulng.rsoptpluginalreadyassigned
|
|
msgid "Plugin %s is already assigned for the following extensions:"
|
|
msgstr "Priključak %s je već dodeljen sledećim nastavcima:"
|
|
|
|
#: ulng.rsoptplugindisable
|
|
msgid "D&isable"
|
|
msgstr "Onemogući"
|
|
|
|
#: ulng.rsoptpluginenable
|
|
msgctxt "ulng.rsoptpluginenable"
|
|
msgid "E&nable"
|
|
msgstr "&Omogući"
|
|
|
|
#: ulng.rsoptpluginsactive
|
|
msgctxt "ulng.rsoptpluginsactive"
|
|
msgid "Active"
|
|
msgstr "Radni"
|
|
|
|
#: ulng.rsoptpluginsdescription
|
|
msgctxt "ulng.rsoptpluginsdescription"
|
|
msgid "Description"
|
|
msgstr "Opis"
|
|
|
|
#: ulng.rsoptpluginsfilename
|
|
msgctxt "ulng.rsoptpluginsfilename"
|
|
msgid "File name"
|
|
msgstr "Ime datoteke"
|
|
|
|
#: ulng.rsoptpluginshowbyextension
|
|
msgid "By extension"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptpluginshowbyplugin
|
|
msgid "By Plugin"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptpluginsname
|
|
msgctxt "ulng.rsoptpluginsname"
|
|
msgid "Name"
|
|
msgstr "Ime"
|
|
|
|
#: ulng.rsoptpluginsortonlywhenbyextension
|
|
msgid "Sorting WCX plugins is only possible when showing plugins by extension"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptpluginsregisteredfor
|
|
msgctxt "ulng.rsoptpluginsregisteredfor"
|
|
msgid "Registered for"
|
|
msgstr "Prijavljen za"
|
|
|
|
#: ulng.rsoptrenamingtooltipfiletype
|
|
msgid "Renaming tooltip file type"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptsearchcase
|
|
msgid "&Sensitive;&Insensitive"
|
|
msgstr "&Osetljivo;&Neosetljivo"
|
|
|
|
#: ulng.rsoptsearchitems
|
|
msgid "&Files;Di&rectories;Files a&nd Directories"
|
|
msgstr "&Datoteke;&Fascikle;Datoteke i fascikle"
|
|
|
|
#: ulng.rsoptsearchopt
|
|
#, fuzzy
|
|
#| msgid "&Hide filter panel when not focused"
|
|
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
|
msgstr "&Skriva površ uslova kada on nije u žiži"
|
|
|
|
#: ulng.rsoptsortcasesens
|
|
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
|
msgstr "neosetljivo na veličinu slova;prema postavkama lokaliteta (aAbBvV);prvo velika, pa mala slova (ABVabv)"
|
|
|
|
#: ulng.rsoptsortfoldermode
|
|
msgid "sort by name and show first;sort like files and show first;sort like files"
|
|
msgstr "rasporedi po imenu i prikaži prvu;rasporedi kao datoteke i prikaži prvu;rasporedi kao datoteke"
|
|
|
|
#: ulng.rsoptsortmethod
|
|
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
|
msgstr "Azbučno, vodeći računa o akcentima;Prirodan raspored: azbučno i brojevno"
|
|
|
|
#: ulng.rsopttabsposition
|
|
msgid "Top;Bottom;"
|
|
msgstr "Vrh;Dno"
|
|
|
|
#: ulng.rsopttoolbarbuttontype
|
|
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
|
msgstr "Razdvajač&;&unutrašnja naredba;&Spoljna naredba;Izbornik&"
|
|
|
|
#: ulng.rsopttooltipconfiguresavetochange
|
|
msgid "To change file type tooltip configuration, either APPLY or DELETE current editing one"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletype
|
|
msgid "Tooltip file type name:"
|
|
msgstr "Vrsta imena&:"
|
|
|
|
#: ulng.rsopttooltipfiletypealreadyexists
|
|
msgid "\"%s\" already exists!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypeconfirmdelete
|
|
msgctxt "ulng.rsopttooltipfiletypeconfirmdelete"
|
|
msgid "Are you sure you want to delete: \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypedefaultexportfilename
|
|
msgid "Exported tooltip file type configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypeexportcaption
|
|
msgid "Export tooltip file type configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypeexportdone
|
|
msgctxt "ulng.rsopttooltipfiletypeexportdone"
|
|
msgid "Exportation of %d elements to file \"%s\" completed."
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypeexportprompt
|
|
msgctxt "ulng.rsopttooltipfiletypeexportprompt"
|
|
msgid "Select the one(s) you want to export"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypeimportcaption
|
|
msgid "Import tooltip file type configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypeimportdone
|
|
msgctxt "ulng.rsopttooltipfiletypeimportdone"
|
|
msgid "Importation of %d elements from file \"%s\" completed."
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypeimportfile
|
|
msgid "Select the file to import tooltip file type configuration(s)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypeimportprompt
|
|
msgctxt "ulng.rsopttooltipfiletypeimportprompt"
|
|
msgid "Select the one(s) you want to import"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipfiletypewheretosave
|
|
msgid "Enter location and filename where to save tooltip file type configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttooltipsfiletypename
|
|
msgid "Tooltip file type name"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopttypeofduplicatedrename
|
|
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptupdatedfilesposition
|
|
msgid "don't change position;use the same setting as for new files;to sorted position"
|
|
msgstr "ne menjaj položaj;koristi iste postavke za nove datoteke;na položaju po rasporedu"
|
|
|
|
#: ulng.rspluginfilenamestylelist
|
|
msgid "With complete absolute path;Path relative to %COMMANDER_PATH%;Relative to the following"
|
|
msgstr ""
|
|
|
|
#: ulng.rspropscontains
|
|
msgid "Files: %d, folders: %d"
|
|
msgstr "Datoteka: %d, fascikli: %d"
|
|
|
|
#: ulng.rspropserrchmod
|
|
msgid "Can not change access rights for \"%s\""
|
|
msgstr "Nisam uspeo da promenim prava pristupa za „%s“"
|
|
|
|
#: ulng.rspropserrchown
|
|
msgid "Can not change owner for \"%s\""
|
|
msgstr "Nisam uspeo da promenim vlasnika „%s“"
|
|
|
|
#: ulng.rspropsfile
|
|
msgctxt "ulng.rspropsfile"
|
|
msgid "File"
|
|
msgstr "Datoteka"
|
|
|
|
#: ulng.rspropsfolder
|
|
msgctxt "ulng.rspropsfolder"
|
|
msgid "Directory"
|
|
msgstr "Fascikla"
|
|
|
|
#: ulng.rspropsnmdpipe
|
|
msgid "Named pipe"
|
|
msgstr "Imenovana cev"
|
|
|
|
#: ulng.rspropssocket
|
|
msgid "Socket"
|
|
msgstr "Utičnica"
|
|
|
|
#: ulng.rspropsspblkdev
|
|
msgid "Special block device"
|
|
msgstr "Naročiti blok uređaj"
|
|
|
|
#: ulng.rspropsspchrdev
|
|
msgid "Special character device"
|
|
msgstr "Naročiti znakovni uređaj"
|
|
|
|
#: ulng.rspropssymlink
|
|
msgid "Symbolic link"
|
|
msgstr "Simbolička veza"
|
|
|
|
#: ulng.rspropsunknowntype
|
|
msgid "Unknown type"
|
|
msgstr "Nepoznata vrsta"
|
|
|
|
#: ulng.rssearchresult
|
|
msgid "Search result"
|
|
msgstr "Izlazi pretrage"
|
|
|
|
#: ulng.rssearchstatus
|
|
msgid "SEARCH"
|
|
msgstr "Traži"
|
|
|
|
#: ulng.rssearchtemplateunnamed
|
|
msgid "<unnamed template>"
|
|
msgstr "<neimenovani obrazac>"
|
|
|
|
#: ulng.rssearchwithdsxplugininprogress
|
|
msgid ""
|
|
"A file search using DSX plugin is already in progress.\n"
|
|
"We need that one to be completed before to launch a new one.\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rssearchwithwdxplugininprogress
|
|
msgid ""
|
|
"A file search using WDX plugin is already in progress.\n"
|
|
"We need that one to be completed before to launch a new one.\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsselectdir
|
|
msgid "Select a directory"
|
|
msgstr "Izaberite fasciklu"
|
|
|
|
#: ulng.rsselectyoufindfileswindow
|
|
msgid "Select your window"
|
|
msgstr ""
|
|
|
|
#: ulng.rsshowhelpfor
|
|
msgid "&Show help for %s"
|
|
msgstr "&Prikaži pomoć za %s"
|
|
|
|
#: ulng.rssimplewordall
|
|
msgctxt "ulng.rssimplewordall"
|
|
msgid "All"
|
|
msgstr "Sve"
|
|
|
|
#: ulng.rssimplewordcategory
|
|
msgctxt "ulng.rssimplewordcategory"
|
|
msgid "Category"
|
|
msgstr ""
|
|
|
|
#: ulng.rssimplewordcolumnsingular
|
|
msgid "Column"
|
|
msgstr ""
|
|
|
|
#: ulng.rssimplewordcommand
|
|
#, fuzzy
|
|
msgctxt "ulng.rssimplewordcommand"
|
|
msgid "Command"
|
|
msgstr "Naredba"
|
|
|
|
#: ulng.rssimplewordfilename
|
|
msgid "Filename"
|
|
msgstr ""
|
|
|
|
#: ulng.rssimplewordfiles
|
|
msgid "files"
|
|
msgstr "Datoteke"
|
|
|
|
#: ulng.rssimplewordletter
|
|
msgid "Letter"
|
|
msgstr ""
|
|
|
|
#: ulng.rssimplewordparameter
|
|
msgid "Param"
|
|
msgstr ""
|
|
|
|
#: ulng.rssimplewordresult
|
|
msgid "Result"
|
|
msgstr ""
|
|
|
|
#: ulng.rssimplewordworkdir
|
|
msgid "WorkDir"
|
|
msgstr ""
|
|
|
|
#: ulng.rssizeunitbytes
|
|
msgid "Bytes"
|
|
msgstr "Bajtova"
|
|
|
|
#: ulng.rssizeunitgbytes
|
|
msgctxt "ulng.rssizeunitgbytes"
|
|
msgid "Gigabytes"
|
|
msgstr "Gigabajta"
|
|
|
|
#: ulng.rssizeunitkbytes
|
|
msgctxt "ulng.rssizeunitkbytes"
|
|
msgid "Kilobytes"
|
|
msgstr "Kilobajta"
|
|
|
|
#: ulng.rssizeunitmbytes
|
|
msgctxt "ulng.rssizeunitmbytes"
|
|
msgid "Megabytes"
|
|
msgstr "Megabajta"
|
|
|
|
#: ulng.rssizeunittbytes
|
|
msgid "Terabytes"
|
|
msgstr "Terabajta"
|
|
|
|
#: ulng.rsspacemsg
|
|
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
|
msgstr "Datoteka: %d, Fascikli: %d, Veličina: %s (%s bajta)"
|
|
|
|
#: ulng.rsspliterrdirectory
|
|
msgid "Unable to create target directory!"
|
|
msgstr "Nisam uspeo da napravim ciljnu fasciklu."
|
|
|
|
#: ulng.rsspliterrfilesize
|
|
msgid "Incorrect file size format!"
|
|
msgstr "Oblik veličine datoteke nije ispravan."
|
|
|
|
#: ulng.rsspliterrsplitfile
|
|
msgid "Unable to split the file!"
|
|
msgstr "Nisam uspeo da podelim datoteku."
|
|
|
|
#: ulng.rssplitmsgmanyparts
|
|
msgid "The number of parts is more than 100! Continue?"
|
|
msgstr "Broj delova je više od 100! Da li da nastavim?"
|
|
|
|
#: ulng.rssplitpredefinedsizes
|
|
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
|
msgstr ""
|
|
|
|
#: ulng.rssplitseldir
|
|
msgid "Select directory:"
|
|
msgstr "Izaberite fasciklu:"
|
|
|
|
#: ulng.rsstraccents
|
|
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstraccentsstripped
|
|
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewjustpreview
|
|
msgid "Just preview"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewothers
|
|
msgid "Others"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewsearchingletters
|
|
msgid "OU"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewsidenote
|
|
msgid "Side note"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched1
|
|
msgid "Flat"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched2
|
|
msgid "Limited"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched3
|
|
msgid "Simple"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched1
|
|
msgid "Fabulous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched2
|
|
msgid "Marvelous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched3
|
|
msgid "Tremendous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosedirhistory
|
|
msgid "Choose your directory from Dir History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefavoritetabs
|
|
msgid "Choose you Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
|
msgid "Choose your command from Command Line History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefrommainmenu
|
|
msgid "Choose your action from Main Menu"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefromtoolbar
|
|
msgid "Choose your action from Maintool bar"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosehotdirectory
|
|
msgid "Choose your directory from Hot Directory:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchooseviewhistory
|
|
msgid "Choose your directory from File View History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchooseyourfileordir
|
|
msgid "Choose your file or your directory"
|
|
msgstr ""
|
|
|
|
#: ulng.rssymerrcreate
|
|
msgid "Error creating symlink."
|
|
msgstr "Greška prilikom stvaranja simboličke veze."
|
|
|
|
#: ulng.rssyndefaulttext
|
|
msgctxt "ulng.rssyndefaulttext"
|
|
msgid "Default text"
|
|
msgstr "Podrazumevani tekst"
|
|
|
|
#: ulng.rssynlangplaintext
|
|
msgctxt "ulng.rssynlangplaintext"
|
|
msgid "Plain text"
|
|
msgstr "Običan tekst"
|
|
|
|
#: ulng.rstabsactionondoubleclickchoices
|
|
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
|
msgstr ""
|
|
|
|
#: ulng.rstimeunitday
|
|
msgctxt "ulng.rstimeunitday"
|
|
msgid "Day(s)"
|
|
msgstr "Dan(i)"
|
|
|
|
#: ulng.rstimeunithour
|
|
msgid "Hour(s)"
|
|
msgstr "Sat(i)"
|
|
|
|
#: ulng.rstimeunitminute
|
|
msgid "Minute(s)"
|
|
msgstr "Minut(i)"
|
|
|
|
#: ulng.rstimeunitmonth
|
|
msgid "Month(s)"
|
|
msgstr "Mesec(i)"
|
|
|
|
#: ulng.rstimeunitsecond
|
|
msgid "Second(s)"
|
|
msgstr "Sekunda (e)"
|
|
|
|
#: ulng.rstimeunitweek
|
|
msgid "Week(s)"
|
|
msgstr "Nedelja(e)"
|
|
|
|
#: ulng.rstimeunityear
|
|
msgid "Year(s)"
|
|
msgstr "Godina(e)"
|
|
|
|
#: ulng.rstitlerenamefavtabs
|
|
msgid "Rename Favorite Tabs"
|
|
msgstr ""
|
|
|
|
#: ulng.rstitlerenamefavtabsmenu
|
|
msgid "Rename Favorite Tabs sub-menu"
|
|
msgstr ""
|
|
|
|
#: ulng.rstooldiffer
|
|
msgctxt "ulng.rstooldiffer"
|
|
msgid "Differ"
|
|
msgstr "Razlika"
|
|
|
|
#: ulng.rstooleditor
|
|
msgctxt "ulng.rstooleditor"
|
|
msgid "Editor"
|
|
msgstr "Uređivač"
|
|
|
|
#: ulng.rstoolerroropeningdiffer
|
|
msgid "Error opening differ"
|
|
msgstr "Desila se greška pri otvaranju programa za razlike"
|
|
|
|
#: ulng.rstoolerroropeningeditor
|
|
msgid "Error opening editor"
|
|
msgstr "Desila se greška pri otvaranju urednika"
|
|
|
|
#: ulng.rstoolerroropeningterminal
|
|
msgid "Error opening terminal"
|
|
msgstr "Desila se greška pri otvaranju terminala"
|
|
|
|
#: ulng.rstoolerroropeningviewer
|
|
msgid "Error opening viewer"
|
|
msgstr "Desila se greška pri otvaranju preglednika"
|
|
|
|
#: ulng.rstoolterminal
|
|
msgctxt "ulng.rstoolterminal"
|
|
msgid "Terminal"
|
|
msgstr "Terminal"
|
|
|
|
#: ulng.rstooltiphidetimeoutlist
|
|
msgid "System default;1 sec;2 sec;3 sec;5 sec;10 sec;30 sec;1 min;Never hide"
|
|
msgstr ""
|
|
|
|
#: ulng.rstooltipmodelist
|
|
msgid "Combine DC and system tooltip, DC first (legacy);Combine DC and system tooltip, system first;Show DC tooltip when possible and system when not;Show DC tooltip only;Show system tooltip only"
|
|
msgstr ""
|
|
|
|
#: ulng.rstoolviewer
|
|
msgctxt "ulng.rstoolviewer"
|
|
msgid "Viewer"
|
|
msgstr "Preglednik"
|
|
|
|
#: ulng.rsunhandledexceptionmessage
|
|
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
|
msgstr "Prijavite grešku bubolovcu sa opisom radnje koju ste primenjivali na sledeću datoteku: %s. Pritisnite %s za nastavak ili %s za izlazak iz programa."
|
|
|
|
#: ulng.rsvarbothpanelactivetoinactive
|
|
msgid "Both panels, from active to inactive"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarbothpanellefttoright
|
|
msgid "Both panels, from left to right"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarcurrentpath
|
|
msgid "Path of panel"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarencloseelement
|
|
msgid "Enclose each name in brackets or what you want"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarfilenamenoext
|
|
msgid "Just filename, no extension"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarfullpath
|
|
msgid "Complete filename (path+filename)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarhelpwith
|
|
msgid "Help with \"%\" variables"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarinputparam
|
|
msgid "Will request request user to enter a parameter with a default suggested value"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarleftpanel
|
|
msgid "Left panel"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistfilename
|
|
msgid "Temporary filename of list of filenames"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistfullfilename
|
|
msgid "Temporary filename of list of complete filenames (path+filename)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistinutf16
|
|
msgid "Filenames in list in UTF-16 with BOM"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistinutf16quoted
|
|
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistinutf8
|
|
msgid "Filenames in list in UTF-8"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistinutf8quoted
|
|
msgid "Filenames in list in UTF-8, inside double quotes"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistrelativefilename
|
|
msgid "Temporary filename of list of filenames with relative path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvaronlyextension
|
|
msgid "Only file extension"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvaronlyfilename
|
|
msgid "Only filename"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarotherexamples
|
|
msgid "Other example of what's possible"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarpath
|
|
msgid "Path, without ending delimiter"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarpercentchangetopound
|
|
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarpercentsign
|
|
msgid "Return the percent sign"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarpoundchangetopercent
|
|
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarprependelement
|
|
msgid "Prepend each name with \"-a \" or what you want"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarpromptuserforparam
|
|
msgid "%[Prompt user for param;Default value proposed]"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarrelativepathandfilename
|
|
msgid "Filename with relative path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarrightpanel
|
|
msgid "Right panel"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarsecondelementrightpanel
|
|
msgid "Full path of second selected file in right panel"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarshowcommandprior
|
|
msgid "Show command prior execute"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarsimplemessage
|
|
msgid "%[Simple message]"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarsimpleshowmessage
|
|
msgid "Will show a simple message"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarsourcepanel
|
|
msgid "Active panel (source)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvartargetpanel
|
|
msgid "Inactive panel (target)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarwillbequoted
|
|
msgid "Filenames will be quoted from here (default)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarwilldointerminal
|
|
msgid "Command will be done in terminal, remaining opened at the end"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarwillhaveendingdelimiter
|
|
msgid "Paths will have ending delimiter"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarwillnotbequoted
|
|
msgid "Filenames will not be quoted from here"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarwillnotdointerminal
|
|
msgid "Command will be done in terminal, closed at the end"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarwillnothaveendingdelimiter
|
|
msgid "Paths will not have ending delimiter (default)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvfsnetwork
|
|
msgctxt "ulng.rsvfsnetwork"
|
|
msgid "Network"
|
|
msgstr "Mreža"
|
|
|
|
#: ulng.rsviewabouttext
|
|
msgid "Internal Viewer of Double Commander."
|
|
msgstr "Unutrašnji preglednik Double Commander-a."
|
|
|
|
#: ulng.rsviewbadquality
|
|
msgid "Bad Quality"
|
|
msgstr ""
|
|
|
|
#: ulng.rsviewencoding
|
|
msgctxt "ulng.rsviewencoding"
|
|
msgid "Encoding"
|
|
msgstr "Šifrovanje"
|
|
|
|
#: ulng.rsviewimagetype
|
|
msgid "Image Type"
|
|
msgstr ""
|
|
|
|
#: ulng.rsviewnewsize
|
|
#, fuzzy
|
|
msgctxt "ulng.rsviewnewsize"
|
|
msgid "New Size"
|
|
msgstr "Nova veličina"
|
|
|
|
#: ulng.rsviewnotfound
|
|
msgid "%s not found!"
|
|
msgstr "Nisam uspeo da pronađem %s."
|
|
|
|
#: ulng.rsviewwithexternalviewer
|
|
msgid "with external viewer"
|
|
msgstr ""
|
|
|
|
#: ulng.rsviewwithinternalviewer
|
|
msgid "with internal viewer"
|
|
msgstr ""
|
|
|
|
#: ulng.rsxreplacements
|
|
msgid "Number of replacement: %d"
|
|
msgstr ""
|
|
|
|
#: ulng.rszeroreplacement
|
|
msgid "No replacement took place."
|
|
msgstr ""
|
|
|