doublecmd/language/doublecmd.sl.po
2017-10-26 19:56:34 +00:00

12007 lines
332 KiB
Text
Raw Blame History

This file contains ambiguous Unicode characters

This file contains Unicode characters that might be confused with other characters. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.

# Slovenian translations for double-commander.
# Copyright (C) YEAR THE PACKAGE'S COPYRIGHT HOLDER.
# This file is distributed under the same license as the double-commander package.
#
# Matej Urbančič <mateju@svn.gnome.org>, 20112017.
msgid ""
msgstr ""
"Project-Id-Version: double-commander master\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2017-09-25 21:39+0200\n"
"Last-Translator: Matej Urbančič <mateju@svn.gnome.org>\n"
"Language-Team: Slovenian GNOME Translation Team <gnome-si@googlegroups.com>\n"
"Language: sl_SI\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Plural-Forms: nplurals=4; plural=(n%100==1 ? 1 : n%100==2 ? 2 : n%100==3 || n%100==4 ? 3 : 0);\n"
"X-Poedit-SourceCharset: utf-8\n"
"X-Generator: Poedit 2.0.1\n"
"X-Native-Language: Slovenščina\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Poteka primerjava ... %d%% (s tipko ESC se opravilo prekliče)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Desno: izbriši %d datotek"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Število najdenih datotek: %d (Enakih: %d, Različnih: %d, Različnih na levi: %d, Različnih na desni: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Z leve na desno: kopiraj %d datotek s skupno velikostjo %d bajtov"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Z desne na levo: kopiraj %d datotek s skupno velikostjo %d bajtov"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Izbor predloge ..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Preveri &zasedenost prostora"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "&Kopiraj atribute"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Kopiraj &lastništvo"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Kopiraj &dovoljenja"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopiraj &datum in čas"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Popravi &povezave"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgid "Drop readonly fla&g"
msgstr "Izpusti zastavico le za branje"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Ne &upoštevaj praznih map"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Sledi &povezavam"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "&Zadrži prostor"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr "&Preveri"
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Kaj storiti, ko ni mogoče nastaviti časa datoteke, atributov ..."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Uporabi predlogo datotek"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Če mapa že obstaja"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgid "When &file exists"
msgstr "Če datoteka &že obstaja"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Ko &lastnosti ni mogoče nastaviti"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<brez predloge>"
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr "&Zapri"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Kopiraj v odložišče"
#: tfrmabout.caption
msgctxt "tfrmabout.caption"
msgid "About"
msgstr "O programu"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Datum izgradnje"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Domača stran:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "tfrmabout.lblrevision.caption"
msgid "Revision"
msgstr "Predelava"
#: tfrmabout.lbltitle.caption
msgctxt "tfrmabout.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Različica"
#: tfrmattributesedit.btncancel.caption
msgctxt "tfrmattributesedit.btncancel.caption"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmattributesedit.btnok.caption
msgctxt "tfrmattributesedit.btnok.caption"
msgid "&OK"
msgstr "V &redu"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Ponastavi"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Izbor atributov"
#: tfrmattributesedit.cbarchive.caption
msgid "&Archive"
msgstr "&Arhiv"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "&Stisnjeno"
#: tfrmattributesedit.cbdirectory.caption
msgid "&Directory"
msgstr "&Mapa"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "&Šifrirano"
#: tfrmattributesedit.cbhidden.caption
msgid "&Hidden"
msgstr "&Skrito"
#: tfrmattributesedit.cbreadonly.caption
msgid "Read o&nly"
msgstr "Le za &branje"
#: tfrmattributesedit.cbsgid.caption
msgctxt "tfrmattributesedit.cbsgid.caption"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "&Redko"
#: tfrmattributesedit.cbsticky.caption
msgctxt "tfrmattributesedit.cbsticky.caption"
msgid "Sticky"
msgstr "Lepljivo"
#: tfrmattributesedit.cbsuid.caption
msgctxt "tfrmattributesedit.cbsuid.caption"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Simbolna povezava"
#: tfrmattributesedit.cbsystem.caption
msgid "S&ystem"
msgstr "S&istem"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Začasno"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Atributi NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Splošni atributi"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "tfrmattributesedit.lblattrbitsstr.caption"
msgid "Bits:"
msgstr "Biti:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "tfrmattributesedit.lblattrgroupstr.caption"
msgid "Group"
msgstr "Skupina"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "tfrmattributesedit.lblattrotherstr.caption"
msgid "Other"
msgstr "Drugo"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "tfrmattributesedit.lblattrownerstr.caption"
msgid "Owner"
msgstr "Lastnik"
#: tfrmattributesedit.lblexec.caption
msgctxt "tfrmattributesedit.lblexec.caption"
msgid "Execute"
msgstr "Izvajanje"
#: tfrmattributesedit.lblread.caption
msgctxt "tfrmattributesedit.lblread.caption"
msgid "Read"
msgstr "Branje"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Kot &besedilo:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "tfrmattributesedit.lblwrite.caption"
msgid "Write"
msgstr "Pisanje"
#: tfrmchecksumcalc.caption
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Izračun nadzornih vsot"
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Po koncu izračunavanja odpri datoteko nadzorne vsote"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "Za vsako datoteko &ustvari ločeno datoteko nadzorne vsote"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "Shrani datoteke z nadzornimi &vsotami v:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zapri"
#: tfrmchecksumverify.caption
msgctxt "tfrmchecksumverify.caption"
msgid "Verify checksum..."
msgstr "Preveri nadzo&rno vsoto ..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "tfrmconnectionmanager.btnadd.caption"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "&Povezava"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "tfrmconnectionmanager.btndelete.caption"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "tfrmconnectionmanager.btnedit.caption"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Upravljalnik povezav"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Povezava s strežnikom:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "&Dodaj v vrsto"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "&Možnosti"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "&Shrani trenutne možnosti kot privzete"
#: tfrmcopydlg.caption
msgctxt "tfrmcopydlg.caption"
msgid "Copy file(s)"
msgstr "Kopiraj datoteke"
#: tfrmcopydlg.mnunewqueue.caption
msgid "New queue"
msgstr "Nova čakalna vrsta"
#: tfrmcopydlg.mnuqueue1.caption
msgid "Queue 1"
msgstr "Vrsta 1"
#: tfrmcopydlg.mnuqueue2.caption
msgid "Queue 2"
msgstr "Vrsta 2"
#: tfrmcopydlg.mnuqueue3.caption
msgid "Queue 3"
msgstr "Vrsta 3"
#: tfrmcopydlg.mnuqueue4.caption
msgid "Queue 4"
msgstr "Vrsta 4"
#: tfrmcopydlg.mnuqueue5.caption
msgid "Queue 5"
msgstr "Vrsta 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Shrani opis"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&V redu"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Opomba datoteke ali mape"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "&Uredi opombo za:"
#: tfrmdescredit.lblencoding.caption
msgid "&Encoding:"
msgstr "&Kodni nabor:"
#: tfrmdescredit.lblfilename.caption
msgctxt "tfrmdescredit.lblfilename.caption"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Samodejna primerjava"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Dvojiški način"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "tfrmdiffer.actcancelcompare.caption"
msgid "Cancel"
msgstr "Prekliči"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Prekliči"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "tfrmdiffer.actcopylefttoright.caption"
msgid "Copy Block Right"
msgstr "Kopiraj blok na desno"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Kopiraj blok na desno"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "tfrmdiffer.actcopyrighttoleft.caption"
msgid "Copy Block Left"
msgstr "Kopiraj blok na levo"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Kopiraj blok na levo"
#: tfrmdiffer.acteditcopy.caption
msgctxt "tfrmdiffer.acteditcopy.caption"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmdiffer.acteditcut.caption
msgctxt "tfrmdiffer.acteditcut.caption"
msgid "Cut"
msgstr "Izreži"
#: tfrmdiffer.acteditdelete.caption
msgctxt "tfrmdiffer.acteditdelete.caption"
msgid "Delete"
msgstr "Izbriši"
#: tfrmdiffer.acteditpaste.caption
msgctxt "tfrmdiffer.acteditpaste.caption"
msgid "Paste"
msgstr "Prilepi"
#: tfrmdiffer.acteditredo.caption
msgctxt "tfrmdiffer.acteditredo.caption"
msgid "Redo"
msgstr "Ponovno uveljavi"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Izberi &vse"
#: tfrmdiffer.acteditundo.caption
msgctxt "tfrmdiffer.acteditundo.caption"
msgid "Undo"
msgstr "Razveljavi"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "&Končaj"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Prva razlika"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Prva razlika"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Prezri velikost črk"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Prezri prazne"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Nadaljuj drsenje"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Zadnja razlika"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Zadnja razlika"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Vrstične razlike"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Naslednja razlika"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Naslednja razlika"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Odpri levo ..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Odpri desno ..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Obarvaj ozadje"
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Predhodna razlika"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Predhodna razlika"
#: tfrmdiffer.actreload.caption
msgid "&Reload"
msgstr "&Ponovno naloži"
#: tfrmdiffer.actreload.hint
msgctxt "tfrmdiffer.actreload.hint"
msgid "Reload"
msgstr "Ponovno naloži"
#: tfrmdiffer.actsave.caption
msgctxt "tfrmdiffer.actsave.caption"
msgid "Save"
msgstr "Shrani"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Shrani"
#: tfrmdiffer.actsaveas.caption
msgctxt "tfrmdiffer.actsaveas.caption"
msgid "Save as..."
msgstr "Shrani kot ..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Shrani kot ..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "tfrmdiffer.actsaveleft.caption"
msgid "Save Left"
msgstr "Shrani levo"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Shrani levo"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "tfrmdiffer.actsaveleftas.caption"
msgid "Save Left As..."
msgstr "Shrani levo kot ..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Shrani levo kot ..."
#: tfrmdiffer.actsaveright.caption
msgctxt "tfrmdiffer.actsaveright.caption"
msgid "Save Right"
msgstr "Shrani desno"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Shrani desno"
#: tfrmdiffer.actsaverightas.caption
msgctxt "tfrmdiffer.actsaverightas.caption"
msgid "Save Right As..."
msgstr "Shrani desno kot ..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Shrani desno kot ..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "tfrmdiffer.actstartcompare.caption"
msgid "Compare"
msgstr "Primerjava"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Primerjava"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "tfrmdiffer.btnleftencoding.hint"
msgid "Encoding"
msgstr "Nabor znakov"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Nabor znakov"
#: tfrmdiffer.caption
msgid "Compare files"
msgstr "Primerjava datotek"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "tfrmdiffer.midivider7.caption"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Levo"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "&Desno"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Dejanja"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&&Uredi"
#: tfrmdiffer.mnuencoding.caption
msgctxt "tfrmdiffer.mnuencoding.caption"
msgid "En&coding"
msgstr "Nabor &znakov"
#: tfrmdiffer.mnufile.caption
msgctxt "tfrmdiffer.mnufile.caption"
msgid "&File"
msgstr "&Datoteka"
#: tfrmdiffer.mnuoptions.caption
msgid "&Options"
msgstr "&Možnosti"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Dodaj novo tipkovno bližnjico v zaporedje"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "V &redu"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Odstrani zadnjo tipkovno bližnjico iz zaporedja"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr "Izbor tipkovne bližnjice iz seznama preostalih neuporabljenih tipk"
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr "Le za navedene tipke"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parametri (vsak ločeno v svoji vrstici):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Tipkovne bližnjice:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "O programu"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Nastavitve"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Nastavitve"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Izreži"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Izreži"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Izbriši"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Najdi"
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Najdi"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Najdi naslednje"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Najdi naslednje"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Najdi predhodno"
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr "Skoči v vrstico ..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Prilepi"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Prilepi"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Ponovi"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Ponovno uveljavi"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Zamenjaj"
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Zamenjaj"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Izberi &vse"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Izberi vse"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Razveljavi"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Razveljavi"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Zapri"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Zapri"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Končaj"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Končaj"
#: tfrmeditor.actfilenew.caption
msgid "&New"
msgstr "&Nov stolpec"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Novo"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Odpri"
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Odpri"
#: tfrmeditor.actfilesave.caption
msgctxt "tfrmeditor.actfilesave.caption"
msgid "&Save"
msgstr "&Shrani"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Shrani"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Shrani &kot ..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Shrani kot"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Shra&ni vse"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Shrani vse"
#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr "Urejevalnik"
#: tfrmeditor.help1.caption
msgctxt "tfrmeditor.help1.caption"
msgid "&Help"
msgstr "Pomo&č"
#: tfrmeditor.menuitem1.caption
msgctxt "TFRMEDITOR.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Nabor &znakov"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Odpri kot"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Shrani kot …"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Datoteka"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Poudarjanje skladnje"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Konec vrstice"
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n5.caption
msgctxt "TFRMEDITOR.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.CANCELBUTTON.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "V &redu"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgid "C&ase sensitivity"
msgstr "Upoštevanje &velikosti črk"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgid "S&earch from caret"
msgstr "Išči od &kazalke naprej"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgid "&Regular expressions"
msgstr "&Logični izraz"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgid "Selected &text only"
msgstr "Le izbrano &besedilo"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgid "&Whole words only"
msgstr "Le &cele besede"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgid "Option"
msgstr "Možnost"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgid "&Replace with:"
msgstr "Zamenjaj &z:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgid "&Search for:"
msgstr "&Poišči:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgid "Direction"
msgstr "Smer"
#: tfrmextractdlg.caption
msgid "Unpack files"
msgstr "Odpakiranje datotek"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Odpakiraj poti datotek, če to se shranjene v arhivu"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Odpakiraj vsak arhiv v &ločeno podrejeno mapo (z imenom vsakega arhiva)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "&Prepiši obstoječe datoteke"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "V &mapo:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "&Odpakiraj datoteke z masko:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "&Geslo šifriranih datotek:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zapri"
#: tfrmfileexecuteyourself.caption
msgid "Wait..."
msgstr "Počakaj ..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Ime datoteke:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "tfrmfileexecuteyourself.lblfrompath.caption"
msgid "From:"
msgstr "Iz:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Kliknite na gumb za zapiranje, ko se začasno datoteko lahko izbriše!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "Na &okno"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "Poglej &vse"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Trenutno opravilo:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Iz:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "V:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zapri"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "&Nastavi"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Nastavi &vsem"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Pres&koči datoteko"
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr "Lastnosti"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Lepljivo"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr "Dovoli izvajanje datote&ke kot programa"
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Lastnik"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Biti:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Skupina"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ostalo"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Lastnik"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "tfrmfileproperties.lblattrtext.caption"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
msgid "Text:"
msgstr "Črkovno:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Vsebuje:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Izvajanje"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr "Izvedi:"
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Ime datoteke"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "tfrmfileproperties.lblfilestr.caption"
msgid "File name"
msgstr "Ime datoteke"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Pot:"
#: tfrmfileproperties.lblgroupstr.caption
msgid "&Group"
msgstr "&Skupina"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Zadnji dostop:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Zadnja sprememba:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Zadnja sprememba stanja:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "tfrmfileproperties.lbloctal.caption"
msgid "Octal:"
msgstr "Osmiško:"
#: tfrmfileproperties.lblownerstr.caption
msgid "O&wner"
msgstr "&Lastnik"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Branje"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "tfrmfileproperties.lblsizestr.caption"
msgid "Size:"
msgstr "Velikost:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Simbolna povezava na:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Vrsta:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Pisanje"
#: tfrmfileproperties.sgimage.columns[0].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Ime"
#: tfrmfileproperties.sgimage.columns[1].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Vrednost"
#: tfrmfileproperties.tsattributes.caption
msgctxt "tfrmfileproperties.tsattributes.caption"
msgid "Attributes"
msgstr "Atributi"
#: tfrmfileproperties.tsplugins.caption
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Vstavki"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Lastnosti"
#: tfrmfinddlg.actcancel.caption
msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION"
msgid "C&ancel"
msgstr "&Prekliči"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "Prekliči iskanje in zapri okno"
#: tfrmfinddlg.actclose.caption
msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zapri"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "TFRMFINDDLG.ACTCONFIGFILESEARCHHOTKEYS.CAPTION"
msgid "Configuration of hot keys"
msgstr "Nastavitev hitrih tipk"
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&&Uredi"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "Izpiši v &seznam"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr "Prekliči iskanje, zapri okno in sprosti pomnilnik"
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr "Za vsa ostala iskanja, prekliči iskanje, zapri in sprosti pomnilnik."
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Skoči na datoteko"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION"
msgid "Find Data"
msgstr "Najdi podatke"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Zadnje iskanje"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Novo iskanje"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr "Novo iskanje (počisti filtre)"
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Skoči na stran »Napredno«"
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Skoči na stran »Nalaganje/Shranjevanje«"
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr "Skoči na &naslednjo stran"
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Skoči na stran »Vstavkov«"
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr "Skoči na &predhodno stran"
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Skoči na stran »Rezultatov«"
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Skoči na stran »Osnovno«"
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Začni"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Pogled"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Dodaj"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "Pomo&č"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Shrani"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "&Naloži"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "&Shrani"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Sh&rani z možnostjo »Začni v mapi«"
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "V kolikor je možnost »Začni v mapi« shranjena, bo mesto obnovljeno med nalaganjem predloge. Možnost je uporabna pri iskanju v določeni mapi."
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Uporabi predlogo"
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Najdi datoteke"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Upoštevaj &velikost črk"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "&Od datuma:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "&Do datuma:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "&Od velikosti:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "&Do velikosti:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "Omogoči iskanje v &arhivih"
#: tfrmfinddlg.cbfindtext.caption
msgid "Find &text in file"
msgstr "Najdi &besedilo"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgid "Follow s&ymlinks"
msgstr "Sledi &simbolnim povezavam"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgid "Find files N&OT containing the text"
msgstr "Najdi datoteke, ki &ne vsebujejo besedila"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Ni &starejše kot:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Odprti zavihki"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Poišči &del imena datoteke"
#: tfrmfinddlg.cbregexp.caption
msgid "&Regular expression"
msgstr "&Logični izraz"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "&Zamenjaj besedilo z"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Izbrane &datoteke in mape"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "Logični &izraz"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "&Od časa:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "&Do časa:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "Uporabi vstavek &iskanja:"
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Vpis imen map, ki naj ne bodo upoštevana v iskanju. Imena morajo biti ločena s podpičjem » ; «."
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Vpis imen datotek, ki naj ne bodo upoštevana v iskanju. Imena morajo biti ločena s podpičjem » ; «."
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Vpis imen datotek, ločenih s podpičjem » ; «"
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Mape"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Datoteke"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Najdi podatke"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "&Atributi"
#: tfrmfinddlg.lblencoding.caption
msgid "Encodin&g:"
msgstr "&Kodiranje:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "Ne upoštevaj &podmap:"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Ne upoštevaj &datotek"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "Poišči datoteke z &masko:"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Začni v &mapi"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Poišči tudi po &podrejenih mapah:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Shranjena iskanja:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr "&Dejanje"
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr "Za vsa ostala prekliči iskanje, zapri in sprosti pomnilnik"
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Odpri v novem zavihku"
#: tfrmfinddlg.mioptions.caption
msgctxt "TFRMFINDDLG.MIOPTIONS.CAPTION"
msgid "Options"
msgstr "Možnosti"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Odstrani s seznama"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr "&Rezultat"
#: tfrmfinddlg.miseparator1.caption
msgctxt "TFRMFINDDLG.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmfinddlg.miseparator2.caption
msgctxt "TFRMFINDDLG.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Pokaži vse najdene predmete"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Pokaži v urejevalniku"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Pokaži v pregledovalniku"
#: tfrmfinddlg.miviewtab.caption
msgctxt "TFRMFINDDLG.MIVIEWTAB.CAPTION"
msgid "&View"
msgstr "&Pogled"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Napredno"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Naloži/Shrani"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Vstavki"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Rezultati"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Običajno"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Najdi"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Najdi"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "&Razlikovanje velikosti črk"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&V redu"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Ustvarjanje trde povezave"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "tfrmhardlink.lblexistingfile.caption"
msgid "&Destination that the link will point to"
msgstr "&Pot povezave:"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "tfrmhardlink.lbllinktocreate.caption"
msgid "&Link name"
msgstr "Ime &povezave:"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr "Uvozi vse!"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr "Uvozi izbrano"
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr "Izberite vnose, ki jih želite uvoziti"
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "S klikom na podrejeni meni bo izbran celoten meni"
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "S klikom ob sočasno pritisnjeni tipki CTRL je mogoče izbrati več poljubnih predmetov"
#: tfrmlinker.btnsave.caption
msgctxt "tfrmlinker.btnsave.caption"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgid "Linker"
msgstr "Povezovalnik"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Shrani v ..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Predmet"
#: tfrmlinker.lblfilename.caption
msgid "&File name"
msgstr "&Ime datoteke"
#: tfrmlinker.spbtndown.caption
msgid "Do&wn"
msgstr "&Dol"
#: tfrmlinker.spbtndown.hint
msgid "Down"
msgstr "Navzdol"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "&Odstrani"
#: tfrmlinker.spbtnrem.hint
msgctxt "TFRMLINKER.SPBTNREM.HINT"
msgid "Delete"
msgstr "Izbriši"
#: tfrmlinker.spbtnup.caption
msgctxt "tfrmlinker.spbtnup.caption"
msgid "&Up"
msgstr "&Gor"
#: tfrmlinker.spbtnup.hint
msgid "Up"
msgstr "Navzgor"
#: tfrmmain.actabout.caption
msgid "&About"
msgstr "&O programu"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Doda ime datoteke v ukazno vrstico"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr "Novo iskanje ..."
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Doda pot in ime datoteke v ukazno vrstico"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Kopira pot v ukazno vrstico"
#: tfrmmain.actbriefview.caption
msgid "Brief view"
msgstr "Datotečni pogled"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Datotečni pogled"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Preračunaj &zasedenost prostora"
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Zamenjaj mapo"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Pojdi v osebno mapo"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Zamenjaj mapo v nadrejeno"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Zamenjaj mapo v korensko"
#: tfrmmain.actchecksumcalc.caption
msgid "Calculate Check&sum..."
msgstr "Izračunaj &nadzorno vsoto ..."
#: tfrmmain.actchecksumverify.caption
msgid "&Verify Checksum..."
msgstr "Preveri nadzo&rne vsote ..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Počisti dnevniško datoteko"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Počisti dnevniško okno"
#: tfrmmain.actclosealltabs.caption
msgid "Close &All Tabs"
msgstr "Zapri &vse zavihke"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Zapri podvojene zavihke"
#: tfrmmain.actclosetab.caption
msgid "&Close Tab"
msgstr "&Zapri zavihek"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Naslednji ukaz"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Izberi naslednji ukaz v zgodovini izvedenih ukazov."
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Predhodni ukaz"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Izberi predhodni ukaz v zgodovini izvedenih ukazov."
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Podrobni pogled"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Stolpčni pogled"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Primerjaj po &vsebini"
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr "Primerjava map"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Primerjava map"
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Možnosti seznama hitrih map"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Možnosti priljubljenih zavihkov"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Možnosti zavihkov map"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Nastavitev hitrih tipk"
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Shrani nastavitve"
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr "Nastavitev iskanja"
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Orodna vrstica ..."
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Nastavljanje menija drevesnega pogleda"
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Nastavljanje barv menija drevesnega pogleda"
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Pokaži vsebinski meni"
#: tfrmmain.actcopy.caption
msgctxt "TFRMMAIN.ACTCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Kopiraj vse zavihke na nasprotno okno"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Kopiraj vse prikazane &stolpce"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Kopiraj imena datotek s polno &potjo"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Kopiraj i&mena datotek v odložišče"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Kopiraj datoteke brez zahteve po potrditvi"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr "Kopiraj polno pot izbranih datotek brez ločilnika konca mape"
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Kopiraj imena datotek s polno &potjo"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Kopiraj v isto okno"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Kopiraj"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Pokaži &zasedenost prostora"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "I&zreži"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Pokaži parametre ukaza"
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr "Za vsa iskanja prekliči iskanje, zapri in sprosti pomnilnik"
#: tfrmmain.actdirhistory.caption
msgid "Directory history"
msgstr "Zgodovina mape"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Seznam &hitrih map"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Izbor kateregakoli ukaza za izvajanje"
#: tfrmmain.actedit.caption
msgctxt "TFRMMAIN.ACTEDIT.CAPTION"
msgid "Edit"
msgstr "Uredi"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Uredi &opombe datotek ..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Uredi novo datoteko"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Uredi polje poti nad seznamom datotek"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Zamenjaj &okni"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr "Izvedi skript"
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Končaj"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "Odpa&kiraj datoteke ..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Možnosti datotečnih &vezi"
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "Zdr&uži razdeljeno datoteko ..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Pokaži &lastnosti datoteke"
#: tfrmmain.actfilespliter.caption
msgid "Spl&it File..."
msgstr "Raz&deli datoteko ..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "&Ploski pogled"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Postavi ukazno vrstico v žarišče"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr "Preklopi žarišče"
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr "Preklopi med levim in desnim datotečnim oknom"
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Postavi kazalko na prvo datoteko seznama"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Postavi kazalko na zadnjo datoteko seznama"
#: tfrmmain.acthardlink.caption
msgid "Create &Hard Link..."
msgstr "Ustvari &trdo povezavo ..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Kazalo pomoči"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "Vodo&ravna postavitev oken"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Tipkovne bližnjice"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Datotečni pogled v levem oknu"
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Stolpčni pogled v levem oknu"
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Levo &= Desno"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "&Ploski pogled v levem oknu"
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Odpri seznam levega pogona"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "O&brnjen vrstni red v levem oknu"
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Razvrsti levo okno po &atributih"
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Razvrsti levo okno po &datumu"
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "Razvrsti levo okno po &priponi"
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "Razvrsti levo okno po &imenu"
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Razvrsti levo okno po &velikosti"
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Pogled sličic v levem oknu"
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "Naloži zavihke iz seznama priljubljenih"
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Naloži izbor iz o&dložišča"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "&Naloži izbor iz datoteke ..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "&Naloži nastavitve zavihkov iz datoteke"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "Ustvari &mapo"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Izberi vse datoteke z &enako pripono"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr "Izberi vse datoteke z enakim imenom"
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr "Izberi vse datoteke z enakim imenom in pripono"
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr "Izberi vse datoteke na isti poti"
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "Obrni iz&bor"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "Izberi &vse"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "Počisti i&zbor po meri ..."
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "&Izberi po meri ..."
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "Počisti &izbor"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Skrči okno"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Napredno &preimenovanje ..."
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Omrežna &povezava ..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "&Prekini omrežno povezavo"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "&Hitra povezava z omrežjem ..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "Ustvari nov &zavihek"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr "Naloži naslednji priljubljen zavihek na seznamu"
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Preklopi na &naslednji zavihek"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Odpri"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Poskusi odpreti arhiv"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Odpri datoteko orodne vrstice"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "O&dpri mapo v novem zavihku"
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgid "Open &VFS List"
msgstr "Odpri seznam &VFS"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "Pre&gledovalnik opravil"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Možnosti ..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "Zapakira&j datoteke ..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Določi položaj razdelilnika"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "&Prilepi"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Naloži predhodni priljubljen zavihek na seznamu"
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Preklopi na &predhodni zavihek"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Hitri filter"
#: tfrmmain.actquicksearch.caption
msgid "Quick search"
msgstr "Hitro iskanje"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "Okno &hitrega predogleda"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Osveži"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Ponovno naloži zadnji naložen priljubljen zavihek"
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Premakni"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Premakni/Preimenuj datoteke brez zahteve po potrditvi"
#: tfrmmain.actrenameonly.caption
msgctxt "tfrmmain.actrenameonly.caption"
msgid "Rename"
msgstr "Preimenuj"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "Pr&eimenuj zavihek"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Ponovno shrani zadnji naložen priljubljen zavihek"
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Obnovi zapomnjen izbor"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "O&brni razvrstitev"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Datotečni pogled v desnem oknu"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Stolpčni pogled v desnem oknu"
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Desno &= Levo"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "&Ploski pogled v desnem oknu"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Odpri seznam desnega pogona"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "O&brnjen vrstni red v desnem oknu"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Razvrsti desno okno po &atributih"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Razvrsti desno okno po &datumu"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Razvrsti desno okno po &priponi"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Razvrsti desno okno po &imenu"
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Razvrsti desno okno po &velikosti"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Pogled sličic v desnem oknu"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Zaženi &terminal"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Shrani trenutne zavihke med priljubljene"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Zapomni si izb&or"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Shrani &izbor v datoteko ..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "Shrani nastavitve &zavihkov v datoteko"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "I&skanje ..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Nastavi vse zavihke kot zaklenjene z možnostjo odpiranja map v novih zavihkih"
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Nastavi vse zavihke kot običajne"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Nastavi vse zavihke kot zaklenjene"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Nastavi vse zavihke kot zaklenjene z možnostjo spreminjanja map"
#: tfrmmain.actsetfileproperties.caption
msgid "Change &Attributes..."
msgstr "Spremeni &atribute ..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Zaklenjen zavihek z možnostjo o&dpiranja map v novih zavihkih"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Običajen zavihek"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Zaklenjen zavihek"
#: tfrmmain.actsettaboptionpathresets.caption
msgid "Locked with &Directory Changes Allowed"
msgstr "Zaklenjen zavihek z možnostjo &spreminjanja map"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Odpri"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Odpri z uporabo sistemskih programskih vezi"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Pokaži meni gumbov"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Pokaži zgodovino ukazne vrstice"
#: tfrmmain.actshowmainmenu.caption
msgid "Menu"
msgstr "Meni"
#: tfrmmain.actshowsysfiles.caption
msgid "Show &Hidden/System Files"
msgstr "Pokaži &skrite in sistemske datoteke"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Razvrsti po &atributih"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Razvrsti po &datumu"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Razvrsti po &priponi"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Razvrsti po &imenu"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Razvrsti po &velikost"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Odpri seznam pogona"
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Omogoči/Onemogoči seznam prezrtih datotek pri prikazovanju"
#: tfrmmain.actsymlink.caption
msgid "Create Symbolic &Link..."
msgstr "Ustvari &simbolno povezavo ..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr "Uskladi mape ..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Izenači z &dejavnim zavihkom"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Preizkusi &celovitost arhivov"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Pogled sličic"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Pogled sličic"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr "Preklopi celozaslonski način konzole"
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Odpri označeno mapo desnega okna v levem oknu"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Odpri označeno mapo levega okna v desnem oknu"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "&Drevesni pogled"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr "Razvrsti glede na parametre"
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Odstrani izbor vse&h datotek z enako pripono"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr "Odstrani izbor vseh datotek z enakim imenom"
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr "Odstrani izbor vseh datotek z enakim imenom in pripono"
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr "Odstrani izbor vseh datotek na isti poti"
#: tfrmmain.actview.caption
msgctxt "TFRMMAIN.ACTVIEW.CAPTION"
msgid "View"
msgstr "Pogled"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Pokaži zgodovino obiskanih poti dejavnega pogleda"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Pojdi na naslednji vnos zgodovine"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Pojdi na predhodni vnos zgodovine"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Preglej vsebino datoteke dnevnika"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr "Pogled trenutno dejavnih iskanj"
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Spletna stran programa"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Neobnovljivo izbriši"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr "Delo z vročimi mapami in parametri ukazov"
#: tfrmmain.btnf10.caption
msgctxt "TFRMMAIN.BTNF10.CAPTION"
msgid "Exit"
msgstr "Končaj"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Mapa"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Odpri Terminal"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Seznam hitrih map"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Pokaži trenutno mapo desnega okna v levem oknu"
#: tfrmmain.btnlefthome.caption
msgctxt "tfrmmain.btnlefthome.caption"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Pojdi v osebno mapo"
#: tfrmmain.btnleftroot.caption
msgctxt "tfrmmain.btnleftroot.caption"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Pojdi v korensko mapo"
#: tfrmmain.btnleftup.caption
msgctxt "tfrmmain.btnleftup.caption"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Pojdi v mapo višje"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Seznam hitrih map"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Pokaži trenutno mapo levega okna v desnem oknu"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "tfrmmain.lblcommandpath.caption"
msgid "Path"
msgstr "Pot"
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Prekliči"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Kopiraj ..."
#: tfrmmain.mihardlink.caption
msgid "Create link..."
msgstr "Ustvari povezavo ..."
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline10.caption
msgctxt "TFRMMAIN.MILINE10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline11.caption
msgctxt "TFRMMAIN.MILINE11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline21.caption
msgctxt "TFRMMAIN.MILINE21.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline23.caption
msgctxt "TFRMMAIN.MILINE23.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline26.caption
msgctxt "TFRMMAIN.MILINE26.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline33.caption
msgctxt "TFRMMAIN.MILINE33.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline37.caption
msgctxt "TFRMMAIN.MILINE37.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline38.caption
msgctxt "TFRMMAIN.MILINE38.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline39.caption
msgctxt "TFRMMAIN.MILINE39.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline40.caption
msgctxt "TFRMMAIN.MILINE40.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline50.caption
msgctxt "TFRMMAIN.MILINE50.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline55.caption
msgctxt "TFRMMAIN.MILINE55.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Počisti"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Skrij"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Izberi vse"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Premakni ..."
#: tfrmmain.misymlink.caption
msgid "Create symlink..."
msgstr "Ustvari simbolno povezavo ..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Možnosti zavihkov"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Končaj"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Obnovi"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Začni"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Prekliči"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Ukazi"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "&Nastavitve"
#: tfrmmain.mnucontextline1.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mnucontextline2.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Priljubljeno"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Datoteke"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "Pomo&č"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Izbor"
#: tfrmmain.mnunetwork.caption
msgctxt "tfrmmain.mnunetwork.caption"
msgid "Network"
msgstr "Omrežje"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Pokaži"
#: tfrmmain.mnutaboptions.caption
msgid "Tab &Options"
msgstr "Možnosti &zavihka"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Zavihki"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Izreži"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Uredi"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Prilepi"
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&V redu"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr "Izbor notranjega ukaza"
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Nerazvrščeno"
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
msgid "Legacy sorted"
msgstr "Nerazvrščeno"
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Privzeto izberi vse kategorije"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Izbor:"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "&Kategorije:"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "&Ime ukaza:"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Filter:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Namig:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Hitra tipka:"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr "cm_ime"
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "Kategorija"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Pomoč"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Namig"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Hitra tipka"
#: tfrmmaskinputdlg.btnaddattribute.caption
msgctxt "TFRMMASKINPUTDLG.BTNADDATTRIBUTE.CAPTION"
msgid "&Add"
msgstr "Dod&aj"
#: tfrmmaskinputdlg.btnattrshelp.caption
msgctxt "TFRMMASKINPUTDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "Pomo&č"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Določi ..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&V redu"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Razlikovanje velikosti črk"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr "Prezri naglase in vezave znakov"
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr "&Atributi"
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Maska izbire:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "&Shranjene maske izbire:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&V redu"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Ustvarjanje nove mape"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "Ime &nove mape:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr "Nova velikost"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Višina :"
#: tfrmmodview.lblpath1.caption
msgctxt "tfrmmodview.lblpath1.caption"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Kakovost stiskanja zapisa JPG"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Širina :"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Višina"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "tfrmmodview.tewidth.text"
msgid "Width"
msgstr "Širina"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr "456456465465465"
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zapri"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmmultirename.btnedit.caption
msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&&Uredi"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "&Naloži"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Preimenuj"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Ponastavi &vse"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Shrani"
#: tfrmmultirename.caption
msgid "MultiRename"
msgstr "Napredno preimenovanje"
#: tfrmmultirename.cblog.caption
msgid "Ena&ble"
msgstr "&Omogoči"
#: tfrmmultirename.cbregexp.caption
msgid "Regular e&xpressions"
msgstr "Logični &izrazi"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "Uporabi &zamenjave"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Pripona"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Števec"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Najdi &in zamenjaj"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Rezultat beleženja"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Maska"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Shranjena preimenovanja"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "&Pripona"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "&Najdi ..."
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "&Razmik"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "Ime &datoteke"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "&Zamenjaj ..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "&Začetna vrednost"
#: tfrmmultirename.lbwidth.caption
msgid "&Width"
msgstr "&Širina"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Števec"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Dan"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Dan (2 številki)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Dan v tednu (kratko, npr.: »pon«)"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Dan v tednu (dolgo, npr.: »ponedeljek«)"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Znak pripone na mestu (x)"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex] Znaki pripone med mestoma (x) in (y)"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Ure"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Ure (2 številki)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minute"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minute (2 številki)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Mesec"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Mesec (2 številki)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Ime meseca (kratko, npr.: »jan«)"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Ime meseca (dolgo, npr.: »januar«)"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Ime"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Znak imena na mestu (x)"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Znaki imena med mestoma (x) in (y)"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Čas ..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Pripona ..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Ime ..."
#: tfrmmultirename.miplugin.caption
msgctxt "tfrmmultirename.miplugin.caption"
msgid "Plugin"
msgstr "Vstavek"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Sekunde"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Sekunde (2 številki)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Leto (2 številki)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Leto (4 številke)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Urejanje imen ..."
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Naloži imena iz datoteke ..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgid "Old File Name"
msgstr "Staro ime datoteke"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgid "New File Name"
msgstr "Novo ime datoteke"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgid "File Path"
msgstr "Pot datoteke"
#: tfrmmultirenamewait.caption
msgctxt "TFRMMULTIRENAMEWAIT.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr "Po zapiranju urejevalnika je treba potrditi nalaganje spremenenjih imen!"
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Izbor programa"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Ukaz po meri"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Shrani programsko vez"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Nastavi izbrani program za privzeto dejanje"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Vrsta datoteke za odpiranje: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Imena več datotek"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Več naslovov URI"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Ime ene datoteke"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "En naslov URI"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgid "&Apply"
msgstr "&Uveljavi"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&V redu"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Možnosti"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Nastavitve sklopa so urejene na straneh podrejenih kategorij."
#: tfrmoptionsarchivers.btnautoconfig.caption
msgid "A&uto Configure"
msgstr "&Samodejno nastavi"
#: tfrmoptionsarchivers.btnmultiarcadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionsarchivers.btnmultiarcapply.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption"
msgid "A&pply"
msgstr "&Uveljavi"
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption"
msgid "D&elete"
msgstr "&Izbriši"
#: tfrmoptionsarchivers.btnmultiarcrename.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
msgid "&Rename"
msgstr "&Preimenuj"
#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
msgid "De&bug mode"
msgstr "Način &razhroščevanja"
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
msgid "E&nabled"
msgstr "O&mogočeno"
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
msgid "S&how console output"
msgstr "Pokaži &odvod konzole"
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
msgid "Options"
msgstr "Možnosti"
#: tfrmoptionsarchivers.lblarchiveadd.caption
msgid "Add&ing:"
msgstr "Doda&janje:"
#: tfrmoptionsarchivers.lblarchiveextension.caption
msgid "E&xtension:"
msgstr "&Razširitev:"
#: tfrmoptionsarchivers.lblarchiveextract.caption
msgid "Ex&tract:"
msgstr "Raz&širi:"
#: tfrmoptionsarchivers.lblarchivelist.caption
msgid "&List:"
msgstr "&Seznam:"
#: tfrmoptionsarchivers.lblarchivelistend.caption
msgid "Listing &finish (optional):"
msgstr "&Konec seznama (izbirno):"
#: tfrmoptionsarchivers.lblarchivelistformat.caption
msgid "Listing for&mat:"
msgstr "&Oblika seznama:"
#: tfrmoptionsarchivers.lblarchiveliststart.caption
msgid "Listin&g start (optional):"
msgstr "&Začetek seznama (izbirno):"
#: tfrmoptionsarchivers.lblarchiver.caption
msgid "Arc&hiver:"
msgstr "Ar&hivirnik:"
#: tfrmoptionsarchivers.lbldescription.caption
msgid "De&scription:"
msgstr "&Opis:"
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgid "Additional"
msgstr "Dodatno"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr "Splošno"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgid "When &size, date or attributes change"
msgstr "če se spremenijo &velikost, datum ali atributi"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "za navedene &poti in podrejene mape:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgid "When &files are created, deleted or renamed"
msgstr "ko je datoteka &ustvarjena, izbrisana ali preimenovana"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgid "When application is in the &background"
msgstr "če je program zagnan v &ozadju"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgid "Disable auto-refresh"
msgstr "Onemogoči samodejno osveževanje:"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgid "Refresh file list"
msgstr "Osveži seznam datotek:"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgid "Al&ways show tray icon"
msgstr "Vedno &pokaži ikono v sistemski vrstici"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Samodejno &skrij odklopljene naprave"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgid "Mo&ve icon to system tray when minimized"
msgstr "Pri skrčenju okna programa pokaži ikono v sistemski vrstici"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgid "A&llow only one copy of DC at a time"
msgstr "Dovoli le &en zagnan primerek programa"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Več pogonov ali priklopnih točk je mogoča vpisati ločeno s podpičjem » ; «."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Črni seznam &pogonov"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Velikost stolpcev"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Izpis pripon datotek"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "&Poravnano (v stolpcu)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "&Neposredno za imenom datoteke"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Samodejno"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Določeno število stolpcev"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Določena širina stolpcev"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "&Okrajšaj besedilo na širino stolpca"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr "&Razširi celico, če je besedila preveč za stolpec"
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "&Vodoravne črte"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "&Navpične črte"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "Samodejno &zapolni stolpce"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Izris mreže okna"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Samodejno prilagajanje velikosti stolpcev"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Samodejno prilagodi &velikost:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "&Uveljavi"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "zgodovino &ukazne vrstice"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgid "&Directory history"
msgstr "zgodovino &map"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "zgodovino mask &imen datotek"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "&nastavitve"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "zgodovino iskanj in zamenjav"
#: tfrmoptionsconfiguration.gbdirectories.caption
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Mape"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Privzeto mesto nastavitvenih datotek je:"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Pred končanjem programa shrani:"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Razvrščanje razdelkov nastavitev v drevesnem pogledu na levi:"
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Nastavi v ukazni vrstici"
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr "Tema ikone:"
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr "Predpomnilnik sličic:"
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "mapa &programa (prenosna različica)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "osebna mapa &uporabnika"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
msgid "All"
msgstr "Vse"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
msgid "Apply modification to all columns"
msgstr "Uveljavi spremembo za vse stolpce"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Nastavi kot privzeto"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
msgid "Reset to default"
msgstr "Povrni na privzete vrednosti"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
msgid "New"
msgstr "Novo"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "Naslednja"
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "Predhodna"
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
msgid "Rename"
msgstr "Preimenuj"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
msgid "Reset to default"
msgstr "Počisti na privzeto vrednost"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
msgid "Save as"
msgstr "Shrani kot"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
msgid "Save"
msgstr "Shrani"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Dovoli nadbarvo"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "S klikanjem za spreminjanje česarkoli, se to odrazi na vseh stolpcih"
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
msgid "General"
msgstr "Splošno"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Okvir kazalke"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Kazalka ima obrobo"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Barva izbire nedejavnega okno:"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Uporabi &obrnjen izbor"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Uporabi barvo in pisavo po meri za ta pogled"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgid "BackGround:"
msgstr "Ozadje:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgid "Background 2:"
msgstr "Ozadje 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Nastavi &stolpce za datotečni sistem:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Trenutno ime stolpca]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgid "Cursor Color:"
msgstr "Barva kazalke:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgid "Cursor Text:"
msgstr "Besedilo kazalke:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgid "Font:"
msgstr "Pisava:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
msgid "Size:"
msgstr "Velikost:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgid "Text Color:"
msgstr "Barva besedila:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Barva nedejavne kazalke"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Barva nedejavnega označevalnika"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgid "Mark Color:"
msgstr "Barva oznake:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Spodaj je okno predogleda. S premikanjem kazalnika in izborom datoteke se pokažejo različne prilagoditve nastavitev."
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Nastavitve stolpca:"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgid "Add column"
msgstr "Dodaj stolpec"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Položaj pladnja po primerjavi"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr "Dodaj mapo iz &dejavnega okna"
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr "Dodaj &mapi iz dejavnega in nedejavnega okna"
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr "Dodaj ročno &izbrano mapo"
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr "Dodaj kopijo izbranega vnosa"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr "Dodaj trenutno &izbrane ali dejavne mape dejavnega okna"
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Dodaj ločilnik"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr "Dodaj podrejeni meni"
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr "Dodaj mapo z vpisom imena"
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Zloži vse veje"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr "Zloži predmet"
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr "Izreži izbor vnosov"
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr "Izbriši vse!"
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Izbriši izbran predmet"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr "Izbriši podrejeni meni in vse njegove predmete"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr "Izbriši podrejeni meni, vendar ohrani njegove predmete"
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr "Razširi predmet"
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr "Žarišči okno drevesnega prikaza"
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr "Skoči na prvi predmet"
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr "Skoči na zadnji predmet"
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr "Skoči na naslednji predmet"
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr "Skoči na predhodni predmet"
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr "Vstavi mapo &dejavnega okna"
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr "Vstavi &mapi dejavnega in nedejavnega okna"
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr "Vstavi mapo po izbiri"
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr "Vstavi kopijo izbranega vnosa"
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr "Vstavi trenutno &izbrane ali dejavne mape dejavnega okna"
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr "Vstavi ločilnik"
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr "Vstavi podrejeni meni"
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr "Vstavi mapo z vpisom imena"
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr "Premakni na naslednje"
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr "Premakni na predhodno"
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Odpri vse veje"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr "Prilapi izrezano"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr "Poišči in zamenjaj na & poti"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr "Poišči in zamenjaj na poti in na ciljni poti"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr "Poišči in zamenjaj na &ciljni poti"
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr "Prilagodi pot"
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr "Prilagodi ciljno pot"
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "&Dodaj ..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "&Varnostna kopija"
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "&Izbriši ..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "&Izvozi ..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION"
msgid "&Help"
msgstr "&Pomoč"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "&Uvozi ..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "&Vstavi ..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "&Drugo ..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgid "Some functions to select appropriate target"
msgstr "Nekatere funkcije za izbor ustreznega cilja"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "&Razvrsti ..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "&Med dodajanjem mape dodaj tudi cilj"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "&Vedno pokaži razširjeno"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Pokaži le &veljavne spremenljivke okolja"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr "V &pojavnem oknu (pokaže tudi pot)"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Ime, a-z"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr "Ime, az"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Seznam hitrih map (razvrščanje z vlečenjem)"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Druge možnosti"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr "Ime:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr "Pot:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgid "&Target:"
msgstr "&Cilj:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "... le trenutno &raven izbranih predmetov"
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Preveri vse poti &hitrih map in potrdi tiste, ki zares obstajajo"
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "&Preveri vse poti &in cilje hitrih map ter potrdi tiste, ki zares obstajajo"
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "v datoteko seznama &hitrih map (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "v datoteko »wincmd.ini« programa TotalCommander (&ohrani obstoječe)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "v datoteko »wincmd.ini« programa TotalCommander (&izbriši obstoječe)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Skoči na &podrobnosti o nastavitvah programa TC"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
msgid "Go to &configure TC related info"
msgstr "Skok na &podrobnosti o nastavitvah programa TC"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "Preizkusni meni hitrih map"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "iz datoteke seznama &hitrih map (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "iz datoteke »&wincmd.ini« programa TotalCommander."
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr "&Prebrskaj ..."
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "&Obnovi varnostno kopijo seznama hitrih map"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "&Shrani varnostno kopijo seznama hitrih map"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Poišči in &zamenjaj ..."
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "... vse od A do &Ž!"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "... le &eno skupino predmetov"
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "... &le vsebino izbranega podrejenega menija brez podravni"
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "... vsebino izbranega podrejenega menija in &vse podravni"
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr "Preizkus &menija"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr "Prilagodi &pot"
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr "Prilagodi &ciljno pot"
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr "Dodajanje iz glavnega okna"
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Vedno vprašaj, kateri zapis naj bo uporabljen"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Med shranjevanjem besedila v naboru Unikod, shrani kot UTF8 (sicer bo uporabljen UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Med vlečenjem besedila samodejno ustvari ime datoteke (sicer se bo pojavilo vnosno polje)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Pokaži &potrditveno okno po spuščanju datotek"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Med vlečenjem besedila v okna:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Najustreznejši zapis postavi na vrh seznama (razvrščanje z vlečenjem):"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(Če najustreznejši ni na voljo, bo uporabljen zapis na drugem mestu)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(lahko ne deluje z nekaterimi izvornimi programi)"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Pokaži &datotečni sistem"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Pokaži &zasedenost prostora"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Pokaži &oznako"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Seznam pogonov"
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Kazalka je za znakom konca vrstice"
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Pokaži posebne znake"
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Možnosti notranjega urejevalnika"
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "O&zadje"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "O&zadje"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Ponastavi"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr "Shrani"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Atributi predmeta"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Pi&sava"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "Pi&sava"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "&Označba besedila"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Uporabi (in uredi) nastavitve &splošne sheme"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Uporabi nastavitve &krajevne sheme"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Krepko"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "O&brni"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&nemogočeno"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "&Omogočeno"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Ležeče"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "O&brni"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&nemogočeno"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "&Omogočeno"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "&Prečrtano"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "O&brni"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&nemogočeno"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "&Omogočeno"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "&Podčrtano"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "O&brni"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "O&nemogočeno"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "&Omogočeno"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION"
msgid "Add..."
msgstr "Dodaj ..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION"
msgid "Delete..."
msgstr "Izbriši ..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Uvoz / Izvoz"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION"
msgid "Insert..."
msgstr "Vstavi ..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION"
msgid "Rename"
msgstr "Preimenuj"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION"
msgid "Sort..."
msgstr "Razvrsti ..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "brez"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION"
msgid "Always expand tree"
msgstr "Vedno pokaži razširjeno"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Ne"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Leva"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Desna"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Seznam priljubljenih zavihkov (razvrstitev je mogoča z miško)"
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION"
msgid "Other options"
msgstr "Druge možnosti"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr "Kaj obnoviti in kje za izbran vnos:"
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Ohrani zavihke:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Shrani zgodovino mape:"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr "Zavihki, shranjeni na levi, bodo obnovljeni na:"
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr "Zavihki, shranjeni na desni, bodo obnovljeni na:"
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION"
msgid "a separator"
msgstr "ločilnik vnosov"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Dodaj ločilnik"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION"
msgid "sub-menu"
msgstr "podrejeni meni"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION"
msgid "Add sub-menu"
msgstr "Dodaj podrejeni meni"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION"
msgid "Collapse all"
msgstr "Zloži vse veje"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION"
msgid "...current level of item(s) selected only"
msgstr "... le trenutno raven izbranih predmetov"
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION"
msgid "Cut"
msgstr "Izreži"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION"
msgid "delete all!"
msgstr "vse predmete!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION"
msgid "sub-menu and all its elements"
msgstr "podrejeni meni in vse njegove predmete"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION"
msgid "just sub-menu but keep elements"
msgstr "le podrejeni meni, vendar ohrani predmete"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION"
msgid "selected item"
msgstr "izbrane predmete"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION"
msgid "Delete selected item"
msgstr "Izbriši izbrane predmete"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr "Izvozi izbor v datoteko *.tab"
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr "Preizkusni meni priljubljenih zavihkov"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr "Uvozi shranjeno datoteko *.tab glede na privzete nastavitve"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Uvozi shranjeno datoteko *.tab na izbrano mesto"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Uvozi shranjeno datoteko *.tab na izbrano mesto"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr "Uvozi shranjeno datoteko *.tab na izbrano mesto v podrejenem meniju"
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Vstavi ločilnik"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Vstavi podrejeni meni"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION"
msgid "Open all branches"
msgstr "Odpri vse veje"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION"
msgid "Paste"
msgstr "Prilepi"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION"
msgid "Rename"
msgstr "Preimenuj"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTEVERYTHING.CAPTION"
msgid "...everything, from A to Z!"
msgstr "... vse od A do Ž!"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP.CAPTION"
msgid "...single group of item(s) only"
msgstr "... le eno skupino predmetov"
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP2.CAPTION"
msgid "Sort single group of item(s) only"
msgstr "Razvrsti le eno skupino predmetov"
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLESUBMENU.CAPTION"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "... le vsebino izbranega podrejenega menija brez podravni"
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSUBMENUANDSUBLEVEL.CAPTION"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "... vsebino izbranega podrejenega menija in vse podravni"
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MITESTRESULTINGFAVORITETABSMENU.CAPTION"
msgid "Test resulting menu"
msgstr "Preizkus menija"
#: tfrmoptionsfileassoc.btnaddact.caption
msgid "Add"
msgstr "Dodaj"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
msgid "&Add"
msgstr "&Dodaj"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr "Kloniraj"
#: tfrmoptionsfileassoc.btndownact.caption
msgid "&Down"
msgstr "&Dol"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION"
msgid "Edit"
msgstr "Uredi"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Vstavi"
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION"
msgid "Insert"
msgstr "Vstavi"
#: tfrmoptionsfileassoc.btnremoveact.caption
msgid "Remo&ve"
msgstr "O&dstrani"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgid "Re&move"
msgstr "&Odstrani"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
msgid "&Remove"
msgstr "&Odstrani"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "&Preimenuj"
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
msgid "&Up"
msgstr "&Gor"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr "Začetna pot ukaza. Ta niz ne sme biti zapisan v navednicah."
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr "Ime opravila. Niz ni sistemska vrednost, zato je lahko poljuben."
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr "Parametri za ukaz. Daljše ime datoteke, ki vključuje presledke, mora biti zapisan v navednicah."
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr "Ukaz za izvršitev. Daljše ime datoteke, ki vključuje presledke, mora biti zapisan v navednicah."
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr "Opis dejanja:"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Dejanja"
#: tfrmoptionsfileassoc.gbexts.caption
msgid "Extensions"
msgstr "Razširitve"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Dovoljeno je razvrščanje z &vlečenjem"
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Vrste datotek"
#: tfrmoptionsfileassoc.gbicon.caption
msgid "Icon"
msgstr "Ikona"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Opravila je mogoče razvrstiti z vlečenjem"
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Razširitve je mogoče razvrstiti z vlečenjem"
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Vrste datotek je mogoče razvrščati z vlečenjem"
#: tfrmoptionsfileassoc.lblaction.caption
msgid "Action name:"
msgstr "Ime dejanja:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgid "&Command:"
msgstr "&Ukaz:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parametr&i:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Začetna &pot:"
#: tfrmoptionsfileassoc.menuitem1.caption
msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Po meri ..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Po meri"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
msgid "Edit"
msgstr "Uredi"
#: tfrmoptionsfileassoc.mieditor.caption
msgid "Open in Editor"
msgstr "Odpri v urejevalniku"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Uredi s programom ..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgid "Get output from command"
msgstr "Pridobi odvod ukaza"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Odpri v notranjem urejevalniku"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Odpri v notranjem pregledovalniku"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
msgid "Open"
msgstr "Odpri"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Odpri s programom …"
#: tfrmoptionsfileassoc.miseparator.caption
msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgid "Run in terminal"
msgstr "Zaženi v terminalu"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
msgid "View"
msgstr "Pogled"
#: tfrmoptionsfileassoc.miviewer.caption
msgid "Open in Viewer"
msgstr "Odpri v pregledovalniku"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Poglej s programom ..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Klik za zamenjavo ikone."
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "Izvedi prek lupine"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Razširjen vsebinski meni"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXTENDEDCONTEXTMENU.HINT"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Ob dostopu do programskih vezi z datotekami naj se pokaže tudi pogovorno okno za dodajanje izbrane vrste datoteke med zbrane nastavitve vezi"
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Nastavitve datotečnih vezi"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr "Prikaži možnost dodajanja izbrane datoteke med programske vezi"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Ob dostopu do programskih vezi z datotekami naj se pokaže tudi pogovorno okno za dodajanje izbrane vrste datoteke med zbrane nastavitve vezi"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "Izvedi v terminalu in končaj"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "Izvedi v terminalu in pusti terminal odprt"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Možnosti v vsebinskem meniju"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgid "Show confirmation window for:"
msgstr "Potrditveno okno se pokaže za:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "opravila &kopiranja"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "opravila &brisanja"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Izbriši v &smeti (s sočasnim pritiskom dvigalke se izbriše trajno)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "opravila brisanja v smeti"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgid "D&rop readonly flag"
msgstr "Odstrani &zastavico le za branje"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "opravila &premikanja"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "&Obravnavaj opombe skupaj z datotekami in mapami"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Med preimenovanjem izberi le &ime datoteke brez pripone"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Pokaži polje izbire &zavihka v pogovornem oknu kopiranja in premikanja"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "&Preskoči napake datotečnih opravil in jih zapiši v dnevnik"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Izvajanje opravil"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Uporabniški vmesnik"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "Velikost &medpomnilnika opravila (v KB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr "Velikost &medpomnilnika za izračun nadzorne vsote (v KB):"
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Pokaži splošni napredek &dejavnosti v"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgid "Duplicated name auto-rename style:"
msgstr "Slog samodejnega preimenovanja podvojenih datotek:"
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "Število prehodov &neobnovljivega brisanja:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Ponastavi na privzete vrednosti"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION"
msgid "Allow Overcolor"
msgstr "Dovoli nadbarvo"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Uporabi kazalko &okvirja"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Uporabi kazalnik &preliva"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Uporabi barvo in pisavo za nedejavno okno"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "Uporabi &obrnjen izbor"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION"
msgid "Cursor border"
msgstr "Okvir kazalke"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr "Kazalnik zasedenosti prostora na pogonu"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "O&zadje:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgid "Backg&round 2:"
msgstr "&Drugo o&zadje:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgid "C&ursor Color:"
msgstr "Barva &kazalke:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgid "Cursor Te&xt:"
msgstr "Besedilo ka&zalke:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION"
msgid "Inactive Cursor Color:"
msgstr "Barva nedejavne kazalke:"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION"
msgid "Inactive Mark Color:"
msgstr "Označeno besedilo:"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "Raven &svetlosti nedejavnega okna"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Barva &ozadja"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Barva &pisave kazalnika:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgid "&Mark Color:"
msgstr "Barva &oznake:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "Spodaj je okno predogleda. S premikanjem kazalnika in izborom datoteke se pokažejo različne prilagoditve nastavitev."
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgid "T&ext Color:"
msgstr "Barva &besedila:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr "Med zagonom iskalnika datotek, počisti predhodno masko iskanja"
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "&Poišči del imena datoteke"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr "Pokaži menijsko vrstico v oknu »iskanja datotek«"
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr "Iskanje besedila v datotekah"
#: tfrmoptionsfilesearch.gbfilesearch.caption
msgctxt "TFRMOPTIONSFILESEARCH.GBFILESEARCH.CAPTION"
msgid "File search"
msgstr "Iskanje datotek"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr "Trenutni filtri gumba »Novo iskanje«:"
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr "Privzeta predloga iskanja:"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Uporabi preslikavo pomnilnika za iskanje &besedila v datotekah"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "&Uporabi pretok za iskanje besedila v datotekah"
#: tfrmoptionsfilesviews.btnaddattribute.caption
msgctxt "TFRMOPTIONSFILESVIEWS.BTNADDATTRIBUTE.CAPTION"
msgid "&Add"
msgstr "Dod&aj"
#: tfrmoptionsfilesviews.btnattrshelp.caption
msgctxt "TFRMOPTIONSFILESVIEWS.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "Pomo&č"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr "Omogoči prehod v &nadrejeno mapo, kadar je izveden dvojni klik na prazni del okna datotek"
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "&Ne naloži datoteke, dokler zavihek ni omogočen"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "&Izpiši oglate oklepaje okoli imena mape v seznamu okna"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "&Poudari nove in posodobljene datoteke"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Omogoči takojšnje &preimenovanje z dvoklikom na ime datoteke"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgid "Load &file list in separate thread"
msgstr "Naloži &seznam datotek v ločeni niti"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgid "Load icons af&ter file list"
msgstr "Naloži ikone &za seznamom datotek"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgid "Show s&ystem and hidden files"
msgstr "Pokaže skrite in &sistemske datoteke"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "&Med izbiranjem datotek s preslednico, se premakni na naslednjo datoteko v seznamu (kot z vstavljalko)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr "Filter v slogu sistema Windows za označevanje datotek (»*.*« izbere tudi datoteke brez pripone ...)"
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr "Vsakič uporabi neodvisen filter atributa v maski"
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Oblikovanje"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr "Označevanje/Preklic oznake vnosov"
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Razvrščanje"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgid "Default attribute mask value to use:"
msgstr "Privzeta maska za uporabo:"
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Razlikovanje velikosti &črk:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Napačen zapis"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "&Zapis datuma in časa:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Zapis velikosti datoteke:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "&Vstavi nove datoteke:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Razvrščanje map:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "&Način razvrščanja:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "&Premakni posodobljene datoteke:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "&Uveljavi"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "&Izbriši"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
msgid "Template..."
msgstr "Predloga ..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Obarvanje različnih skupin datotek (razvrščanje z vlečenjem)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "&Atributi kategorije:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "&Barva kategorije:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
msgid "Category &mask:"
msgstr "&Maska kategorije:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr "&Ime kategorije:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNPATHEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSEARCHRESULTSFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "&Pisava konzole"
#: tfrmoptionsfonts.lbleditorfont.caption
msgid "&Editor font"
msgstr "Pisava &urejevalnika"
#: tfrmoptionsfonts.lbllogfont.caption
msgid "&Log font"
msgstr "Pisava &dnevnika"
#: tfrmoptionsfonts.lblmainfont.caption
msgid "Main &font"
msgstr "&Glavna pisava"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Pisava poti"
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Pisava rezultatov iskanja"
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgid "Viewer&Book Font"
msgstr "Pisava &bralnega pregledovalnika"
#: tfrmoptionsfonts.lblviewerfont.caption
msgid "&Viewer font"
msgstr "Pisava &pregledovalnika"
#: tfrmoptionshotkeys.actaddhotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTADDHOTKEY.CAPTION"
msgid "Add &hotkey"
msgstr "&Dodaj hitro tipko"
#: tfrmoptionshotkeys.actcopy.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmoptionshotkeys.actdelete.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmoptionshotkeys.actdeletehotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETEHOTKEY.CAPTION"
msgid "&Delete hotkey"
msgstr "&Izbriši hitro tipko"
#: tfrmoptionshotkeys.actedithotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTEDITHOTKEY.CAPTION"
msgid "&Edit hotkey"
msgstr "Uredi &hitro tipko"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr "Naslednja kategorija"
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr "Pojavno okno naj bo z vrsto datoteke povezan meni"
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr "Predhodna kategorija"
#: tfrmoptionshotkeys.actrename.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTRENAME.CAPTION"
msgid "Rename"
msgstr "Preimenuj"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr "Ponastavi na privzete vrednosti"
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr "Shrani zdaj"
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr "Razvrsti po imenu ukaza"
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr "Razvrsti po hitrih tipkah (skupinjeno)"
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr "Razvrsti po hitrih tipkah (ena na vrstico)"
#: tfrmoptionshotkeys.lbfilter.caption
msgid "&Filter"
msgstr "&Filter"
#: tfrmoptionshotkeys.lblcategories.caption
msgid "C&ategories:"
msgstr "&Kategorije:"
#: tfrmoptionshotkeys.lblcommands.caption
msgid "Co&mmands:"
msgstr "&Ukazi:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgid "&Shortcut files:"
msgstr "Datoteke &tipkovnih bližnjic:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr "Način &razvrščanja:"
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr "Kategorije"
#: tfrmoptionshotkeys.micommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.MICOMMANDS.CAPTION"
msgid "Command"
msgstr "Ukaz"
#: tfrmoptionshotkeys.miseparator1.caption
msgctxt "TFRMOPTIONSHOTKEYS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr "Način razvrščanja"
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Za navedene &poti in podrejene mape:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Pokaži ikone za dejanja v &meniju"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr "Na gumbih naj se izrisujejo ikone."
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgid "Show o&verlay icons, e.g. for links"
msgstr "Pokaži prekrivne i&kone za npr. povezave"
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Onemogoči posebne ikone"
#: tfrmoptionsicons.gbiconssize.caption
msgid " Icon size "
msgstr "Velikost ikon"
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr "Tema ikon"
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr "Pokaži ikone"
#: tfrmoptionsicons.gbshowiconsmode.caption
msgid " Show icons to the left of the filename "
msgstr "Pokaži ikone na levi strani imena datoteke"
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr "Okno nosilca:"
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr "Okno datoteke:"
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
msgid "A&ll"
msgstr "&Vse"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgid "All associated + &EXE/LNK (slow)"
msgstr "Vse programske vezi in &EXE/LNK (počasneje)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgid "&No icons"
msgstr "Brez &ikon"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgid "Only &standard icons"
msgstr "Le &običajne ikone"
#: tfrmoptionsignorelist.btnaddsel.caption
msgid "A&dd selected names"
msgstr "&Dodaj izbrana imena"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgid "Add selected names with &full path"
msgstr "Doda izbrana imena s polno &potjo"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Prezri in ne pokaži naslednjih datotek in map:"
#: tfrmoptionsignorelist.lblsavein.caption
msgid "&Save in:"
msgstr "&Shrani v:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "&Tipki levo in desno zamenjata mapo (način Lynx)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Dejanja pritiskov tipk na tipkovnici"
#: tfrmoptionskeyboard.lblalt.caption
msgid "Alt+L&etters:"
msgstr "Alt+Č&rke:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+Čr&ke:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "&Črke:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr "&Ploski gumbi"
#: tfrmoptionslayout.cbflatinterface.caption
msgid "Flat i&nterface"
msgstr "&Ploski vmesnik"
#: tfrmoptionslayout.cbflattoolbar.caption
msgid "Flat b&uttons"
msgstr "Ploski &gumbi"
#: tfrmoptionslayout.cbfreespaceind.caption
msgid "Show fr&ee space indicator on drive label"
msgstr "Pokaži vrstico &zasedenosti prostora"
#: tfrmoptionslayout.cblogwindow.caption
msgid "Show lo&g window"
msgstr "Pokaži okno &dnevniškega izpisa"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgid "Show panel of operation in background"
msgstr "Pokaži okno opravil, zagnanih v ozadju"
#: tfrmoptionslayout.cbproginmenubar.caption
msgid "Show common progress in menu bar"
msgstr "Pokaži splošni napredek dejavnosti v menijski vrstici"
#: tfrmoptionslayout.cbshowcmdline.caption
msgid "Show command l&ine"
msgstr "Pokaži &ukazno vrstico"
#: tfrmoptionslayout.cbshowcurdir.caption
msgid "Show current director&y"
msgstr "Pokaži &trenutno mapo"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgid "Show &drive buttons"
msgstr "Pokaže gumbe &pogonov"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgid "Show free s&pace label"
msgstr "Pokaži vrednost &zasedenosti prostora"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Pokaži gumb seznama &pogonov"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgid "Show function &key buttons"
msgstr "Pokaži &funkcijske gumbe"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgid "Show &main menu"
msgstr "Pokaži &glavni meni"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgid "Show tool&bar"
msgstr "Pokaži &orodno vrstico"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Pokaži kratko oznako &zasedenosti prostora"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgid "Show &status bar"
msgstr "Pokaži vrstico &stanja"
#: tfrmoptionslayout.cbshowtabheader.caption
msgid "S&how tabstop header"
msgstr "Pokaži glave &stolpcev"
#: tfrmoptionslayout.cbshowtabs.caption
msgid "Sho&w folder tabs"
msgstr "Pokaži z&avihke map"
#: tfrmoptionslayout.cbtermwindow.caption
msgid "Show te&rminal window"
msgstr "Pokaži okno &terminala"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Pokaži dve orodni vrstici gumbov pogonov (&določene širine nad okni)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgid " Screen layout "
msgstr "Zaslonska razporeditev"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Preglej vsebino datoteke dnevnika"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Vključi datum v ime dnevniške datoteke"
#: tfrmoptionslog.cblogarcop.caption
msgid "&Pack/Unpack"
msgstr "&Zapakiranje/Odpakiranje"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Zunanje izvajanje ukazne vrstice"
#: tfrmoptionslog.cblogcpmvln.caption
msgid "Cop&y/Move/Create link/symlink"
msgstr "Ko&piranje/Premikanje/Ustvarjanje navadnih in simbolnih povezav"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "&Brisanje"
#: tfrmoptionslog.cblogdirop.caption
msgid "Crea&te/Delete directories"
msgstr "Us&tvarnje/Brisanje map"
#: tfrmoptionslog.cblogerrors.caption
msgid "Log &errors"
msgstr "Beleži &napake opravil"
#: tfrmoptionslog.cblogfile.caption
msgid "C&reate a log file:"
msgstr "Ustvari &dnevniško datoteko:"
#: tfrmoptionslog.cbloginfo.caption
msgid "Log &information messages"
msgstr "&Beleži sporočila podrobnosti"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Zagon/Izklop programa"
#: tfrmoptionslog.cblogsuccess.caption
msgid "Log &successful operations"
msgstr "Beleži &uspešno končana opravila"
#: tfrmoptionslog.cblogvfs.caption
msgid "&File system plugins"
msgstr "&Uporabo sistemsko-datotečnih vstavkov"
#: tfrmoptionslog.gblogfile.caption
msgid "File operation log file"
msgstr "Dnevniška datoteka datotečnih opravil"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Beleži opravila"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Stanje opravila"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Odstrani sličice neobstoječih datotek"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
msgid "View log file content"
msgstr "Preglej vsebino datoteke dnevnika"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION"
msgid "Create new with the encoding:"
msgstr "Ustvari novo besedilno datoteko z naborom:"
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Med zamenjavo pogona vedno odpri &korensko mapo"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Pokaži &opozorila (okna, ki imajo le gumb »V redu«)"
#: tfrmoptionsmisc.chkthumbsave.caption
msgid "&Save thumbnails in cache"
msgstr "&Shrani sličice v predpomnilnik"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Sličice"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr "Opombe k datoteki (descript.ion)"
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "TC izvoz in uvoz:"
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION"
msgid "Default encoding:"
msgstr "Privzeti nabor:"
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Nastavitvena datoteka:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "Izvedljiva datoteka TC."
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Odvodna pot orodne vrstice"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "točke"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Velikost sličic:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Izbiranje datotek z miško"
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Drsenje"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Izbor"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Način:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "&Vrstica po vrstico"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Premik kazalke &vrstico po vrstico"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Stran po stran"
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "&Nastavitve"
#: tfrmoptionsplugins.btnenableplugin.caption
msgid "E&nable"
msgstr "&Omogoči"
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "&Odstrani"
#: tfrmoptionsplugins.btntweakplugin.caption
msgid "&Tweak"
msgstr "&Prilagodi"
#: tfrmoptionsplugins.lbldsxdescription.caption
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Vstavki &iskalnikov omogočajo uporabo dodatnih načinov iskanja oziroma uporabo zunanjih orodij (ukaz »locate« in podobno)"
#: tfrmoptionsplugins.lblwcxdescription.caption
msgid "Pack&er plugins are used to work with archives"
msgstr "Vstavki &pakirnikov so uporabljeni za delo z arhivi."
#: tfrmoptionsplugins.lblwdxdescription.caption
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Vsebinski &vstavki omogočajo prikaz podrobnosti datotek, kot so oznake mp3, atributi slik in seznami datotek, ter uporabo podatkov oznak za iskanje, preimenovanje in drugo."
#: tfrmoptionsplugins.lblwfxdescription.caption
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Sistemsko-datotečni vstavki omogočajo dostop do naprav, kot so dlančniki in PocketPC."
#: tfrmoptionsplugins.lblwlxdescription.caption
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Vstavki &pregledovalnikov omogočajo prikaz različnih datotek dokumentov, kot so slike, preglednice, podatkovne zbirke in podobno (F3, Ctrl+Q)."
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Dejavno"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr "Vstavek"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Vpisano za"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr "Ime datoteke"
#: tfrmoptionsplugins.tsdsx.caption
msgid "&Search plugins (.DSX)"
msgstr "Vstavki &iskanja (.dsx)"
#: tfrmoptionsplugins.tswcx.caption
msgid "Pac&ker plugins (.WCX)"
msgstr "Vstavki &pakiranja (.wcx)"
#: tfrmoptionsplugins.tswdx.caption
msgid "Content pl&ugins (.WDX)"
msgstr "&Vsebinski vstavki (.wdx)"
#: tfrmoptionsplugins.tswfx.caption
msgid "F&ile system plugins (.WFX)"
msgstr "Sistemsko-&datotečni vstavki (.wfx)"
#: tfrmoptionsplugins.tswlx.caption
msgid "&Viewer plugins (.WLX)"
msgstr "Vstavki &pregledovanja (.wlx)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgid "&Beginning (name must start with first typed character)"
msgstr "na &začetku (ime se mora začeti s prvim vpisanim znakom)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgid "En&ding (last character before a typed dot . must match)"
msgstr "na &koncu (ime se mora končati s prvim vpisanim znakom pred piko (.) in pripono)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Možnosti"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Natančno ujemanje imena datoteke:"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Upoštevanje velikosti črk med iskanjem je:"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Iskanje predmetov"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Ohrani preimenovano ime ob odklepanju zavihka"
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "S klikom na zavihek, se okno postavi v &žarišče"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgid "&Show tab header also when there is only one tab"
msgstr "Pokaži &glavo zavihka tudi, ko je odprt le en zavihek"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Zapri podvojene zavihke ob končanju programa"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgid "Con&firm close all tabs"
msgstr "&Potrdi zapiranje vseh zavihkov"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Potrdi zapiranje zaklenjenih zavihkov"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr "Omeji dolžino naslova zavihka na"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgid "Show locked tabs &with an asterisk *"
msgstr "Zaklenjene zavihke označi z zvezdico *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgid "&Tabs on multiple lines"
msgstr "&Zavihki so lahko v več vrsticah"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Tipki CTRL+↑ odpreta nov zavihek v ospredju"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgid "Open &new tabs near current tab"
msgstr "Odpri &nov zavihek ob trenutno dejavnem"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Uporabi obstoječi zavihek, ko je le mogoče"
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgid "Show ta&b close button"
msgstr "Gumb za &zapiranje zavihka je vedno viden"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Vedno pokaži črko pogona v nazivu zavihka"
#: tfrmoptionstabs.gbtabs.caption
msgid "Folder tabs headers"
msgstr "Glave zavihkov map"
#: tfrmoptionstabs.lblchar.caption
msgid "characters"
msgstr "znakov"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Dejanja ob dvojnem kliku na zavihek:"
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr "Položaj &zavihkov"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTEXISTINGTABSTOKEEP.TEXT"
msgid "None"
msgstr "brez"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTSAVEDIRHISTORY.TEXT"
msgid "No"
msgstr "Ne"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELLEFTSAVED.TEXT"
msgid "Left"
msgstr "Leva"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELRIGHTSAVED.TEXT"
msgid "Right"
msgstr "Desna"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr "Po ponovnem shranjevanju skoči na nastavitve priljubljenih zavihkov"
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr "Po prvem shranjevanju skoči na nastavitve priljubljenih zavihkov"
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr "Omogoči dodatne možnosti priljubljenih zavihkov (izbor ciljne strani ob obnovitvi ...)"
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr "Privzete dodatne nastavitve shranjevanja zavihkov:"
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr "Glave zavihkov map"
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr "Ob obnavljanju zavihkov obdrži tudi:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr "Zavihki, shranjeni na levi, bodo obnovljeni na:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr "Zavihki, shranjeni na desni, bodo obnovljeni na:"
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "S priljubljenimi zavihki se shranjuje tudi zgodovina map:"
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr "Privzet položaj v meniju med shranjevanjem:"
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} bi moral biti izpisan na tem mestu za ukaz, ki bo zagnan v terminalu"
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} bi moral biti izpisan na tem mestu za ukaz, ki bo zagnan v terminalu"
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} bi moral biti izpisan na tem mestu za ukaz, ki bo zagnan v terminalu"
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Ukaz za zagon terminala:"
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Ukaz za izvedbo zaključenega ukaza v terminalu"
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Ukaz za izvedbo ukaza v oknu terminala, ki naj ostane odprto"
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION"
msgid "Command:"
msgstr "Ukaz:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parametri:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION"
msgid "Command:"
msgstr "Ukaz:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parametri:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION"
msgid "Command:"
msgstr "Ukaz:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parametri:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "Gumb za &kloniranje"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgid "Edit hot&key"
msgstr "Uredi hitro &tipko"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgid "&Insert new button"
msgstr "&Vstavi nov gumb"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Izbor"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Drugo ..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr "Odstrani &hitre tipke"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Predlagaj"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr "Naj program ponudi orodni namig na osnovi vrste gumba, ukaza in parametra"
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "TFRMOPTIONSTOOLBAR.CBFLATBUTTONS.CAPTION"
msgid "&Flat buttons"
msgstr "&Ploski gumbi"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Pokaži napake ukazov"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Vnos parametrov ukaza, ki so podani vsak v svoji vrstici. Pritisnite tipko F1 za več pomoči o parametrih."
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Videz"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "Velikost orodne &vrstice:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgid "Comman&d:"
msgstr "&Ukaz:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parametr&i:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION"
msgid "Help"
msgstr "Pomoč"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Hitra tipka:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Iko&na:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Veli&kost ikone:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgid "Co&mmand:"
msgstr "&Ukaz:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgid "&Parameters:"
msgstr "&Parametri:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLSTARTPATH.CAPTION"
msgid "Start pat&h:"
msgstr "Začetna &pot:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "&Orodni namig:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "Dodaj orodno vrstico z VSEMI ukazi DC"
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "za zunanji ukaz"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "za notranji ukaz"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "za ločilnik"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "za podrejeno orodno vrstico"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION"
msgid "Backup..."
msgstr "Varnostna kopija ..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION"
msgid "Export..."
msgstr "Izvozi ..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Trenutna orodna vrstica ..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
msgid "to a Toolbar File (.toolbar)"
msgstr "v datoteko orodne vrstice (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
msgid "to a TC .BAR file (keep existing)"
msgstr "v datoteko TC.BAR (ohrani obstoječe)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
msgid "to a TC .BAR file (erase existing)"
msgstr "v datoteko TC.BAR (izbriši obstoječe)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Vrhnja orodna vrstica"
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Shrani varnostno kopijo orodne vrstice"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "v datoteko orodne vrstice (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "v datoteko TC.BAR (ohrani obstoječe)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "v datoteko TC.BAR (izbriši obstoječe)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "takoj za trenutno izbiro"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "kot prvi predmet"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "kot zadnji predmet"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "takoj pred trenutno izbiro"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION"
msgid "Import..."
msgstr "Uvozi ..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Obnovi varnostno kopijo orodne vrstice"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "za dodajanje na trenutno orodno vrstico"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "za dodajanje na novo orodno vrstico na trenutni orodni vrstici"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "za dodajanje nove orodne vrstice na vrhnjo orodno vrstico"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "za dodajanje na vrhnjo orodno vrstico"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "za zamenjavo vrhnje orodne vrstice"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "iz datoteke orodne vrstice (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "za dodajanje na trenutno orodno vrstico"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "za dodajanje na novo orodno vrstico na trenutni orodni vrstici"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "za dodajanje na novo orodno vrstico na vrhnji orodni vrstici"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "za dodajanje na vrhnjo orodno vrstico"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "za zamenjavo vrhnje orodne vrstice"
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "iz ene datoteke TC.BAR"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "za dodajanje na trenutno orodno vrstico"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "za dodajanje na novo orodno vrstico na trenutni orodni vrstici"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "za dodajanje nove orodne vrstice na vrhnjo orodno vrstico"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "za dodajanje na vrhnjo orodno vrstico"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "za zamenjavo vrhnje orodne vrstice"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "iz datoteke »wincmd.ini« programa TotalCommander ..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "za dodajanje na trenutno orodno vrstico"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "za dodajanje na novo orodno vrstico na trenutni orodni vrstici"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "za dodajanje nove orodne vrstice na vrhnjo orodno vrstico"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "za dodajanje na vrhnjo orodno vrstico"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "za zamenjavo vrhnje orodne vrstice"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "takoj za trenutnim izborom"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "kot prvi predmet"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "kot zadnji predmet"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "takoj pred trenutno izbiro"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION"
msgid "Search and replace..."
msgstr "Poišči in zamenjaj ..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "takoj za trenutnim izborom"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "kot prvi predmet"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "kot zadnji predmet"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "takoj pred trenutno izbiro"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "v vseh od vseh zgoraj ..."
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "v vseh ukazih ..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "v vseh imenih ikon ..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "v vseh parametrih ..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "v vseh začetnih poteh ..."
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "takoj za trenutnim izborom"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "kot prvi predmet"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "kot zadnji predmet"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "takoj pred trenutnim izborom"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Vrsta gumba"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "Po koncu izvajanja programa ohrani okno terminala &odprto"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "Izvedi v &terminalu"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "Uporabi &zunanji program"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "&Dodatni parametri:"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "&Pot do programa za izvedbo:"
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "&Uveljavi"
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "&Izbriši"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Predloga ..."
#: tfrmoptionstooltips.chkshowtooltip.caption
msgid "&Show tooltip for files in the file panel"
msgstr "Pokaži orodne &namige za datoteke v oknu"
#: tfrmoptionstooltips.gbcustomfields.caption
msgid "Custom fields by file type"
msgstr "Polja po meri (glede na vrsto datoteke)"
#: tfrmoptionstooltips.lblfieldslist.caption
msgid "Category &hint:"
msgstr "&Namig kategorije:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "&Maska kategorije:"
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "Ime &kategorije:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr "Z dvojnim klikom na vrstico na vrhu datotečnega okna"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "za notranji ukaz"
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr "Dvojni klik miške v izboru drevesa in končaj"
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION"
msgid "With the menu and internal command"
msgstr "za notranji ukaz"
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr "Z dvojnim klikom na zavihe (če je tako nastavljeno)"
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr "Med uporabi tipkovnih bližnjic, konča okno in se vrne na trenutno izbiro"
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr "Enojni klik miške v izboru drevesa in končaj"
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr "Uporabi za zgodovino ukazne vrstice"
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr "Uporabi za zgodovino map"
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr "Uporabi za zgodovino pogleda (obiskane poti dejavnega okna)"
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr "Obnašanje glede na izbor:"
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr "Možnosti, povezane z menijem drevesnega pogleda:"
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr "Kje uporabiti menije drevesnega pogleda:"
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr "* OPOMBA: Možnosti, kot so upoštevanje velikosti črk, izpuščanje akcentov znakov in podobno, so shranjene in naložene posamično za vsako rabo oziroma sejo."
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr "Z vročimi mapami:"
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr "S priljubljenimi zavihki:"
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr "Z zgodovino:"
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr "Uporabi in pokaži tipkovno bližnjico za izbor predmetov"
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr "Razporeditev in možnosti barv:"
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Barva ozadja:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Barva kazalke:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Barva najdenega besedila:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Barva najdenega besedila pod kazalko:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Običajna barva besedila:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Običajna barva ozadja besedila:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Predogled menija drevesnega pogleda:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr "Drugotna barva besedila:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr "Drugotna barva ozadja besedila:"
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Barva bližnjice:"
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr "Bližnjica pod kazalko:"
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr "Barva pisave neizberljivega predmeta:"
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr "Barva neizberljivega predmeta"
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr "S spreminjanjem barve na levi si je mogoče ogledati, kako bo drevesni pogled menija videti."
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Način bralnega pregledovalnika"
#: tfrmoptionsviewer.gbviewerexample.caption
msgid "Example"
msgstr "Primer"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "Barva &ozadja v bralnem pregledovalniku"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "&Barva pisave v bralnem pregledovalniku"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "&Število stolpcev v bralnem pregledovalniku"
#: tfrmpackdlg.btnconfig.caption
msgctxt "tfrmpackdlg.btnconfig.caption"
msgid "Con&figure"
msgstr "&Nastavitve"
#: tfrmpackdlg.caption
msgid "Pack files"
msgstr "Pakiranje datotek"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "&Ustvari ločen arhiv za vsako izbrano datoteko oziroma mapo"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Ustvari arhiv za samodejno odpakiranje"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "&Šifriraj arhiv z geslom"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Pre&makni v arhiv"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "Ustvari arhiv v več &delih"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "Najprej &vstavi v arhiv TAR"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Zapakiraj tudi imena &poti (le pri več ravneh map)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Zapakiraj datoteke v arhiv:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Pakirnik"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zapri"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Odpakiraj &vse in izvedi"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "Odpakiraj &in izvedi"
#: tfrmpackinfodlg.caption
msgid "Properties of packed file"
msgstr "Lastnosti arhiva"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Atributi:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Raven stiskanja:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Datum:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Način:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Izvorna velikost:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Datoteka:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Arhivirana velikost:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Pakirnik:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Čas:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Zapri okno filtra"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Vnos besedila za iskanje ali filtriranje"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Razlikuj velikosti črk"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "M"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "TFRMQUICKSEARCH.SBDIRECTORIES.HINT"
msgid "Directories"
msgstr "Mape"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "D"
#: tfrmquicksearch.sbfiles.hint
msgctxt "TFRMQUICKSEARCH.SBFILES.HINT"
msgid "Files"
msgstr "Datoteke"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Poišči na začetku imena"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Poišči na koncu imena"
#: tfrmquicksearch.tglfilter.caption
msgid "Filter"
msgstr "Filter"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Preklop med iskalnim in filtrirnim načinom"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "&Več pravil"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "Man%j pravil"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Uporabi &vsebinske vstavke združeno z:"
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
msgid "Plugin"
msgstr "Vstavek"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Polje"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Operator"
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Vrednost"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&AND (vsi zadetki)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&OR (vsi zadetki)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Prekliči"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "&Zapri"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "Pomo&č"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "V &redu"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "Izbor znakov za &vstavljanje:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&V redu"
#: tfrmsetfileproperties.caption
msgid "Change attributes"
msgstr "Spreminjanje atributov"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Lepljivo"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgid "Archive"
msgstr "Arhiv"
#: tfrmsetfileproperties.chkcreationtime.caption
msgid "Created:"
msgstr "Ustvarjeno:"
#: tfrmsetfileproperties.chkhidden.caption
msgid "Hidden"
msgstr "Skrita datoteka"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Zadnji dostop:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Spremenjeno:"
#: tfrmsetfileproperties.chkreadonly.caption
msgid "Read only"
msgstr "Le za branje"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Vključi podrejene mape"
#: tfrmsetfileproperties.chksystem.caption
msgid "System"
msgstr "Sistemska datoteka"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Časovni podatki datotek in map"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributi"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributi"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Biti:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Skupina"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(sivo polje pomeni nespremenjeno vrednost)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Drugo"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Lastnik"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Črkovno:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Izvedi"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION"
msgid "(gray field means unchanged value)"
msgstr "(sivo polje pomeni nespremenjeno vrednost)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Osmiško:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Preberi"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zapiši"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "V &redu"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nekatere funkcije za izbor ustrezne poti"
#: tfrmsplitter.caption
msgid "Splitter"
msgstr "Razdelilnik"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Ustvari overitveno datoteko CRC32"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Ime datoteke"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Velikost in število delov"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "&Ciljna mapa:"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "&Vir datoteke:"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "&Število delov"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Bajti"
#: tfrmsplitter.rbtngigab.caption
msgid "&Gigabytes"
msgstr "&Gigabajti"
#: tfrmsplitter.rbtnkilob.caption
msgid "&Kilobytes"
msgstr "&Kilobajti"
#: tfrmsplitter.rbtnmegab.caption
msgid "&Megabytes"
msgstr "&Megabajti"
#: tfrmstartingsplash.caption
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
msgid "Build"
msgstr "Izgradnja"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Operacijski sistem"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Okolje"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Predelava"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr "Različica"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr "Različica gradnika"
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&V redu"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Ustvarjanje simbolne povezave"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Pot povezave:"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Ime &povezave:"
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr "Zapri"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr "Primerjaj"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Uskladi"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Usklajevanje map"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "Nesimetrično"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "Po vsebini"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "Prezri datum"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "Le izbrano mapo"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Upoštevaj podmape"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Pokaži:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
msgid "Name"
msgstr "Ime"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
msgid "Size"
msgstr "Velikost"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
msgid "Date"
msgstr "Datum"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
msgid "Date"
msgstr "Datum"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
msgid "Size"
msgstr "Velikost"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
msgid "Name"
msgstr "Ime"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(v glavnem oknu)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
msgid "Compare"
msgstr "Primerjaj"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Poglej na levi"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Poglej na desni"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "podvojene"
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "posamezne"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Pritisnite gumb »Primerjava« za začetek"
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr "Uskladi"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Potrdi prepisovanje"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Meni drevesnega pogleda"
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr "Izbor vroče mape:"
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr "Iskanje upošteva velikosti črk"
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr "Zloži vse ravni"
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr "Razširi vse ravni"
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr "Iskanje ne upošteva naglasov in vezav znakov"
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr "Iskanje ne upošteva velikosti črk"
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr "Iskanje upošteva naglase in vezave znakov"
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr "Ne pokaži vsebine veje »le zato«, ker je iskalni niz najden v imenu veje"
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr "Če je iskalni niz najden v imenu veje, pokaži celotno vejo tudi, če predneti niso skladni"
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr "Zapri meni drevesnega pogleda"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT"
msgid "Configuration of Tree View Menu"
msgstr "Nastavljanje menija drevesnega pogleda"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT"
msgid "Configuration of Tree View Menu Colors"
msgstr "Nastavljanje barv menija drevesnega pogleda"
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "Dodaj n&ovo"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Prekliči"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "S&premeni"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Pri&vzeto"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "V &redu"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "&Odstrani"
#: tfrmtweakplugin.caption
msgid "Tweak plugin"
msgstr "Prilagodi vstavek"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Določi vrsto arhiva po &vsebini"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Dovoljeno je &izbrisati datoteke"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Podpira &šifriranje"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Pokaži kot &običajne datoteke (skrij ikono arhiva)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Podpira pakiranje datotek v &pomnilniku"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Dovoljeno je &spreminjati obstoječe arhive"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "Arhiv lahko vsebuje &več datotek"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Dovoljeno je ustvariti nove ar&hive"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "Podpira &pogovorno okno možnosti"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Dovoli iskanje &besedila v arhivih"
#: tfrmtweakplugin.lbldescription.caption
msgid "&Description:"
msgstr "&Opis:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "Zaznava &nizov:"
#: tfrmtweakplugin.lblextension.caption
msgid "&Extension:"
msgstr "Ra&zširitev:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Zastavice:"
#: tfrmtweakplugin.lblname.caption
msgctxt "tfrmtweakplugin.lblname.caption"
msgid "&Name:"
msgstr "&Ime:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "tfrmtweakplugin.lblplugin.caption"
msgid "&Plugin:"
msgstr "&Vstavek:"
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "&Vstavek:"
#: tfrmviewer.actabout.caption
msgid "About Viewer..."
msgstr "O pregledovalniku ..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Prikaže pogovorno okno podrobnosti"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr "Spremeni nabor"
#: tfrmviewer.actcopyfile.caption
msgctxt "tfrmviewer.actcopyfile.caption"
msgid "Copy File"
msgstr "Kopiraj datoteko"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Kopiranje datoteke"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "TFRMVIEWER.ACTCOPYTOCLIPBOARD.CAPTION"
msgid "Copy To Clipboard"
msgstr "Kopiranje v odložišče"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr "Kopiranje oblikovanega besedila v odložišče"
#: tfrmviewer.actdeletefile.caption
msgctxt "tfrmviewer.actdeletefile.caption"
msgid "Delete File"
msgstr "Izbriši datoteko"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Brisanje datoteke"
#: tfrmviewer.actexitviewer.caption
msgctxt "TFRMVIEWER.ACTEXITVIEWER.CAPTION"
msgid "E&xit"
msgstr "&Končaj"
#: tfrmviewer.actfind.caption
msgctxt "TFRMVIEWER.ACTFIND.CAPTION"
msgid "Find"
msgstr "Najdi"
#: tfrmviewer.actfindnext.caption
msgctxt "TFRMVIEWER.ACTFINDNEXT.CAPTION"
msgid "Find next"
msgstr "Najdi naslednje"
#: tfrmviewer.actfindprev.caption
msgctxt "TFRMVIEWER.ACTFINDPREV.CAPTION"
msgid "Find previous"
msgstr "Najdi predhodne"
#: tfrmviewer.actfullscreen.caption
msgctxt "TFRMVIEWER.ACTFULLSCREEN.CAPTION"
msgid "Full Screen"
msgstr "Celozaslonski način"
#: tfrmviewer.actimagecenter.caption
msgid "Center"
msgstr "Sredina"
#: tfrmviewer.actloadnextfile.caption
msgid "&Next"
msgstr "&Naslednji"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Naloži naslednjo datoteko"
#: tfrmviewer.actloadprevfile.caption
msgid "&Previous"
msgstr "&Predhodna"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Naloži predhodno datoteko"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr "Zrcali vodoravno"
#: tfrmviewer.actmirrorhorz.hint
msgid "Mirror"
msgstr "Zrcaljenje"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr "Zrcali navpično"
#: tfrmviewer.actmovefile.caption
msgctxt "tfrmviewer.actmovefile.caption"
msgid "Move File"
msgstr "Premakni datoteko"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Premakni datoteko"
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Predogled"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Ponovno naloži"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Ponovno naloži trenutno datoteko"
#: tfrmviewer.actrotate180.caption
msgid "+ 180"
msgstr "+180"
#: tfrmviewer.actrotate180.hint
msgid "Rotate 180 degrees"
msgstr "Zavrti za 180 stopinj"
#: tfrmviewer.actrotate270.caption
msgid "- 90"
msgstr "90"
#: tfrmviewer.actrotate270.hint
msgid "Rotate -90 degrees"
msgstr "Zavrti za 90 stopinj v desno"
#: tfrmviewer.actrotate90.caption
msgid "+ 90"
msgstr "+90"
#: tfrmviewer.actrotate90.hint
msgid "Rotate +90 degrees"
msgstr "Zavrti za 90 stopinj v levo"
#: tfrmviewer.actsave.caption
msgctxt "TFRMVIEWER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Shrani"
#: tfrmviewer.actsaveas.caption
msgid "Save As..."
msgstr "Shrani kot ..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Shrani datoteko kot ..."
#: tfrmviewer.actscreenshot.caption
msgctxt "TFRMVIEWER.ACTSCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Zaslonska slika"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "Zamakni za 3 sekunde"
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "Zamakni za 5 sekund"
#: tfrmviewer.actselectall.caption
msgctxt "TFRMVIEWER.ACTSELECTALL.CAPTION"
msgid "Select All"
msgstr "Izberi vse"
#: tfrmviewer.actshowasbin.caption
msgid "Show as &Bin"
msgstr "Pokaži &dvojiško"
#: tfrmviewer.actshowasbook.caption
msgid "Show as B&ook"
msgstr "Pokaži v &bralnem pogledu"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr "Pokaži &desetiško"
#: tfrmviewer.actshowashex.caption
msgid "Show as &Hex"
msgstr "Pokaži &šestnajstiško"
#: tfrmviewer.actshowastext.caption
msgid "Show as &Text"
msgstr "Pokaži kot &besedilo"
#: tfrmviewer.actshowaswraptext.caption
msgid "Show as &Wrap text"
msgstr "Pokaži kot besedilo v &prelomu"
#: tfrmviewer.actshowgraphics.caption
msgid "Graphics"
msgstr "Grafični prikaz"
#: tfrmviewer.actshowplugins.caption
msgctxt "TFRMVIEWER.ACTSHOWPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Vstavki"
#: tfrmviewer.actstretchimage.caption
msgid "Stretch"
msgstr "Raztegni"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Raztegni sliko"
#: tfrmviewer.actstretchonlylarge.caption
msgid "Stretch only large"
msgstr "Raztegni le velike"
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Približanje"
#: tfrmviewer.actzoomin.caption
msgid "Zoom In"
msgstr "Približaj"
#: tfrmviewer.actzoomout.caption
msgid "Zoom Out"
msgstr "Oddalji"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmviewer.btncuttuimage.hint
msgid "Crop"
msgstr "Obreži"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Izbriši"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Izbriši"
#: tfrmviewer.btnfullscreen.hint
msgctxt "tfrmviewer.btnfullscreen.hint"
msgid "Full Screen"
msgstr "Celozaslonski način"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Poudari"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Premakni"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Premakni"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Risanje"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Rdeče oči"
#: tfrmviewer.btnresize.hint
msgid "Resize"
msgstr "Spremeni velikost"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Razveljavi"
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Pregledovalnik"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Predstavitev"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Pisalo"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "tfrmviewer.gboxhightlight.caption"
msgid "Highlight"
msgstr "Poudari"
#: tfrmviewer.gboxpaint.caption
msgctxt "tfrmviewer.gboxpaint.caption"
msgid "Paint"
msgstr "Risanje"
#: tfrmviewer.gboxslideshow.caption
msgctxt "tfrmviewer.gboxslideshow.caption"
msgid "Slide Show"
msgstr "Predstavitev"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Pogled"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Nabor &znakov"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Datoteka"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Slika"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Natisni ..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Zavrti"
#: tfrmviewer.miscreenshot.caption
msgctxt "tfrmviewer.miscreenshot.caption"
msgid "Screenshot"
msgstr "Zaslonski posnetek"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Pogled"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Izberi vse"
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Če datoteka obstaja"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Če datoteka obstaja"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION"
msgid "Copy d&ate/time"
msgstr "Kopiraj &datum in čas"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Pošlji v ozadje (ločena povezava)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Če datoteka že obstaja,"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr "Datum posnetka"
#: uexifreader.rsimageheight
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Višina"
#: uexifreader.rsimagewidth
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Širina"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr "Proizvajalec"
#: uexifreader.rsmodel
msgid "Camera model"
msgstr "Model fotoaparata"
#: uexifreader.rsorientation
msgid "Orientation"
msgstr "Usmerjenost"
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
"Datoteke ni mogoče najti, zato ni mogoče overiti končne kombinacije datotek:\n"
"%s\n"
"\n"
"Omogočite dostop do datoteke in pritisnite gumb »V redu«,\n"
"ali pa pritisnite »Prekliči« in nadaljujte brez nje?\n"
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Prekliči hitri filter"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Prekliči trenutno opravilo"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Vpis imena datoteke s pripono za spuščeno besedilo."
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Vrsta zapisa za uvoz"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Okvarjeno:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Splošno:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Manjkajoče:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Napaka branj:"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Uspešno zaključeno:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Vnos nadzorne vsote in izbira algoritma:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Preverjanje nadzornih vsot"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Skupaj:"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr "Ali želite počistiti filtre pred novim iskanjem?"
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "V odložišču ni veljavnih podatkov orodne vrstice."
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr "Vse;Dejavno okno;Levo okno;Desno okno;Datotečna opravila;Nastavitve;Omrežje;Razno;Paralelna vrata;Tisk;Označevanje;Varnost;Odložišče;FTP;Navigacija;Pomoč;Okno;Ukazna vrstica;Orodja;Pogled;Uporabnik;Zavihki;Razvrščanje;Beleženje"
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr "Opuščeno razvrščanje;Abecedno razvrščanje"
#: ulng.rscolattr
msgid "Attr"
msgstr "Atrib"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Datum"
#: ulng.rscolext
msgid "Ext"
msgstr "Pri"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Ime"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Velikost"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Poravnava"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Naslov"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Izbriši"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Vsebina stolpca"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Premakni"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Širina"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Prilagodi stolpec"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Nastavi programsko vez"
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "Potrjevanje ukazne vrstice in parametrov"
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Kopiraj (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Uvožena orodna vrstica DC"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Uvožena orodna vrstica TC"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "_Spuščeno besedilo"
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "_Spuščena koda HTML"
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "_Spuščeno oblikovano besedilo"
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "_Spuščeno neoblikovano besedilo"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "_Spuščeno besedilo UTF16"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "_Spuščeno besedilo UTF8"
#: ulng.rsdiffadds
msgid " Adds: "
msgstr "Dodano:"
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr "Za izbris:"
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "Datoteki sta enaki!"
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr "Število razlik:"
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr " Spremenjeno:"
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "&Prekini"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "&Vse"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Pripni"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "&Samodejno preimenuj izvorne datoteke"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Prekliči"
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Nadaljuj"
#: ulng.rsdlgbuttoncopyinto
msgid "&Merge"
msgstr "Kopiraj &v"
#: ulng.rsdlgbuttoncopyintoall
msgid "Mer&ge All"
msgstr "Kopiraj v &vse"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "&Končaj program"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr "Pre&zri"
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Izberi &vse"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Ne"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "&Brez"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&V redu"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "&Drugo"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Prepiši"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Prepiši &vse"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Prepiši vse &večje"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Prepiši vse &starejše"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Prepiši vse &manjše"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "&Preimenuj"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Nadaljuj"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Poskusi &znova"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr "Kot &skrbnik"
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Preskoči"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Pres&koči vse"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Da"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Kopiraj datoteke"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Premakni datoteke"
#: ulng.rsdlgoppause
msgid "Pau&se"
msgstr "Pre&mor"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&Začni"
#: ulng.rsdlgqueue
msgid "Queue"
msgstr "V vrsto"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Hitrost %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Pri hitrosti %s/s bo opravilo trajalo še %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr "obogateno besedilo;zapis HTML;zapis v naboru Unikod;običajno besedilo"
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<brez oznake>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<ni nosilca>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Urejevalnik besedila programa Double Commander"
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Skoči v vrstico:"
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr "Skoči v vrstico"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "nova_datoteka.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Ime datoteke:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Odpri datoteko"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Nazaj"
#: ulng.rseditsearchcaption
msgid "Search"
msgstr "Poišči"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "&Naprej"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Zamenjaj"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "z zunanjim urejevalnikom"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "z notranjim urejevalnikom"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Izvedi prek lupine"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Izvedi v terminalu in zapri okno"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Izvedi v terminalu in pusti okno odprto"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "levo;desno;dejavno;nedejavno;oboje;brez"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Da;Ne"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Izvozi iz DC"
#: ulng.rsfileopdirectoryexistsoptions
msgid "Ask;Merge;Skip"
msgstr "vprašaj;združi;preskoči"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Vprašaj;Prepiši;Prepiši starejše;Preskoči"
#: ulng.rsfileopsetpropertyerroroptions
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "vprašaj;ne nastavljaj več;prezri napake"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "Filter"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Določitev predloge"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "do %s. ravni map"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "vse ravni (neomejena globina)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "le trenutno raven"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Mapa %s ne obstaja!"
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Najdeno: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Shrani predlogo iskanja"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Ime predloge:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Preiskano: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Preiskovanje"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Iskanje datotek"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Čas preiskovanja:"
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Začni pri"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Sprosti %s od %s bajtov"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%sB prostora"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Datum in čas zadnjega dostopa"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Atributi"
#: ulng.rsfunccomment
msgid "Comment"
msgstr "Opomba"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Stisnjena velikost"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Datum in čas ustvarjanja"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Pripona"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Skupina"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Spremeni čas in datum"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Povezava do"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Datum in čas spremembe"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Ime"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Ime brez pripone"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Lastnik"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Pot"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Velikost"
#: ulng.rsfunctype
msgid "Type"
msgstr "Vrsta"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Napaka med ustvarjanjem trde povezave."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "brez;ime, az;ime, za;pripona, az;pripona, za;velikost 90;velikost 09;datum 90;datum 09"
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"Opozorilo! Med obnavljanjem datoteke varnostne kopije vročih map *.hotlist se starejša različica izbriše in je ni mogoče več povrniti.\n"
"\n"
"Ali ste prepričani, da želite nadaljevati?\n"
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Pogovorno okno kopiranja in premikanja"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Primerjalnik"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Uredi pogovorno okno opombe"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Urejevalnik"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Najdi datoteke"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Glavno"
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Pregledovalnik"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
"Namestitev s tem imenom že obstaja.\n"
"Ali jo želite prepisati?\n"
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr "Ali ste prepričani, da želite obnoviti privzeto?"
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr "Ali ste prepričani, da želite izbrisati namestitev »%s«?"
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr "Kopija %s"
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr "Vpis novega imena"
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr "Ohraniti je treba vsak eno datoteko tipkovne bližnjice."
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr "Novo ime"
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
"Nastavitev »%s« je spremenjena.\n"
"Ali želite spremembe shraniti?\n"
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr "Ni tipkovne bližnjice s tipko »ENTER«"
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr "po imenu ukaza;po tipkovni bližnjici (skupinjeno);po tipkovni bližnjici (ena na vrstico)"
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "Ni mogoče najti sklica na privzeto datoteko orodne vrstice"
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr "Seznam oken dejavnih iskanj"
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Maska odstranitve izbire"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Maska izbire"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Maska izbire:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Stolpčni pogled s tem imenom že obstaja"
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr "Za spreminjanje trenutnega pogleda urejanja stolpcev, kopirajte, shranite ali pa izbrišite trenutne"
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Nastavitve stolpcev po meri"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Vpis novega imena stolpca po meri"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Dejanja"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr "<Privzeto>"
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr "Osmiško"
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr "Kopiraj imena s potjo UNC"
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Odklopi omrežno pogon ..."
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Uredi"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Izvrzi"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Odpakiraj v to mapo ..."
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Preslikaj omrežni pogon ..."
#: ulng.rsmnumount
msgid "Mount"
msgstr "Priklopi"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Novo"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Nosilec ni na voljo"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Odpri"
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Odpri s programom"
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Drugo ..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Zapakiraj datoteke v to mapo ..."
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Razvrsti po"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Odklopi"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Poglej"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Račun:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr "Vsi notranji ukazi programa DC"
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Dodatni parametri arhiva v ukazni vrstici:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr "Ali želite niz zapreti z oklepajem?"
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"Napaka nadzorne vsote CRC32 za datoteko:\n"
"»%s«\n"
"\n"
"Ali želite obdržati okvarjeno datoteko?\n"
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Datoteke »%s« ni mogoče kopirati oziroma premakniti samo vase!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Ni mogoče izbrisati mape %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr "Mape »%s« ni mogoče prepisati s predmetom »%s«, ki ni mapa!"
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Ukaz chdir v [%s] je spodletel!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Ali naj se odstranijo vsi nedejavni zavihki?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Zavihek (%s) je zaklenjen! Ali naj se vseeno zapre?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr "Potrditev parametra"
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Ali ste prepričani, da želite končati?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "Datoteka %s je spremenjena. Ali želite kopirati vsebino nazaj?"
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "Ni mogoče kopirati nazaj ali želite ohraniti spremenjeno datoteko?"
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Ali naj se kopira %d izbranih datotek ali map?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Ali naj se »%s« kopira v:"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Ustvari novo vrsto »datotek %s« >"
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Vpis mesta in imena datoteke, kamor naj se shrani datoteka orodne vrstice DC"
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Dejanje po meri"
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Ali naj se delno kopirana datoteka izbriše?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Ali naj se izbrani predmeti izbrišejo (%d predmetov)?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Ali naj se izbrani predmeti premaknejo v smeti (%d predmetov)?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Ali naj se »%s« izbriše?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Ali naj se »%s« premakne v smeti?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Predmeta »%s« ni mogoče premakniti v smeti. Ali naj se izbriše trajno?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Disk ni na voljo"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr "Vpis imena dejanja po meri:"
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Vpis pripone datoteke:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Vnos imena:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Vpis imena nove vrste datotek za razširitev »%s«"
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Napaka CRC v podatkih arhiva"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Slabi podatki"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Ni se mogoče povezati s strežnikom: »%s«"
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Ni mogoče kopirati datoteke %s v %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Mapa z imenom »%s« že obstaja."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Datum %s ni podprt!"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Mapa %s že obstaja!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Ukaz je prekinjen na zahtevo uporabnika"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Napaka med zapiranjem datoteke"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Ni mogoče ustvariti datoteke"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "V arhivu ni več datotek"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Ni mogoče odpreti obstoječe datoteke"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Napaka med branjem iz datoteke"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Napaka med pisanjem v datoteko"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Ni mogoče ustvariti mape %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Neveljavna povezava"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Ni najdenih datotek"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Ni dovolj pomnilnika"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Funkcija ni podprta!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Napaka v ukazu vsebinskega menija"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Napaka med nalaganjem nastavitev"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Napaka skladnje logičnega izraza!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Ni mogoče preimenovati datoteke %s v %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Vezi ni mogoče shraniti!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Ni mogoče shraniti datoteke"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Ni mogoče določiti atributov za »%s«"
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Datuma in časa za datoteko »%s« ni mogoče določiti."
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Ni mogoče določiti lastništva in skupine za »%s«"
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "Ni mogoče nastaviti dovoljenj za »%s«"
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Medpomnilnik je premajhen"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Izbranih je preveč datotek za pakiranje"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Vrsta arhiva ni znana"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "Ali ste prepričani, da želite odstraniti vse vnose priljubljenih zavihkov (dejanja ni mogoče povrniti)?"
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Sem povlecite druge vrednosti"
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr "Vnos imena novega priljubljenega predmeta"
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "Shranjevanje novega priljubljenega zavihka"
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Uspešno izvoženi priljubljeni zavihki: %d na %d"
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr "Privzete dodatne nastavitve za shranjevanje zgodovine za nove priljubljene zavihke:"
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Uspešno uvožene datoteke: %d na %d"
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Opuščeni zavihki so uvoženi"
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr "Izbor datotek .tab za uvoz (izbrati je dovoljeno več kot eno!)"
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr "Zadnje spremembe priljubljenih zavihkov še niso shranjene. Ali jih želite shraniti pred nadaljevanjem?"
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Shranjuj zgodovino mape s priljubljenimi zavihki:"
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Ime podrejenega menija"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "Naloženi bodo priljubljeni zavihki: »%s«"
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr "Shrani trenutne zavihke preko obstoječih priljubljenih zavihkov"
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Datoteka %s je spremenjena. Ali naj se spremembe shranijo?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s bajtov, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Prepiši:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Datoteka %s že obstaja. Ali naj bo prepisana?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Z datoteko:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Datoteke »%s« ni mogoče najti."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Zaznana so dejavna datotečna opravila"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Nekatera opravila datotek še niso končana. S predčasnim končanjem programa lahko pride do izgube podatkov."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
"Dolžina imena cilja (%d) je več kot %d znakov!\n"
"%s\n"
"Mnogi programi imajo lahko težave s tako dolgimi imeni datotek in map!\n"
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Datoteka %s je označena skrita, sistemska ali le za branje. Ali naj se vseeno izbriše?"
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "Datoteka velikosti »%s« je prevelika za ciljni datotečni sistem!"
#: ulng.rsmsgfolderexistsrwrt
msgid "Folder %s exists, merge?"
msgstr "Mapa %s že obstaja. Ali želite datoteke združiti v to mapo?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Ali naj se sledi simbolni povezavi »%s«?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Izbor vrste zapisa za uvoz"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Dodaj %d izbranih map"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Dodaj izbrano mapo:"
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Dodaj trenutno mapo:"
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Izvedi ukaz"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_nek_ukaz"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Nastavitev seznama hitrih map"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Ali ste prepričani, da želite odstraniti vse vnose seznama hitrih map (dejanja ni mogoče povrniti)?"
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Izveden bo naslednji ukaz:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "To je hitra mapa z imenom "
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "S tem bo spremenjeno dejavno okna na pot:"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "Nedejavno okno sledi naslednji poti:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Napaka ustvarjanja varnostne kopije vnosov ..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Napaka med izvažanjem vnosov ..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Izvozi vse!"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Izvozi seznam hitrih map izbor vnosov za izvoz"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Izvozi izbrano"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Uvozi vse!"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Uvoz seznama hitrih map izbor vnosov za uvoz"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Uvozi izbrano"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "&Pot"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Najdi datoteko ».hotlist« za uvoz"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Ime vroče mape"
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Število novih vnosov: %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "In izbranih predmetov za izvoz!"
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Pot do vroče mape"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Ponovno dodaj izbrano mapo:"
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Ponovno dodaj trenutno mapo:"
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Vpis mesta in imena datoteke seznama hitrih map za obnovitev"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Ukaz:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(konec podrejenega menija)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Ime &menija:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "&Ime:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(ločilnik)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Ime podrejenega menija"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Cilj vroče mape"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Določilo, ali naj bo dejavno okno razvrščeno na trenuten način tudi po zamenjavi mape"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Določilo, ali naj bo nedejavno okno razvrščeno na trenuten način tudi po zamenjavi mape"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Nekatere funkcije za izbor ustrezne poti; relativne, absolutne, posebne mape ..."
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Skupno shranjenih vnosov: %d\n"
"\n"
"Ime datoteke varnostne kopije: %s\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Število izvoženih vnosov:"
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"Ali ste želeli izbrisati vse predmete znotraj podrejenega menija [%s]?\n"
"Če izberete NE, bodo izbrisani le ločilniki menija, predmeti pa bodo ohranjeni.\n"
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Vpis mesta in imena datoteke, kamor naj se shrani seznam hitrih map"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Nepravilni podatki dolžine datoteke za: »%s«"
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Vstavite dodatni disk, ključ oziroma drug pogon.\n"
"\n"
"S tem omogočite zapis datoteke:\n"
"»%s«\n"
"\n"
"Zapisati je treba še: %d\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Napaka v ukazni vrstici"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Neveljavno ime datoteke"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Neveljaven zapis nastavitvene datoteke"
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Neveljavna pot"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Pot %s vsebuje nedovoljene znake."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Ta vrsta vstavka ni podprta!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Ta vstavek je izgrajen za različico %s.%s. Z različico %s ne deluje."
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Neveljavno navajanje"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Neveljaven izbor datotek"
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Nalaganje seznama datotek ..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr "Najdi nastavitveno datoteko programa TotalCommander (wincmd.ini)"
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "Določi pot do izvedljive datoteke TC (totalcmd.exe ali totalcmd64.exe)"
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Kopiraj datoteko %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Izbriši datoteko %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Napaka:"
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr "Zaženi zunanji program"
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr "Zunanji rezultati"
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Razširi datoteko %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Podrobnosti:"
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Ustvari povezavo %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Ustvari mapo %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Premakni datoteko %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Zapakiraj v datoteko %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Odstrani mapo %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Končano:"
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Ustvari simbolno povezavo %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Preizkusi celovitost datoteke %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Varno izbriši %s"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Neobnovljivo izbriši mapo %s"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Glavno geslo"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Vnesite glavno geslo:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Nova datoteka"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Odpakiran bo naslednji del arhiva"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Ni datotek"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Ni izbranih datotek."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Ni dovolj prostora na ciljnem pogonu. Ali naj se opravilo vseeno nadaljuje?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Ni dovolj prostora na ciljnem pogonu. Ali naj se prostor ponovno izračuna?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Ni mogoče izbrisati datoteke %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Ni podprto."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr "Predmet ne obstaja!"
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Spodaj je okno predogleda. S premikanjem kazalnika in izborom datoteke se pokažejo različne prilagoditve nastavitev."
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Geslo:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Gesli sta različni!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Vnesite geslo:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Geslo (požarni zid):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Ponovno vnesite geslo za overitev:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Izbriši %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Shranjen predmet »%s« že obstaja. Ali naj se prepiše?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Napaka izvajanja ukaza (%s)"
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Ime datoteke za spuščeno besedilo:"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Ta datoteka mora biti na voljo. Ali želite poskusiti znova?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Vnos imena novega priljubljenega predmeta"
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Vnos imena tega meni"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Ali naj se izbrani predmeti preimenujejo oziroma premaknejo (%d predmetov)?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Ali naj se predmet »%s« preimenuje oziroma premakne?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Za uveljavitev sprememb je treba program ponovno zagnati."
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Izberite vrsto datoteke za dodajanje razširitve »%s«"
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Izbrano: %s od %s, datoteke: %d od %d, mape: %d od %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Izbor izvedljive datoteke za"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Izbrati je treba le datoteko nadzorne vsote!"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Izberite mesto za naslednji del arhiva"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Določi oznako dela arhiva"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Posebne mape"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Dodaj pot iz dejavnega okna"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Dodaj pot iz nedejavnega okna"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Prebrskaj in uporabi izbrano pot"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Uporabi okoljske spremenljivke"
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Programska pot DC ..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Pot do okoljske spremenljivke ..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Uporabi drugo posebno mapo Windows ..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Uporabi posebno mapo Windows ..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Pokaži kot relativno pot do vroče mape ..."
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Uporabi pot kot absolutno pot"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Pokaži kot relativno pot do posebne poti DC ..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Pokaži kot relativno pot do okoljske spremenljivke ..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Pokaži kot relativno pot do posebne mape Windows (TC) ..."
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Pokaži kot relativno pot do posebne mape Windows ..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Uporabi posebno pot ..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr "Uporabi pot do vroče mape"
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Uporabi drugo posebno mapo Windows ..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Uporabi posebno mapo Windows ..."
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr "Zavihek (%s) je zaklenjen! Ali želite odpreti mapo v novem zavihku?"
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Preimenuj zavihek"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Novo ime zavihka:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Ciljna pot:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Napaka: ni mogoče najti nastavitvene datoteke programa Total Commander:\n"
"%s\n"
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Napaka: ni mogoče najti izvedbene datoteke programa Total Commander:\n"
"%s\n"
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Napaka: program Total Commander je zagnan, kar pa za to dejanje ne sme biti.\n"
"Zaprite program ali prekličite opravilo\n"
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Napaka! Ni mogoče najti žele odvodne mape orodne vrstice TC:\n"
"%s\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Vpis mesta in imena datoteke, kamor naj se shrani datoteka orodne vrstice DC"
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr "Datoteka »%s« je kopirana v odložišče"
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr "Razširitev te datoteke ni med znanimi vrstami datotek"
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Najdi datoteko »*.toolbars« za uvoz"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Najdi datoteko »*.bar« za uvoz"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Vpišite mesto in ime datoteke orodne vrstice za obnovitev"
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Shranjeno.\n"
"Ime orodne vrstice: %s'\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Izbranih je preveč datotek."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Nedoločeno"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr "NAPAKA: nepričakovana raba menija drevesnega pogleda!"
#: ulng.rsmsgurl
msgid "URL:"
msgstr "Naslov URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "<brez pripone>"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr "<brez imena>"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Uporabniško ime:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Uporabniško ime (požarni zid):"
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Oznaka dela arhiva:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Velikost dela arhiva:"
# This should be multiple plural !!!!
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Ali naj se izbrane datoteke oziroma mape neobnovljivo izbrišejo (%d)?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Ali naj se »%s« neobnovljivo izbriše?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "z"
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr "Ali želite predmete samodejno preimenovati v »ime (1).pri«, »ime (2).pri« ... ?"
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Brez spremembe;VELIKE ČRKE;male črke;Prva črka je velika;Prva Črka Vsake Besede Je Velika;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr "Opozorilo, imena so podvojena!"
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr "Datoteka vsebuje napačno število vrstic; zaznana vrednost je %d, pričakovana pa %d!"
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr "ohrani;počisti;vprašaj"
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr "Ni ustreznega notranjega ukaza"
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr "Ni še začetega okna »iskanja datotek« ..."
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr "Ni še drugih oken »iskanja datotek« za zapiranje in sproščanje pomnilnika ..."
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Preklicano"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Izračunavanje nadzorne vsote"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Izračunavanje nadzorne vsote v »%s«"
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "Izračunavanje nadzorne vsote »%s«"
#: ulng.rsopercalculatingstatictics
msgid "Calculating"
msgstr "Preračunavanje"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Preračunavanje »%s«"
#: ulng.rsopercombining
msgid "Joining"
msgstr "Združevanje"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Združevanje datotek iz »%s« v »%s«"
#: ulng.rsopercopying
msgid "Copying"
msgstr "Kopiranje"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Kopiranje iz »%s« v »%s«"
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Kopiranje »%s« v »%s«"
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Ustvarjanje mape"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Ustvarjanje mape »%s«"
#: ulng.rsoperdeleting
msgid "Deleting"
msgstr "Brisanje"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Brisanje v »%s«"
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Brisanje »%s«"
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Izvajanje"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Izvajanje »%s«"
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Poteka odpakiranje"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Odpakitanje iz »%s« v »%s«"
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Končano"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Izpisovanje"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Izpisovanje seznama »%s«"
#: ulng.rsopermoving
msgid "Moving"
msgstr "Premikanje"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Premikanje iz »%s« v »%s«"
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Premikanje »%s« v »%s«"
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Ni začeto"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Pakiranje"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Pakiranje iz »%s« v »%s«"
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Pakiranje »%s« v »%s«"
#: ulng.rsoperpaused
msgid "Paused"
msgstr "V premoru"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "V premoru"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Zagnano"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Nastavljanje lastnosti"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Nastavljanje lastnosti v »%s«"
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Nastavljanje lastnosti »%s«"
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Razdeljevanje"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Razdeljevanje »%s« v »%s«"
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Začenjanje"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Zaustavljeno"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Zaustavljanje"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Preizkušanje"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Preizkušanje v »%s«"
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Preizkušanje »%s«"
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Preverjanje nadzorne vsote"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Preverjanje nadzorne vsote »%s«"
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "Preverjanje nadzorne vsote »%s«"
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Čakanje na dostop do vira datoteke."
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Čakanje na odziv uporabnika"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Neobnovljivo brisanje"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Neobnovljivo brisanje v »%s«"
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Neobnovljivo brisanje »%s«"
#: ulng.rsoperworking
msgid "Working"
msgstr "Izvajanje opravila"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "dodaj na &začetek;dodaj na konec;pametno dodajanje"
#: ulng.rsoptarchivedelete
msgid "Delete:"
msgstr "Izbriši:"
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Odpakiraj brez navedbe poti:"
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr "Način razčlenjevanja oblike:"
#: ulng.rsoptarchiveid
msgid "ID:"
msgstr "ID:"
#: ulng.rsoptarchiveidpos
msgid "ID Position:"
msgstr "Položaj ID:"
#: ulng.rsoptarchiveidseekrange
msgid "ID Seek Range:"
msgstr "ID obsega iskanja:"
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr "Parameter"
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr "Niz poizvedbe gesla:"
#: ulng.rsoptarchiveselfextract
msgid "Create self extracting archive:"
msgstr "Ustvari arhiv za samodejno odpakiranje:"
#: ulng.rsoptarchivetest
msgid "Test:"
msgstr "Preizkus:"
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Ime vrste arhiva:"
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Vrednost"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Vzpostavi programsko vez vstavka »%s« z:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "prvega stolpca;zadnjega stolpca;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "običajno, privzet način;abecedno (razdelek »Jezik« je vedno na vrhu)"
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Dejavno okno na levi, nedejavno na desni (opuščeno);Levo okno na levi, desno na desni"
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Onemogoči"
#: ulng.rsoptenable
msgid "Enable"
msgstr "Omogoči"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Vnos pripone"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "dodaj na začetek;dodaj na konec;abecedno razvrščanje"
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "ločenem oknu;skrčenem ločenem oknu;oknu opravil"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "plavajoče;B;K;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Bližnjica %s za ukaz cm_Delete bo vpisana, zato jo bo mogoče uporabiti za povrnitev te nastavitve."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Dodaj hitro tipko za %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Dodaj bližnjico"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Ni mogoče nastaviti tipkovne bližnjice"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Spremeni tipkovno bližnjico"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Ukaz"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Tipkovna bližnjica %s za ukaz cm_Delete ima določen parametre, ki prekliče nastavitev. Ali želite spremeniti ta parameter za uporabo splošnih nastavitev?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Tipkovna bližnjica %s za cm_Delete mora imeti parameter spremenjen tako, da ustreza tipkovni bližnjici %s. Ali jo želite spremeniti?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Opis"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Uredi hitro tipko za %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Popravi parameter"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Hitra tipka"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Hitre tipke"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<brez>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parametri"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Dodaj bližnjico za brisanje datotek"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Za povezavo te možnosti s tipkovno bližnjico %s mora biti ta določena za cm_Delete, vendar je povezana z možnostjo %s. Ali jo želite spremeniti."
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Tipkovna bližnjica %s za cm_Delete je tipkovna bližnjica zaporedja ukazov za katerega obratnega ukaza ni mogoče določiti. Nastavitev najverjetneje ne bo delovala."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Tipkovna bližnjica v uporabi"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "Tipkovna bližnjica %s je že v uporabi."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Ali naj se zamenja v %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "uporabljeno za %s v %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "uporabljeno za ta ukaz, vendar z drugačnimi parametri"
#: ulng.rsoptionseditorarchivers
msgid "Archivers"
msgstr "Pakirniki"
#: ulng.rsoptionseditorautorefresh
msgid "Auto refresh"
msgstr "Samodejno osveževanje"
#: ulng.rsoptionseditorbehavior
msgid "Behaviors"
msgstr "Obnašanje"
#: ulng.rsoptionseditorbriefview
msgid "Brief"
msgstr "Datotečni pogled"
#: ulng.rsoptionseditorcolors
msgid "Colors"
msgstr "Barve"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Stolpci"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Nastavitve"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Stolpci po meri"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Seznam hitrih map"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Povleci in spusti"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Gumb seznama pogonov"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Priljubljeni zavihki"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Dodatne programske &vezi"
#: ulng.rsoptionseditorfileassoc
msgid "File associations"
msgstr "Programske vezi"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Novo"
#: ulng.rsoptionseditorfileoperations
msgid "File operations"
msgstr "Datotečna opravila"
#: ulng.rsoptionseditorfilepanels
msgid "File panels"
msgstr "Okna datotek"
#: ulng.rsoptionseditorfilesearch
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Iskanje datotek"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Pogled datotek"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Vrste datotek"
#: ulng.rsoptionseditorfoldertabs
msgid "Folder tabs"
msgstr "Zavihki map"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Zavihki map"
#: ulng.rsoptionseditorfonts
msgid "Fonts"
msgstr "Pisave"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Poudarjalniki"
#: ulng.rsoptionseditorhotkeys
msgid "Hot keys"
msgstr "Hitre tipke"
#: ulng.rsoptionseditoricons
msgid "Icons"
msgstr "Ikone"
#: ulng.rsoptionseditorignorelist
msgid "Ignore list"
msgstr "Seznam prezrtih datotek in map"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Tipke"
#: ulng.rsoptionseditorlanguage
msgid "Language"
msgstr "Jezik"
#: ulng.rsoptionseditorlayout
msgid "Layout"
msgstr "Razporeditev"
#: ulng.rsoptionseditorlog
msgid "Log"
msgstr "Dnevniki"
#: ulng.rsoptionseditormiscellaneous
msgid "Miscellaneous"
msgstr "Različne možnosti"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Miška"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
"Spremenjene so možnosti »%s«\n"
"\n"
"Ali želite shraniti spremembe?\n"
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Vstavki"
#: ulng.rsoptionseditorquicksearch
msgid "Quick search/filter"
msgstr "Hitro iskanje/Filtriranje"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Orodna vrstica"
#: ulng.rsoptionseditortools
msgid "Tools"
msgstr "Orodja"
#: ulng.rsoptionseditortooltips
msgid "Tooltips"
msgstr "Orodni namigi"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Meni drevesnega pogleda"
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr "Barve menija drevesnega pogleda"
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Brez;Ukazna vrstica;Hitro iskanje;Hitri filter"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "z desnim gumbom;z levim gumbom;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "na vrhu seznama datotek;za mapami (če so mape razvrščene pred datotekami);na mestu razvrščanja;na dnu seznama datotek"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Vstavek %s je že vezan na naslednje pripone datotek:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Dejavno"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Ime datoteke"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Ime"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Vpisano za"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&občutljivo;&neobčutljivo"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Datoteke;&Mape;Datoteke &in Mape"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "&Skrij okno filtra, kadar ni v žarišču;Nadaljuj s shranjevanjem sprememb za naslednjo sejo"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "ne upošteva velikosti črk;upošteva glede na jezikovno nastavitev sistema (aAbBcC);najprej velike, nato male črke (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "razvrsti po imenu in najprej pokaži; razvrsti kot datoteke in najprej pokaži; razvrsti kot datoteke"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "abecedno, upoštevajoč znakovne naglase;naravno, številčno in abecedno"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "zgoraj;spodaj;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "&Ločilnik;&Notranji ukaz;&Zunanji ukaz;&Meni"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "opuščen slog DC Kopija (x) ime_datoteke.pri;slog Windows ime datoteke (x).pri;skrčen slog ime_datoteke(x).pri"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "ne spremeni mesta;uporabi enake nastavitve kot za nove datoteke;na razvrščeno mesto"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Datoteke: %d; Mape: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Ni mogoče spremeniti dovoljenj dostopa za »%s«"
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Lastnika »%s« ni mogoče spremeniti."
#: ulng.rspropsfile
msgid "File"
msgstr "Datoteka"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Mapa"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Imenovan cevovod"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Vtič"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Posebna bločna naprava"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Posebna znakovna naprava"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Simbolna povezava"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "neznana vrsta"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Rezultati iskanja"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "Iskanje"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<neimenovana predloga>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Iskanje datotek z uporabo vstavka DSX je že v teku.\n"
"Pred začetkom novega iskanja z vstavkom mora biti predhodno končano.\n"
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Iskanje datotek z uporabo vstavka WDX je že v teku.\n"
"Pred začetkom novega iskanja z vstavkom mora biti predhodno končano.\n"
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Izbor mape"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr "Izbor okna"
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "&Pokaži pomoč za %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Vse"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Kategorija"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Stolpec"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Ukaz"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Ime datoteke"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "datoteke"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr "Pismo"
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Parametri"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Rezultat"
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "Delovna mapa"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bajti"
#: ulng.rssizeunitgbytes
msgid "Gigabytes"
msgstr "Gigabajti"
#: ulng.rssizeunitkbytes
msgid "Kilobytes"
msgstr "Kilobajti"
#: ulng.rssizeunitmbytes
msgid "Megabytes"
msgstr "Megabajti"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabajti"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Datoteke: %d, Mape: %d, Velikost: %s (%s bajtov)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Ciljne mape ni mogoče ustvariti!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Nepravilen zapis velikosti datoteke!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Ni mogoče razdeliti datoteke!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Število delov presega vrednost 100! Ali naj se opravilo vseeno izvede?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr "Samodejno;1457664B 3.5\" Visoke gostote 1.44M;1213952B 5.25\" Visoke gostote 1.2M;730112B 3.5\" Dvojne gostote 720K;362496B 5.25\" Dvojne gostote 360K;98078KB ZIP 100MB;650MB CD 650MB;700MB CD 700MB;4482MB - DVD+R"
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Izbor mape:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr "Le predogled"
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr "Ostalo"
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr "OU"
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr "Opomba:"
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr "Ploski"
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr "Omejeno"
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr "Enostavno"
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr "Izjemen"
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr "Čudovit"
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr "Velikanski"
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr "Izbor mape iz zgodovine obiskanih map"
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr "Izbor priljubljenih zavihkov:"
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr "Izbor ukaza iz zgodovine uporabljenih ukazov"
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr "Izbor dejanj iz glavnega menija"
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr "Izbor dejanj iz glavne orodne vrstice"
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr "Izbor mape izmed vročih map"
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr "Izbor mape iz zgodovine datotečnega pogleda"
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr "Izbor datoteke ali mape"
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Napaka med ustvarjanjem simbolne povezave."
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr "Privzeto besedilo"
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr "Golo besedilo"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "ne naredi ničesar;zapri zavihek;dostopi do priljubljenih zavihkov;pokaži pojavni meni zavihkov"
#: ulng.rstimeunitday
msgid "Day(s)"
msgstr "dni"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "ure"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "minute"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "meseci"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "sekunde"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "tedni"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "leta"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Preimenuj priljubljene zavihke"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Preimenuj priljubljene zavihke"
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Primerjalnik"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Urejevalnik"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Napaka med odpiranjem primerjalnika"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Napaka odpiranja urejevalnika"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Napaka odpiranja terminala"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Napaka odpiranja pregledovalnika"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Pregledovalnik"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Pošljite poročilo napake s podrobnim opisom in datoteko: %s. Pritisnite %s za nadaljevanje ali pa %s za končanje programa."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "Obe okni, od dejavne proti nedejavni"
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "Obe okni, z leve proti desni"
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Pot okna"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "Z oklepajem označite vsako ime, ki ga želite"
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Le ime datoteke brez pripone"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "Polno ime datoteke (pot in ime)"
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr "Pomoč z uporabo spremenljivk »%«"
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr "Zahteva od uporabnika vpis parametra s predlagano privzeto vrednostjo"
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Levo okno"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "Začasno ime datoteke seznama imen datotek"
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "Začasno ime datoteke popolnega seznama imen datotek (pot in ime datoteke)"
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr "Imena datotek v seznamu v UTF16 z BOM"
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr "Imena datotek v seznamu v UTF16 z BOM znotraj dvojnih narekovajev"
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr "Imena datotek v seznamu v UTF8 "
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr "Imena datotek v seznamu v UTF8 z BOM znotraj dvojnih narekovajev"
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "Začasno ime datoteke seznama imen datotek z relativno potjo"
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Le pripona datoteke"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Le ime datoteke"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Drug primer možnosti"
#: ulng.rsvarpath
#| msgid "Path, with ending delimiter"
msgid "Path, without ending delimiter"
msgstr "Pot brez končnega ločilnika"
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr "Od kazalke do konca vrstice je določilnik spremenljivke odstotka znak »#«"
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr "Vrne znak za odstotek"
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr "Od kazalke do konca vrstice je določilnik spremenljivke odstotka spet znak »%«"
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "Dodaj predpono »-a« vsakemu imenu oziroma karkoli drugega"
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "%[Zahtevaj uporabniške parametre;Predlagaj privzete vrednosti]"
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "Ime datoteke z relativno potjo"
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Desno okno"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "Polna pot druge izbrane datoteke v desnem oknu"
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "Pokaži ukaz pred izvedbo"
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "%[Enostavno sporočilo]"
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "Prikazano bo enostavno sporočilo"
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Dejavno okno (vir)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Nedejavno okno (cilj)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr "Imena datotek bodo navedena od tu (privzeto)"
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "Ukazi bodo izvršeni v terminalu, ki bo po izvajanju ostal odprt"
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr "Poti bodo zapisane s končnim ločilnikom (privzeto)"
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "Imena datotek ne bodo navedena od tu"
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "Ukazi bodo izvršeni v terminalu, ki bo po izvajanju končan"
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr "Poti bodo zapisane brez končnega ločilnika (privzeto)"
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Omrežje"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Pregledovalnik programa Double Commander."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Slaba kakovost"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Nabor znakov"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Vrsta slike"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Nova velikost"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s ni mogoče najti!"
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "z zunanjim pregledovalnikom"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "z notranjim pregledovalnikom"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Število zamenjav: %d"
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "Zamenjava ni bila izvršena."