doublecmd/language/doublecmd.be.po
2018-11-21 17:07:49 +00:00

12652 lines
383 KiB
Text
Raw Blame History

This file contains ambiguous Unicode characters

This file contains Unicode characters that might be confused with other characters. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.8.0 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: YEAR-MO-DA HO:MI+ZONE\n"
"Last-Translator: Full Name <zmicerturok@gmail.com>\n"
"Language-Team: Language <zmicerturok@gmail.com>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Беларуская\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Параўнанне... ‰d%% (ESC каб скасаваць)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Права: выдаліць %d файл(аў)"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Знойдзена файлаў: %d (Аднолькавых: %d, Розных: %d, Унікальных злева: %d, Унікальных зправа: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Злева ўправа: Капіруецца %d файлаў, агульны памер: %d байтаў"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Зправа ўлева: Капіруецца %d файлаў , агульны памер: %d байтаў"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Абраць шаблон..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "&Праверыць на волнае месца"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "&Скапіраваць атрыбуты"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Скапіраваць ул&адальнікаў"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Скапіраваць &правы на доступ"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Скапіраваць &дату/час"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Выправіць спа&сылкі"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgid "Drop readonly fla&g"
msgstr "Прыбраць п&азнаку \"толькі для чытання\""
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Вы&ключыць пустыя каталогі"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "&Выкарыcтоўваць спасылкі"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "&Рэзерваваць прастору"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr "&Праверыць"
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Што рабіць калі не атрымоўваецца задаць час, атрыбуты і т.п."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Выкарыстоўваць шаблоны файлаў"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Калі &каталог існуе"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgid "When &file exists"
msgstr "Калі &файл існуе"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Калі немаг&чыма задаць уласцівасць"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<няма шаблона>"
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Капіраваць у буфер абмену"
#: tfrmabout.caption
msgctxt "tfrmabout.caption"
msgid "About"
msgstr "Пра праграму"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Зборка"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Хатняя старонка:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "tfrmabout.lblrevision.caption"
msgid "Revision"
msgstr "Рэвізія"
#: tfrmabout.lbltitle.caption
msgctxt "tfrmabout.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Версія"
#: tfrmattributesedit.btncancel.caption
msgctxt "tfrmattributesedit.btncancel.caption"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmattributesedit.btnok.caption
msgctxt "tfrmattributesedit.btnok.caption"
msgid "&OK"
msgstr "&Добра"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Скінуць"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Абраць атрыбуты"
#: tfrmattributesedit.cbarchive.caption
msgid "&Archive"
msgstr "&Архіў"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Сці&снуты"
#: tfrmattributesedit.cbdirectory.caption
msgid "&Directory"
msgstr "&Каталог"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "&Зашыфраваны"
#: tfrmattributesedit.cbhidden.caption
msgid "&Hidden"
msgstr "&Схаваны"
#: tfrmattributesedit.cbreadonly.caption
msgid "Read o&nly"
msgstr "&Толькі для чытання"
#: tfrmattributesedit.cbsgid.caption
msgctxt "tfrmattributesedit.cbsgid.caption"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "&Рэдкі"
#: tfrmattributesedit.cbsticky.caption
msgctxt "tfrmattributesedit.cbsticky.caption"
msgid "Sticky"
msgstr "Мацуючы"
#: tfrmattributesedit.cbsuid.caption
msgctxt "tfrmattributesedit.cbsuid.caption"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Спасылка"
#: tfrmattributesedit.cbsystem.caption
msgid "S&ystem"
msgstr "Сі&стэмны"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Часовы"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Атрыбуты NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Асноўныя атрыбуты"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "tfrmattributesedit.lblattrbitsstr.caption"
msgid "Bits:"
msgstr "Біты:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "tfrmattributesedit.lblattrgroupstr.caption"
msgid "Group"
msgstr "Група"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "tfrmattributesedit.lblattrotherstr.caption"
msgid "Other"
msgstr "Іншае"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "tfrmattributesedit.lblattrownerstr.caption"
msgid "Owner"
msgstr "Уладальнік"
#: tfrmattributesedit.lblexec.caption
msgctxt "tfrmattributesedit.lblexec.caption"
msgid "Execute"
msgstr "Выкананне"
#: tfrmattributesedit.lblread.caption
msgctxt "tfrmattributesedit.lblread.caption"
msgid "Read"
msgstr "Чытанне"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Як тэ&кст:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "tfrmattributesedit.lblwrite.caption"
msgid "Write"
msgstr "Запісаць"
#: tfrmbenchmark.caption
msgid "Benchmark"
msgstr ""
#: tfrmbenchmark.lblbenchmarksize.caption
msgid "Benchmark data size: %d MB"
msgstr ""
#: tfrmbenchmark.stgresult.columns[0].title.caption
msgid "Hash"
msgstr ""
#: tfrmbenchmark.stgresult.columns[1].title.caption
msgid "Time (ms)"
msgstr ""
#: tfrmbenchmark.stgresult.columns[2].title.caption
msgid "Speed (MB/s)"
msgstr ""
#: tfrmchecksumcalc.caption
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Падлік кантрольнай сумы..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Адкрыць файл кантрольнай сумы пасля завяршэння"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "С&твараць асобны файл кантрольнай сумы для кожнага файла"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "&Захаваць файл(ы) кантрольнай сумы ў:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmchecksumverify.caption
msgctxt "tfrmchecksumverify.caption"
msgid "Verify checksum..."
msgstr "Прверыць кантрольную суму..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "tfrmconnectionmanager.btnadd.caption"
msgid "A&dd"
msgstr "&Дадаць"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "З&лучыцца"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "tfrmconnectionmanager.btndelete.caption"
msgid "&Delete"
msgstr "&Выдаліць"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "tfrmconnectionmanager.btnedit.caption"
msgid "&Edit"
msgstr "&Рэдагаваць"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Кіраўнік злучэння"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Злучыцца з:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "&Дадаць у чаргу"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "&Параметры"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "З&ахаваць гэтыя параметры як прадвызначаныя"
#: tfrmcopydlg.caption
msgctxt "tfrmcopydlg.caption"
msgid "Copy file(s)"
msgstr "Капіраваць файл(ы)"
#: tfrmcopydlg.mnunewqueue.caption
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Новая чарга"
#: tfrmcopydlg.mnuqueue1.caption
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Чарга 1"
#: tfrmcopydlg.mnuqueue2.caption
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Чарга 2"
#: tfrmcopydlg.mnuqueue3.caption
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Чарга 3"
#: tfrmcopydlg.mnuqueue4.caption
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Чарга 4"
#: tfrmcopydlg.mnuqueue5.caption
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Чарга 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Захаваць апісанне"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Каментар да файла/каталога"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "Рэдагаваць каментар да:"
#: tfrmdescredit.lblencoding.caption
msgid "&Encoding:"
msgstr "&Кадаванне:"
#: tfrmdescredit.lblfilename.caption
msgctxt "tfrmdescredit.lblfilename.caption"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "Пра праграму"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Аўтаматычнае параўнанне"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Двайковы рэжым"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "tfrmdiffer.actcancelcompare.caption"
msgid "Cancel"
msgstr "Скасаваць"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Скасаваць"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "tfrmdiffer.actcopylefttoright.caption"
msgid "Copy Block Right"
msgstr "Скапіраваць блок управа"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Скапіраваць блок управа"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "tfrmdiffer.actcopyrighttoleft.caption"
msgid "Copy Block Left"
msgstr "Скапіраваць блок улева"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Скапіраваць блок улева"
#: tfrmdiffer.acteditcopy.caption
msgctxt "tfrmdiffer.acteditcopy.caption"
msgid "Copy"
msgstr "Капіраваць"
#: tfrmdiffer.acteditcut.caption
msgctxt "tfrmdiffer.acteditcut.caption"
msgid "Cut"
msgstr "Выразаць"
#: tfrmdiffer.acteditdelete.caption
msgctxt "tfrmdiffer.acteditdelete.caption"
msgid "Delete"
msgstr "Выдаліць"
#: tfrmdiffer.acteditpaste.caption
msgctxt "tfrmdiffer.acteditpaste.caption"
msgid "Paste"
msgstr "Уставіць"
#: tfrmdiffer.acteditredo.caption
msgctxt "tfrmdiffer.acteditredo.caption"
msgid "Redo"
msgstr "Паўтарыць"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Абраць &усё"
#: tfrmdiffer.acteditundo.caption
msgctxt "tfrmdiffer.acteditundo.caption"
msgid "Undo"
msgstr "Адвярнуць"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "&Выйсці"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Першае адрозненне"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Першае адрозненне"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Не зважаць на рэгістр"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Не зважаць на прагалы"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Сінхронная пракрутка"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Апошняе адрозненне"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Апошняе адрозненне"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Адрозненне радкоў"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Наступнае адрозненне"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Наступнае адрозненне"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Адкрыць злева..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Адкрыць зправа..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Заліўка фону"
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Папярэдняе адрозненне"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Папярэдняе адрозненне"
#: tfrmdiffer.actreload.caption
msgid "&Reload"
msgstr "&Перазагрузіць"
#: tfrmdiffer.actreload.hint
msgctxt "tfrmdiffer.actreload.hint"
msgid "Reload"
msgstr "Перазагрузіць"
#: tfrmdiffer.actsave.caption
msgctxt "tfrmdiffer.actsave.caption"
msgid "Save"
msgstr "Захаваць"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Захаваць"
#: tfrmdiffer.actsaveas.caption
msgctxt "tfrmdiffer.actsaveas.caption"
msgid "Save as..."
msgstr "Захаваць як..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Захаваць як..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "tfrmdiffer.actsaveleft.caption"
msgid "Save Left"
msgstr "Захаваць злева"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Захаваць злева"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "tfrmdiffer.actsaveleftas.caption"
msgid "Save Left As..."
msgstr "Захаваць злева як..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Захаваць злева як..."
#: tfrmdiffer.actsaveright.caption
msgctxt "tfrmdiffer.actsaveright.caption"
msgid "Save Right"
msgstr "Захаваць зправа"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Захаваць зправа"
#: tfrmdiffer.actsaverightas.caption
msgctxt "tfrmdiffer.actsaverightas.caption"
msgid "Save Right As..."
msgstr "Захаваць зправа як..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Захаваць зправа як..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "tfrmdiffer.actstartcompare.caption"
msgid "Compare"
msgstr "Параўнаць"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Параўнаць"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "tfrmdiffer.btnleftencoding.hint"
msgid "Encoding"
msgstr "Кадаванне"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Кадаванне"
#: tfrmdiffer.caption
msgid "Compare files"
msgstr "Параўнаць файлы"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "tfrmdiffer.midivider7.caption"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "З&лева"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "З&права"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Дзеянні"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Рэдагаваць"
#: tfrmdiffer.mnuencoding.caption
msgctxt "tfrmdiffer.mnuencoding.caption"
msgid "En&coding"
msgstr "&Кадаванне"
#: tfrmdiffer.mnufile.caption
msgctxt "tfrmdiffer.mnufile.caption"
msgid "&File"
msgstr "&Файл"
#: tfrmdiffer.mnuoptions.caption
msgid "&Options"
msgstr "&Параметры"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Дадаць новае спалучэнне ў паслядоўнасць"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Выдаліць апошняе спалучэнне з паслядоўнасці"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr "Абраць спалучэнне са спіса апошніх застаўшыхся клавіш"
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr "Толькі для гэтых элементаў кіравання"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Параметры (кожны ў асобным радку):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Спалучэнні клавіш:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "Пра праграму"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "Пра праграму"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Канфігурацыя"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Канфігурацыя"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Капіраваць"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Капіраваць"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Выразаць"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Выразаць"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Выдаліць"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Выдаліць"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Шукаць"
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Шукаць"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Шукаць наступнае"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Шукаць наступнае"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Шукаць папярэдняе"
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr "Перайсці да радка..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Уставіць"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Уставіць"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Паўтарыць"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Паўтарыць"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Замяніць"
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Замяніць"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Абраць &усё"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Абраць усё"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Адвярнуць"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Адвярнуць"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Закрыць"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Выйсці"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Выйсці"
#: tfrmeditor.actfilenew.caption
msgid "&New"
msgstr "&Новы"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Новы"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Адкрыць"
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Адкрыць"
#: tfrmeditor.actfilereload.caption
msgctxt "tfrmeditor.actfilereload.caption"
msgid "Reload"
msgstr "Перазагрузіць"
#: tfrmeditor.actfilesave.caption
msgctxt "tfrmeditor.actfilesave.caption"
msgid "&Save"
msgstr "&Захаваць"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Захаваць"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Захаваць &як..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Захаваць як"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Захаваць& усё"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Захаваць усё"
#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr "Рэдактар"
#: tfrmeditor.help1.caption
msgctxt "tfrmeditor.help1.caption"
msgid "&Help"
msgstr "&Даведка"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Рэдагаваць"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Када&ванне"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Адкрыць як"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Захаваць як"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Файл"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Падсвятленне сінтаксісу"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Канец радка"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.CANCELBUTTON.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgid "C&ase sensitivity"
msgstr "&Улічваць рэгістр"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgid "S&earch from caret"
msgstr "Шу&каць ад курсора"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgid "&Regular expressions"
msgstr "&Рэгулярны выраз"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgid "Selected &text only"
msgstr "Толькі ў &вылучаным тэксце"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgid "&Whole words only"
msgstr "&Толькі цэлыя словы"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgid "Option"
msgstr "Параметры"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgid "&Replace with:"
msgstr "&Замяніць:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgid "&Search for:"
msgstr "&Шукаць для:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgid "Direction"
msgstr "Напрамак"
#: tfrmextractdlg.caption
msgid "Unpack files"
msgstr "Распакаваць файлы"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Распакаваць з падкаталогамі"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Распакаваць кожны архіў у а&собны падкаталог (з назвай архіва)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "Пе&разапісаць існуючыя файлы"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "У ката&лог:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "&Распакаваць файлы згодна з файлавай маскай:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "&Пароль для зашыфраваных файлаў:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmfileexecuteyourself.caption
msgid "Wait..."
msgstr "Пачакайце..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Назва файла:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "tfrmfileexecuteyourself.lblfrompath.caption"
msgid "From:"
msgstr "З:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Пстрыкніце па \"Закрыць\" калі часовы файл можа быць выдалены!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&На панэль"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Праглядзець усё"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Бягучая аперацыя:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "З:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "У:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "&Задаць уласцівасці"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Задаць для ўс&іх абраных файлаў"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Пра&мінуць гэты файл"
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr "Уласцівасці"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Мацуючы"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr "Дазволіць &запускаць як праграму"
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Уладальнік"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Біты:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Група"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Іншае"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Уладальнік"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "tfrmfileproperties.lblattrtext.caption"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
msgid "Text:"
msgstr "Тэкст:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Змяшчае:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Выкананне"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr "Запуск:"
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Назва файла"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "tfrmfileproperties.lblfilestr.caption"
msgid "File name"
msgstr "Назва файла"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Шлях:"
#: tfrmfileproperties.lblgroupstr.caption
msgid "&Group"
msgstr "&Група"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Апошні доступ:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Апошняя змена:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Апошняя змена:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "tfrmfileproperties.lbloctal.caption"
msgid "Octal:"
msgstr "Васьмярковы:"
#: tfrmfileproperties.lblownerstr.caption
msgid "O&wner"
msgstr "&Уладальнік"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Чытанне"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "tfrmfileproperties.lblsizestr.caption"
msgid "Size:"
msgstr "Памер:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Спасылка:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Тып:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Запісаць"
#: tfrmfileproperties.sgimage.columns[0].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Назва"
#: tfrmfileproperties.sgimage.columns[1].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Значэнне"
#: tfrmfileproperties.tsattributes.caption
msgctxt "tfrmfileproperties.tsattributes.caption"
msgid "Attributes"
msgstr "Атрыбуты"
#: tfrmfileproperties.tsplugins.caption
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Убудовы"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Уласцівасці"
#: tfrmfileunlock.btnclose.caption
#, fuzzy
msgctxt "tfrmfileunlock.btnclose.caption"
msgid "Close"
msgstr "Закрыць"
#: tfrmfileunlock.btnterminate.caption
msgid "Terminate"
msgstr ""
#: tfrmfileunlock.btnunlock.caption
msgctxt "tfrmfileunlock.btnunlock.caption"
msgid "Unlock"
msgstr ""
#: tfrmfileunlock.btnunlockall.caption
msgid "Unlock All"
msgstr ""
#: tfrmfileunlock.caption
msgctxt "tfrmfileunlock.caption"
msgid "Unlock"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[0].title.caption
msgid "File Handle"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[1].title.caption
msgid "Process ID"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[2].title.caption
msgid "Executable Path"
msgstr ""
#: tfrmfinddlg.actcancel.caption
msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION"
msgid "C&ancel"
msgstr "&Скасаваць"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "Скасаваць і закрыць акно"
#: tfrmfinddlg.actclose.caption
msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "TFRMFINDDLG.ACTCONFIGFILESEARCHHOTKEYS.CAPTION"
msgid "Configuration of hot keys"
msgstr "Наладзіць гарачыя клавішы"
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Рэдагаваць"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "Файлы для &панэлі"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr "Скасаваць пошук і закрыць акно"
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr "Скасаваць і закрыць усе іншыя вокны \"Пошук файлаў\""
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Перайсці да файла"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION"
msgid "Find Data"
msgstr "Шукаць даныя"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Апошні пошук"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Новы пошук"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr "Новы пошук (ачысціць фільтры)"
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Перайсці да ўкладкі \"Пашыраны\""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Перайсці да ўкладкі \"Загрузіць/Захаваць\""
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr "Перайсці да &наступнай укладкі"
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Перайсці да ўкладкі \"Убудовы\""
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr "Перайсці да &папярэдняй укладкі"
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Перайсці да ўкладкі \"Вынікі\""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Перайсці да ўкладкі \"Стандартны\""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Пачаць"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Праглядзець"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Дадаць"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Даведка"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Захаваць"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Выдаліць"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "&Загрузіць"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "&Захаваць"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Захав&аць з \"Запускаць у каталозе\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Пры націсканні захоўваецца значэнне \"Запускаць у каталозе\". Выкарыстоўвайце, калі хочаце пачынаць пошук з пэўнага каталога"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Выкарыстоўваць шаблон"
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Пошук файлаў"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Улічваць &рэгістр"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "Пачынаючы з &даты:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Па да&ту:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "Па&мер ад:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Па&мер да:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "Шукаць у ар&хівах"
#: tfrmfinddlg.cbfindtext.caption
msgid "Find &text in file"
msgstr "Шукаць &тэкст у файле"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgid "Follow s&ymlinks"
msgstr "Карыстацца сп&асылкамі"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgid "Find files N&OT containing the text"
msgstr "Шукаць файлы б&ез тэксту"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Не& старэйшыя за:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "У адкрытых укладках"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Шука&ць частку назвы"
#: tfrmfinddlg.cbregexp.caption
msgid "&Regular expression"
msgstr "&Рэгулярны выраз"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "За&мяніць на"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Абраныя каталогі і &файлы"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "Рэгулярны &выраз"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "&Час ад:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "&Час да:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "&Выкарыстоўваць убудову пошуку:"
#: tfrmfinddlg.chkhex.caption
msgid "Hexadecimal"
msgstr ""
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Увядзіце назвы каталогаў, якія патрэбна выключыць з пошуку. Назвы патрэбна аддзяляць \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Увядзіце назвы файлаў, якія патрэбна выключыць з пошуку. Назвы патрэбна аддзяляць \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Увядзіце назвы файлаў, аддзеленыя \";\""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Каталогі"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Файлы"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Шукаць даныя"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Атр&ыбуты"
#: tfrmfinddlg.lblencoding.caption
msgid "Encodin&g:"
msgstr "Кадава&нне:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "Вы&ключыць падкаталогі"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "&Выключыць файлы"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "&Файлавая маска"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Запускаць у &каталозе"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Шукаць пад&каталогі:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Папярэднія пошукі:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr "&Дзеянне"
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr "Спыніць і закрыць іншыя вокны"
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Адкрыць у новай укладцы(ках)"
#: tfrmfinddlg.mioptions.caption
msgctxt "TFRMFINDDLG.MIOPTIONS.CAPTION"
msgid "Options"
msgstr "Параметры"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Выдаліць са спіса"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr "&Вынік"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Паказаць усе элементы"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Паказаць у рэдактары"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Паказаць у праграме прагляду"
#: tfrmfinddlg.miviewtab.caption
msgctxt "TFRMFINDDLG.MIVIEWTAB.CAPTION"
msgid "&View"
msgstr "&Праглядзець"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Налады"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Загрузіць/Захаваць"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Убудовы"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Вынікі"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Стандартны"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Шукаць"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Шукаць"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "У&лічваць рэгістр"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Стварыць жорсткую спасылку"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "tfrmhardlink.lblexistingfile.caption"
msgid "&Destination that the link will point to"
msgstr "&На што паказвае спасылка"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "tfrmhardlink.lbllinktocreate.caption"
msgid "&Link name"
msgstr "Назва с&пасылкі"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr "Імпартаваць усе!"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr "Імпартаваць абранае"
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr "Абраць радок для імпарту"
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Калі пстрыкнуць па падменю, абярэцца ўсё падменю"
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Утрымліваючы CTRL можна абраць адразу некалькі запісаў"
#: tfrmlinker.btnsave.caption
msgctxt "tfrmlinker.btnsave.caption"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgid "Linker"
msgstr "Зборка"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Захаваць у..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Элемент"
#: tfrmlinker.lblfilename.caption
msgid "&File name"
msgstr "&Назва файла"
#: tfrmlinker.spbtndown.caption
msgctxt "tfrmlinker.spbtndown.caption"
msgid "Do&wn"
msgstr "&Уніз"
#: tfrmlinker.spbtndown.hint
msgid "Down"
msgstr "Уніз"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "&Выдаліць"
#: tfrmlinker.spbtnrem.hint
msgctxt "TFRMLINKER.SPBTNREM.HINT"
msgid "Delete"
msgstr "Выдаліць"
#: tfrmlinker.spbtnup.caption
msgctxt "tfrmlinker.spbtnup.caption"
msgid "&Up"
msgstr "&Уверх"
#: tfrmlinker.spbtnup.hint
msgid "Up"
msgstr "Уверх"
#: tfrmmain.actabout.caption
msgid "&About"
msgstr "&Пра праграму"
#: tfrmmain.actactivatetabbyindex.caption
msgid "Activate Tab By Index"
msgstr ""
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Дадаць назву файла ў загадны радок"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr "Новы асобнік пошуку..."
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Дадаць шлях і назву файла ў загадны радок"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Скапіраваць шлях у загадны радок"
#: tfrmmain.actbenchmark.caption
msgid "&Benchmark"
msgstr ""
#: tfrmmain.actbriefview.caption
msgid "Brief view"
msgstr "Скарочаны выгляд"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Скарочаны выгляд"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Падлічыць &ужываемую прастору"
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Змяніць каталог"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Змяніць каталог на хатні"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Змяніць каталог на бацькоўскі"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Змяніць каталог на корань файлавай сістэмы"
#: tfrmmain.actchecksumcalc.caption
msgid "Calculate Check&sum..."
msgstr "Падлічыць кантрольную &суму..."
#: tfrmmain.actchecksumverify.caption
msgid "&Verify Checksum..."
msgstr "&Праверыць кантрольную суму..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Ачысціць лог"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Ачысціць акно лога"
#: tfrmmain.actclosealltabs.caption
msgid "Close &All Tabs"
msgstr "Закрыць &усе ўкладкі"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Закрыць дублікаты ўкладак"
#: tfrmmain.actclosetab.caption
msgid "&Close Tab"
msgstr "&Закрыць укладку"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Наступны загадны радок"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Абраць наступны загад з гісторыі"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Папярэдні загадны радок"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Абраць папярэдні загад з гісторыі"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Падрабязны"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Падрабязны выгляд"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Параўнаць па &змесціву"
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr "Параўнаць каталогі"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Параўнаць каталогі"
#: tfrmmain.actconfigarchivers.caption
msgid "Configuration of Archivers"
msgstr ""
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Налады спіса выбраных каталогаў"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Налады выбраных укладак"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Налады ўкладак каталогаў"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Наладзіць гарачыя клавішы"
#: tfrmmain.actconfigplugins.caption
msgid "Configuration of Plugins"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Захаваць налады"
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr "Наладка гарачых клавіш"
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Панэль прылад..."
#: tfrmmain.actconfigtooltips.caption
msgid "Configuration of tooltips"
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Наладка меню ў выглядзе дрэва"
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Наладка колераў меню ў выглядзе дрэва"
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Паказаць кантэкстнае меню"
#: tfrmmain.actcopy.caption
msgctxt "TFRMMAIN.ACTCOPY.CAPTION"
msgid "Copy"
msgstr "Капіраваць"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Капіраваць усе ўкладкі на супрацьлеглы бок"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Капіраваць усе адлюстроўваемыя &слупкі"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Капіраваць назву файла(ў) разам са шляхам"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Капіраваць &назву ў буфер абмену"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Капіраваць файлы без пацверджання"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr "Капіраваць поўны шлях абраных файлаў без канцавога падзяляльніка"
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Капіраваць поўны шлях да абраных файлаў"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Капіраваць на іншую панэль"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Капіраваць"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Па&казаць памер ужываемай прасторы"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "&Выразаць"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Паказаць параметры загаду"
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Выдаліць"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr "Спыніць і закрыць усе вокны"
#: tfrmmain.actdirhistory.caption
msgid "Directory history"
msgstr "Гісторыя каталогаў"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "&Спіс выбраных каталогаў"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Абраць загад і выканаць яго"
#: tfrmmain.actedit.caption
msgctxt "TFRMMAIN.ACTEDIT.CAPTION"
msgid "Edit"
msgstr "Рэдагаваць"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Рэдагаваць ка&ментар..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Рэдагаваць новы файл"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Рэдагаваць поле са шляхам па-над спісам файлаў"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Памяняць &панэлі"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr "Запусціць скрыпт"
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Выйсці"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "&Выняць файлы..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Налады файлавых &асацыяцый"
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "Аб'яд&наць файлы..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Паказаць уласцівасці &файла"
#: tfrmmain.actfilespliter.caption
msgid "Spl&it File..."
msgstr "Падзя&ліць файл..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "&Плоскі інтэрфейс"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Перайсці да загаднага радка"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr "Змяніць фокус"
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr "Пераключыцца на іншую файлавую панэль"
#: tfrmmain.actfocustreeview.caption
msgid "Focus on tree view"
msgstr ""
#: tfrmmain.actfocustreeview.hint
msgid "Switch between current file list and tree view (if enabled)"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Размясціць курсор на першым файле са спіса"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Размясціць курсор на апошнім файле са спіса"
#: tfrmmain.acthardlink.caption
msgid "Create &Hard Link..."
msgstr "Стварыць &жорсткую спасылку..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Змест"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "&Рэжым гарызантальных панэляў"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Клавіятура"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Скарочаны выгляд левай панэлі"
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Падрабязны выгляд левай панэлі"
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Левая &=Правая"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "&Плоскі выгляд левай панэлі"
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Адкрыць спіс дыскаў злева"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Ад&вярнуць парадак элементаў левай панэлі"
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Упарадкаваць элементы левай панэлі па &атрыбутах"
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Упарадкаваць элементы левай панэлі па &даце"
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "Упарадкаваць элементы левай панэлі па &пашырэнню"
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "Упарадкаваць элементы левай панэлі па &назве"
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Упарадкаваць элементы левай панэлі па &памеры"
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Прагляд мініяцюр у левай панэлі"
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "Загрузіць укладкі з выбраных"
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Загрузіць вылучэнне з &буфера абмену"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "&Загрузіць вылучэнне з файла..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "&Загрузіць укладкі з файла"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "Стварыць &каталог"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Абраць усе з гэтым пашырэннем"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr "Абраць усе з гэтай назвай"
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr "Абраць усе з гэтай назвай і пашырэннем"
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr "Абраць усе з гэтым шляхам"
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "&Адвярнуць"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "&Вылучыць усё"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "Зняць вылучэнне з &групы..."
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "Вылучыць &групу..."
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "&Зняць вылучэнне з усяго"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Згарнуць акно"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Прылада шматлікай змены назваў"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "&Злучыцца з сеткай..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "&Адлучыцца ад сеткі"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "&Новае злучэнне"
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Новая укладка"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr "Загрузіць наступныя выбраныя ўкладкі са спіса"
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Перайсці да нас&тупнай укладкі"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Адкрыць"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Паспрабаваць адкрыць архіў"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Адкрыць файл панэлі"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Адкрыць &каталог у новай укладцы"
#: tfrmmain.actopendrivebyindex.caption
msgid "Open Drive by Index"
msgstr ""
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgid "Open &VFS List"
msgstr "Адкрыць спіс &VFS"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "&Праграма прагляду аперацый"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Параметры..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "&Запакаваць файлы..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Прызначыць пазіцыю падзяляльніка"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "&Уставіць"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Загрузіць папярэднюю выбраную ўкладку са спіса"
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Перайсці да &папярэдняй укладкі"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Хуткі фільтр"
#: tfrmmain.actquicksearch.caption
msgid "Quick search"
msgstr "Хуткі пошук"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "&Панэль хуткага прагляду"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Абнавіць"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Перазагрузіць апошнія загружаныя выбраныя ўкладкі"
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Перамясціць"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Перамясціць/змяніць назву файла без пацверджання"
#: tfrmmain.actrenameonly.caption
msgctxt "tfrmmain.actrenameonly.caption"
msgid "Rename"
msgstr "Змяніць назву"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "&Змяніць назву ўкладкі"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Перазахаваць апошнія загружаныя выбраныя ўкладкі"
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Аднавіць вылучэнне"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "Ад&варотны парадак"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Скарочаны выгляд правай панэлі"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Падрабязны выгляд правай панэлі"
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Правая &=Левая"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "&Плоскі выгляд правай панэлі"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Адкрыць правы спіс дыскаў"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "Ад&вярнуць парадак элементаў правай панэлі"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Упарадкаваць элементы правай панэлі па &атрыбутах"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Упарадкаваць элементы правай панэлі па &даце"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Упарадкаваць элементы правай панэлі па &пашырэнню"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Упарадкаваць элементы правай панэлі па &назве"
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Упарадкаваць элементы правай панэлі па &памеры"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Прагляд мініяцюр на правай панэлі"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Запусціць &тэрмінал"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Захаваць бягучыя ўкладкі як новыя выбраныя"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "З&ахаваць вылучэнне"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Захаваць вылучэнне ў файл..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "&Захаваць укладкі ў файл"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Шукаць…"
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Заблакаваць усе ўкладкі і адкрываць каталогі ў новых укладках"
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Разблакаваць усе ўкладкі"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Заблакаваць усе ўкладкі"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Заблакаваць усе ўкладкі з магчымасцю змены каталога"
#: tfrmmain.actsetfileproperties.caption
msgid "Change &Attributes..."
msgstr "Змяніць &атрыбуты..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Заблакаваць і адкрываць каталогі ў новых укладках"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Звычайная"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Заблакаваная"
#: tfrmmain.actsettaboptionpathresets.caption
msgid "Locked with &Directory Changes Allowed"
msgstr "Заблакаваць з магчымасцю змены &каталога"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Адкрыць"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Адкрыць выкарыстоўваючы сістэмныя асацыяцыі"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Паказаць кнопкі меню"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Паказаць гісторыю загаднага радка"
#: tfrmmain.actshowmainmenu.caption
msgid "Menu"
msgstr "Меню"
#: tfrmmain.actshowsysfiles.caption
msgid "Show &Hidden/System Files"
msgstr "Паказваць с&хаваныя/сістэмныя файлы"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Упарадкаваць па &атрыбутах"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Упарадкаваць па &даце"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Упарадкаваць па &пашырэнню"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Упарадкаваць па &назве"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Упарадкаваць па &памеры"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Адкрыць спіс дыскаў"
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Уключыць/выключыць функцыю выключэння назваў файлаў"
#: tfrmmain.actsymlink.caption
msgid "Create Symbolic &Link..."
msgstr "Стварыць сімвалічную &спасылку..."
#: tfrmmain.actsyncdirs.caption
msgid "Syn&chronize dirs..."
msgstr "Сінхранізаваць каталогі..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Мэта &= Крыніца"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "&Праверыць архіў(вы)"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Мініяцюры"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Прагляд мініяцюр"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr "Пераключыць акно кансолі ў поўнаэкранны рэжым"
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Адкрыць каталог пад курсорам у левай панэлі"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Адкрыць каталог пад курсорам у правай панэлі"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "&Панэль у выглядзе дрэва"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr "Упарадкаваць па параметрах"
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Зняць вылучэнне з файлаў з такім жа пашы&рэннем"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr "Зняць вылучэнне з файлаў з такой жа назвай"
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr "Зняць вылучэнне з файлаў з такім жа пашырэннем і назвай"
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr "Зняць вылучэнне з гэтым шляхам"
#: tfrmmain.actview.caption
msgctxt "TFRMMAIN.ACTVIEW.CAPTION"
msgid "View"
msgstr "Праглядзець"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Паказаць гісторыю наведаных месцаў"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Перайсці да наступнага запіса ў гісторыі"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Перайсці да папярэдняга запіса ў гісторыі"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Паказаць лог"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr "Паказаць спіс запушчаных акон пошуку"
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Наведаць сайт Double Commander"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Сцерці"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr "Працаваць са выбраных каталогаў і параметрамі"
#: tfrmmain.btnf10.caption
msgctxt "TFRMMAIN.BTNF10.CAPTION"
msgid "Exit"
msgstr "Выйсці"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Каталог"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Выдаліць"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Тэрмінал"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Спіс выбраных каталогаў"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Паказаць бягучы каталог правай панэлі ў левай"
#: tfrmmain.btnlefthome.caption
msgctxt "tfrmmain.btnlefthome.caption"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Перайсці да хатняга каталога"
#: tfrmmain.btnleftroot.caption
msgctxt "tfrmmain.btnleftroot.caption"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Перайсці да каранёвага каталога"
#: tfrmmain.btnleftup.caption
msgctxt "tfrmmain.btnleftup.caption"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Перайсці да бацькоўскага каталога"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Спіс выбраных каталогаў"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Паказаць бягучы каталог левай панэлі ў правай"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "tfrmmain.lblcommandpath.caption"
msgid "Path"
msgstr "Шлях"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Скасаваць"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Капіраваць..."
#: tfrmmain.mihardlink.caption
msgid "Create link..."
msgstr "Стварыць спасылку..."
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Ачысціць"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Капіраваць"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Схаваць"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Абраць усё"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Перамясціць..."
#: tfrmmain.misymlink.caption
msgid "Create symlink..."
msgstr "Стварыць спасылку..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Параметры ўкладкі"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Выйсці"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Аднавіць"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Пачаць"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Скасаваць"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Загады"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "&Канфігурацыя"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Выбранае"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Файлы"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "&Даведка"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Пазначэнне"
#: tfrmmain.mnunetwork.caption
msgctxt "tfrmmain.mnunetwork.caption"
msgid "Network"
msgstr "Сетка"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Выгляд"
#: tfrmmain.mnutaboptions.caption
msgid "Tab &Options"
msgstr "&Параметры ўкладкі"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Укладкі"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Капіраваць"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Выразаць"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Выдаліць"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Рэдагаваць"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Уставіць"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmmaincommandsdlg.caption
msgctxt "tfrmmaincommandsdlg.caption"
msgid "Select your internal command"
msgstr "Абраць унутраны загад"
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Упарадкаваць састарэлыя"
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
msgid "Legacy sorted"
msgstr "Упарадкаваць састарэлыя"
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Абраць усе прадвызначаныя катэгорыі"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Вылучэнне:"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "&Катэгорыі:"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "&Назва загада:"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Фільтр:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Падказка:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Гарачыя клавішы:"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr "cm_name"
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "Катэгорыя"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Даведка"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Падказка"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Гарачыя клавішы"
#: tfrmmaskinputdlg.btnaddattribute.caption
msgctxt "TFRMMASKINPUTDLG.BTNADDATTRIBUTE.CAPTION"
msgid "&Add"
msgstr "&Дадаць"
#: tfrmmaskinputdlg.btnattrshelp.caption
msgctxt "TFRMMASKINPUTDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Даведка"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Шаблон..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Зважаць на рэгістр"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr "Не зважаць на акцэнты і лігатуры"
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr "Атр&ыбуты:"
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Уваходная маска:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "&Альбо абярыце тып файла па шаблоне:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Стварыць новы каталог"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "&Увядзіце новую назву каталога:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr "Новы памер"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Вышыня:"
#: tfrmmodview.lblpath1.caption
msgctxt "tfrmmodview.lblpath1.caption"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Якасць сціскання Jpg"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Шырыня:"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Вышыня"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "tfrmmodview.tewidth.text"
msgid "Width"
msgstr "Шырыня"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr "456456465465465"
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Выдаліць"
#: tfrmmultirename.btnedit.caption
msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Рэдагаваць"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "&Загрузіць"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Змяніць назву"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Скінуць &усё"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Захаваць"
#: tfrmmultirename.caption
msgid "MultiRename"
msgstr "Змена назваў некалькіх файлаў"
#: tfrmmultirename.cblog.caption
msgid "Ena&ble"
msgstr "Укл&ючыць"
#: tfrmmultirename.cbregexp.caption
msgid "Regular e&xpressions"
msgstr "Рэгулярныя &выразы"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "&Выкарыстоўваць падстаноўку"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Пашырэнне"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Лічыльнік"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Знайсці і &замяніць"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Лог вынікаў"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Маска"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Профілі"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "&Пашырэнне"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "&Шукаць..."
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "&Інтэрвал"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "&Назва файла"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "Зам&яніць..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "&Пачатковы нумар"
#: tfrmmultirename.lbwidth.caption
msgid "&Width"
msgstr "&Шырыня"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Лічыльнік"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Дзень"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Дзень (2 лічбы)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Дзень тыдня (скарочана,напрыклад , \"пн\")"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Дзень тыдня (поўная назва ,напрыклад \"панядзелак\")"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Сімвал з пазіцыі x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Сімвалы з пацізыі x да y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[г] Гадзіна"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Гадзіна (2 лічбы)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Хвіліна"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Хвіліна (2 лічбы)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Месяц"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Месяц (2 лічбы)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Назва месяца (скарочаная, напрыклад \"стдз\")"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Назва месяца (поўная,напрыклад, \"студзень\")"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Назва"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Сімвал з пазіцыі x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Сімвалы з пацізыі x да y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Час..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Пашырэнне..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Назва..."
#: tfrmmultirename.miplugin.caption
msgctxt "tfrmmultirename.miplugin.caption"
msgid "Plugin"
msgstr "Убудова"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Секунда"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Секунда (2 лічбы)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Год (2 лічбы)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Год (4 лічбы)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Рэдагаваць назвы..."
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Загрузіць назвы з файла..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgid "Old File Name"
msgstr "Старая назва файла"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgid "New File Name"
msgstr "Новая назва файла"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgid "File Path"
msgstr "Шлях да файла"
#: tfrmmultirenamewait.caption
msgctxt "TFRMMULTIRENAMEWAIT.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr "Пстрыкніце \"Добра\" пры закрыцці рэдактара, каб загрузіць змененыя назвы!"
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Абраць праграму"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Адвольны загад"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Захаваць асацыяцыю"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Прызначыць абраную праграму прадвызначаным дзеяннем"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Тып адкрываемага файла: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Спіс файлаў"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Спіс URI"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Адзін файл"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "Адзін URI"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgid "&Apply"
msgstr "&Ужыць"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Параметры"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Калі ласка, абярыце адну з падстаронак, на гэтай няма патрэбных налад."
#: tfrmoptionsarchivers.btnarchiveradd.caption
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
msgid "A&dd"
msgstr "&Дадаць"
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverapply.caption
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
msgid "A&pply"
msgstr "У&жыць"
#: tfrmoptionsarchivers.btnarchivercopy.caption
msgctxt "tfrmoptionsarchivers.btnarchivercopy.caption"
msgid "Cop&y"
msgstr "Капіраваць"
#: tfrmoptionsarchivers.btnarchiverdelete.caption
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
msgid "Delete"
msgstr "Вы&даліць"
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverother.caption
msgctxt "tfrmoptionsarchivers.btnarchiverother.caption"
msgid "Oth&er..."
msgstr ""
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionsarchivers.btnarchiverrename.caption
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
msgid "&Rename"
msgstr "&Змяніць назву"
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiverids.caption
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
msgid "Options:"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
msgid "Format parsing mode:"
msgstr "Рэжым разбору фармату:"
#: tfrmoptionsarchivers.chkarchiverenabled.caption
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
msgid "E&nabled"
msgstr "Ук&лючана"
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcdebug.caption"
msgid "De&bug mode"
msgstr "&Рэжым адладкі"
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
msgid "S&how console output"
msgstr "Па&казваць вывад кансолі"
#: tfrmoptionsarchivers.chkfilenameonlylist.caption
msgid "Use archive name without extension as list"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
msgid "Uni&x file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
msgid "&Unix path delimiter \"/\""
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
msgid "Windows &file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
msgid "Windows path deli&miter \"\\\""
msgstr ""
#: tfrmoptionsarchivers.lblarchiveradd.caption
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
msgid "Add&ing:"
msgstr "Дада&нне:"
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
msgid "Arc&hiver:"
msgstr "Ар&хіватар:"
#: tfrmoptionsarchivers.lblarchiverdelete.caption
msgid "De&lete:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiverdescription.caption
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
msgid "De&scription:"
msgstr "Апі&санне:"
#: tfrmoptionsarchivers.lblarchiverextension.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
msgid "E&xtension:"
msgstr "Па&шырэнне:"
#: tfrmoptionsarchivers.lblarchiverextract.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
msgid "Ex&tract:"
msgstr "Вы&няць:"
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
msgid "Extract &without path:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiveridposition.caption
msgid "ID Po&sition:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiverids.caption
msgid "&ID:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
msgid "ID See&k Range:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiverlist.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
msgid "&List:"
msgstr "&Спіс:"
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
msgid "Archi&vers:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiverlistend.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
msgid "Listing &finish (optional):"
msgstr "&Канец спіса (неабавязкова):"
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
msgid "Listing for&mat:"
msgstr "&Фармат спіса:"
#: tfrmoptionsarchivers.lblarchiverliststart.caption
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
msgid "Listin&g start (optional):"
msgstr "Пачатак с&піса (неабавязкова):"
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
msgid "Password &query string:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
msgid "Create self extractin&g archive:"
msgstr ""
#: tfrmoptionsarchivers.lblarchivertest.caption
msgid "Tes&t:"
msgstr ""
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
msgid "Auto Configure"
msgstr "Аў&таматычная наладка"
#: tfrmoptionsarchivers.miarchiverdisableall.caption
msgid "Disable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
msgid "Discard modifications"
msgstr ""
#: tfrmoptionsarchivers.miarchiverenableall.caption
msgid "Enable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverexport.caption
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
msgid "Export..."
msgstr "Экспарт..."
#: tfrmoptionsarchivers.miarchiverimport.caption
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
msgid "Import..."
msgstr "Імпарт..."
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
msgid "Sort archivers"
msgstr ""
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgid "Additional"
msgstr "Дадатковыя"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr "Асноўныя"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgid "When &size, date or attributes change"
msgstr "Калі &памер, дата альбо атрыбуты змяняюцца"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "Для выкарыстоўваемых &шляхоў і падкаталогаў па іх:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgid "When &files are created, deleted or renamed"
msgstr "Калі &файлы ствараюцца, выдаляюцца альбо змяняюцца іх назвы"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgid "When application is in the &background"
msgstr "Калі праграма ў &фоне"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgid "Disable auto-refresh"
msgstr "Выключыць аўтаматычнае абнаўленне"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgid "Refresh file list"
msgstr "Абнавіць спіс файлаў"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgid "Al&ways show tray icon"
msgstr "Заў&сёды паказваць значок на прасторы апавяшчэнняў"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Аўтаматычна &хаваць адмантаваныя прылады"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgid "Mo&ve icon to system tray when minimized"
msgstr "Перамя&шчаць значок на прастору апавяшчэнняў падчас згортвання"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgid "A&llow only one copy of DC at a time"
msgstr "Дазв&оліць запуск толькі адной копіі DC"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Тут вы можаце ўвесці адзін альбо некалькі дыскаў альбо пунктаў мантавання, падзяляючы іх \";\"."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "&Чорны спіс дыскаў"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Памер слупкоў"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Паказваць пашырэнні файлаў"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "выраў&наванымі (з Tab)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "непа&срэдна пасля назваў"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Аўтаматычна"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Фіксаваная колькасць слупкоў"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Фіксаваная шырыня слупкоў"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "Абразаць &тэкст па шырыні слупка"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr "&Пашырыць шырыню ячэйкі, калі тая не ўмяшчаецца ў слупок"
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "&Гарызантальныя лініі"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "&Вертыкальныя лініі"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "Аў&таматычнае запаўненне слупкоў"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Паказваць сетку"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Аўтаматычна змяняць памер слупкоў"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Аўтаматычна змяняць па&мер слупкоў:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "У&жыць"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "&Рэдагаваць"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "Гісторыя загад&нага радка"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgid "&Directory history"
msgstr "&Гісторыя каталога"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "Гісторыя &файлавай маскі"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "Захава&ць канфігурацыю"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "Шукаць/замяніць гісторыю"
#: tfrmoptionsconfiguration.gbdirectories.caption
msgctxt "TFRMOPTIONSCONFIGURATION.GBDIRECTORIES.CAPTION"
msgid "Directories"
msgstr "Каталогі"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Размяшчэнне файлаў канфігурацыі"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Захоўваць падчас выхаду"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Парадкаванне дрэва канфігурацыі злева"
#: tfrmoptionsconfiguration.gpconfigurationtreestate.caption
msgid "Tree state when entering in configuration page"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Зададзена праз загадны радок"
#: tfrmoptionsconfiguration.lblhighlighters.caption
msgid "Highlighters:"
msgstr "Падсвятленне:"
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr "Тэма значкоў:"
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr "Кэш мініяцюр:"
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "Каталог пра&грамы (партатыўная версія)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "Хатні каталог &карыстальніка"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
msgid "All"
msgstr "Усё"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
msgid "Apply modification to all columns"
msgstr "Ужыць змены да ўсіх слупкоў"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
msgid "&Delete"
msgstr "&Выдаліць"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Перайсці да прадвызначанага"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
msgid "New"
msgstr "Новая"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "Наступная"
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "Папярэдняя"
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
msgid "Rename"
msgstr "Змяніць назву"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
msgid "R"
msgstr "П"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
msgid "Reset to default"
msgstr "Скінуць да прадвызначанага"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
msgid "Save as"
msgstr "Захаваць як"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
msgid "Save"
msgstr "Захаваць"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Дазволіць накладанне колера"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "Калі што-небудзь змяняецца, то змяняецца для ўсіх слупкоў"
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
msgid "General"
msgstr "Асноўныя"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Мяжа курсора"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Выкарыстоўваць рамку курсора"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Вылучэнне ў неактыўнай панэлі"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Выкарыстоўваць адваротнае вылучэнне"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Выкарыстоўваць адвольны шрыфт і колер"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgid "BackGround:"
msgstr "Фон:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgid "Background 2:"
msgstr "Фон 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Нала&дзіць выгляд слупкоў:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Бягучая назва слупка]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgid "Cursor Color:"
msgstr "Колер курсора:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgid "Cursor Text:"
msgstr "Тэкст курсора:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgid "Font:"
msgstr "Шрыфт:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
msgid "Size:"
msgstr "Памер:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgid "Text Color:"
msgstr "Колер тэксту:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Колер неактыўнага курсора:"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Колер неактыўнага вылучэння:"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgid "Mark Color:"
msgstr "Колер вылучэння:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Ніжэй знаходзіцца папярэдні прагляд. Вы можаце перамяшчаць курсор і вылучаць файлы, каб паспрабаваць абраныя налады."
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Налады слупка:"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgid "Add column"
msgstr "Дадаць слупок"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Пазіцыя панэлі пасля параўнання:"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr "Дадаць каталог &актыўнай укладкі"
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr "Дадаць &каталогі актыўнай і неактыўнай укладак"
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr "Дыялог &выбару каталога"
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr "Дадаць копію абранага радка"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr "Дадаць &абранае альбо каталог актыўнай укладкі"
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Дадаць падзяляльнік"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr "Дадаць падменю"
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr "Дадаць каталог уласнаручна"
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Згарнуць усё"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr "Згарнуць элемент"
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr "Выразаць абранае"
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr "Выдаліць усё!"
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Выдаліць абраны элемент"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr "Выдаліць падменю і ўсе яго элементы"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr "Выдаліць падменю, але пакінуць яго элементы"
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr "Разгарнуць элемент"
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr "Фокус на дрэва элементаў"
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr "Перайсці да першага элемента"
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr "Перайсці да апошняга элемента"
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr "Перайсці да наступнага элемента"
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr "Перайсці да папярэдняга элемента"
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr "Уставіць каталог &актыўнай укладкі"
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr "Уставіць каталогі && актыўнай і неактыўнай укладак"
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr "Дыялог &выбару каталога"
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr "Уставіць копію абранага элемента"
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr "Уставіць &абранае альбо каталог актыўнай укладкі"
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr "Уставіць падзяляльнік"
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr "Уставіць падменю"
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr "Уставіць каталог уласнаручна"
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr "Перайсці да наступнага"
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr "Перайсці да папярэдняга"
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Адкрыць усе галіны"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr "Уставіць выразанае"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr "Знайсці і замяніць па &шляху"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr "Знайсці і &замяніць па шляху і мэтавым шляху"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr "Знайсці і замяніць па &мэтавым шляху<"
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr "Змяніць шлях"
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr "Змяніць мэтавы шлях"
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "&Дадаць..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "&Стварыць рэзервовую копію..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "&Выдаліць..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "&Экспарт..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION"
msgid "&Help"
msgstr "&Даведка"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "&Імпарт..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "&Уставіць..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "&Рознае..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgid "Some functions to select appropriate target"
msgstr "Некаторыя функцыі для выбару мэтавага шляху"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "&Упарадкаваць…"
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "&Падчас дадання дадаваць мэтавы шлях"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "&Заўсёды разгортваць дрэва"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Паказваць толькі &карэктныя зменныя асяроддзя"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr "Паказваць у &меню таксама і шлях"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Назва , а-я"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr "Назва, а-я"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Выбраныя каталогі (парадкуйце &перацягваннем)"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Іншыя параметры"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr "Назва:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr "Шлях:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgid "&Target:"
msgstr "&Мэта:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "...бягучы ўз&ровень элементаў, толькі абраныя"
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Праверыць &існаванне шляхоў"
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "&Праверыць існаванне шляхоў і мэтавых шляхоў"
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "у файл &выбраных каталогаў (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "у файл \"wincmd.ini\" TC (&пакінуць існуючыя)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "у файл \"wincmd.ini\" TC (&выдаліць існуючыя)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Перайсці да &налад, звязаных з TC"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
msgid "Go to &configure TC related info"
msgstr "Перайсці да &налад, звязаных з TC"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "HotDirTestMenu"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "з файла выбраных &каталогаў (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "з файла ТС \"&wincmd.ini\""
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr "&Навігацыя..."
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "&Аднавіць спіс выбраных каталогаў з рэзервовай копіі"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "&Захаваць рэзервовую копію"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Знайсці і &замяніць..."
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...усе, ад а да &я!"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "...толькі асобныя &групы элементаў"
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "...&змесціва абранага падменю, без падузроўняў"
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "...змесціва абранага падменю і &ўсіх падузроўняў"
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr "Праверыць &выніковае меню"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr "Змяніць &шлях"
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr "Змяніць &мэтавы шлях"
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr "Даданне з галоўнай панэлі:"
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Прапаноўваць усе падтрымліваемыя фарматы, пытацца штораз"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Падчас захавання тэксту ў Unicode захоўваць з кадаваннем UTF8 (інакш будзе UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Падчас перацягвання тэксту генераваць назвы файлаў аўтаматычна (інакш будзе пытацца)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "&Паказваць дыялог пацверджання пры перацягванні"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Пры пера&цягванні тэксту на панэль:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Размясціце фарматы па ўбыванню (выкарыстоўвайце перацягванне):"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(калі найбольш адпаведнае адсутнічае, бярэцца наступнае і г.д.)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(не будзе працаваць з некаторымі праграмамі, пры ўзікненні праблем выключыце)"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Паказваць &файлавую сістэму"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Паказваць во&льнае месца"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Паказваць &адмеціну"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Спіс дыскаў"
#: tfrmoptionseditor.chkautoindent.caption
msgid "Auto Indent"
msgstr ""
#: tfrmoptionseditor.chkautoindent.hint
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
msgstr ""
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Пракручваць канцом радка"
#: tfrmoptionseditor.chkscrollpastendline.hint
msgid "Allows caret to go into empty space beyond end-of-line position"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Паказваць адмысловыя сімвалы"
#: tfrmoptionseditor.chkshowspecialchars.hint
msgid "Shows special characters for spaces and tabulations"
msgstr ""
#: tfrmoptionseditor.chksmarttabs.caption
msgid "Smart Tabs"
msgstr ""
#: tfrmoptionseditor.chksmarttabs.hint
msgid "When using <Tab> key, caret will go to the next non-space character of the previous line"
msgstr ""
#: tfrmoptionseditor.chktabindent.caption
msgid "Tab indents blocks"
msgstr ""
#: tfrmoptionseditor.chktabindent.hint
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.caption
msgid "Use spaces instead tab characters"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.hint
msgid "Converts tab characters to a specified number of space characters (when entering)"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.caption
msgid "Delete trailing spaces"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.hint
msgid "Auto delete trailing spaces, this applies only to edited lines"
msgstr ""
#: tfrmoptionseditor.edtabwidth.hint
msgctxt "tfrmoptionseditor.edtabwidth.hint"
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Параметры ўнутранага рэдактара"
#: tfrmoptionseditor.lbltabwidth.caption
msgid "Tab width:"
msgstr ""
#: tfrmoptionseditor.lbltabwidth.hint
msgctxt "tfrmoptionseditor.lbltabwidth.hint"
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Фо&н"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "Фо&н"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Скінуць"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr "Захаваць"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Атрыбуты элемента"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Пя&рэдні план"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "Пя&рэдні план"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "&Пазначэнне тэксту"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Выкарыстоўваць (і змяняць) глабальную схему"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Выкарыстоўваць глабальную схему"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Тлусты"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "&Адвярнуць"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Вы&ключыць"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "Укл&ючыць"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Курсіў"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "&Адвярнуць"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Вы&ключыць"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "Укл&ючыць"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "&Закрэслены"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "&Адвярнуць"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Вы&ключыць"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "Укл&ючыць"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "&Падкрэслены"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "&Адвярнуць"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "Вы&ключыць"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "Укл&ючыць"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION"
msgid "Add..."
msgstr "Дадаць..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION"
msgid "Delete..."
msgstr "Выдаліць..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Імпарт/Экспарт"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION"
msgid "Insert..."
msgstr "Уставіць..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION"
msgid "Rename"
msgstr "Змяніць назву"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION"
msgid "Sort..."
msgstr "Упарадкаваць …"
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Няма"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION"
msgid "Always expand tree"
msgstr "Заўсёды разгортваць дрэва"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Не"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Па леваму краю"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Па праваму краю"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Спіс выбраных укладак (парадкуйце &перацягваннем)"
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION"
msgid "Other options"
msgstr "Іншыя параметры"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr "Каб аднавіць для абранага радка"
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Захоўваць існуючыя ўкладкі:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Захоўваць гісторыю каталога:"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr "Укладкі, захаваныя злева адновяцца:"
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr "Укладкі, захаваныя зправа, адновяцца:"
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION"
msgid "a separator"
msgstr "падзяляльнік"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Дадаць падзяляльнік"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION"
msgid "sub-menu"
msgstr "падменю"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION"
msgid "Add sub-menu"
msgstr "Дадаць падменю"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION"
msgid "Collapse all"
msgstr "Згарнуць усё"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION"
msgid "...current level of item(s) selected only"
msgstr "...бягучы ўзровень абранага(ых) элемента(аў)"
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION"
msgid "Cut"
msgstr "Выразаць"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION"
msgid "delete all!"
msgstr "выдаліць усё!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION"
msgid "sub-menu and all its elements"
msgstr "падменю і ўсе яго элементы"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION"
msgid "just sub-menu but keep elements"
msgstr "толькі падменю, элементы пакінуць"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION"
msgid "selected item"
msgstr "абраны элемент"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION"
msgid "Delete selected item"
msgstr "Выдаліць абраны элемент"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr "Экспартаваць абранае ў файлы .tab"
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr "FavoriteTabsTestMenu"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr "Імпартаваць файлы .tab з прадвызначанымі наладамі"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Імпартаваць файлы .tab на абраную пазіцыю"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Імпартаваць файлы .tab на абраную пазіцыю"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr "Імпартаваць файлы .tab у падменю на абранай пазіцыі"
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Уставіць падзяляльнік"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Уставіць падменю"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION"
msgid "Open all branches"
msgstr "Адкрыць усе галіны"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION"
msgid "Paste"
msgstr "Уставіць"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION"
msgid "Rename"
msgstr "Змяніць назву"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTEVERYTHING.CAPTION"
msgid "...everything, from A to Z!"
msgstr "...усе, ад а да я!"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP.CAPTION"
msgid "...single group of item(s) only"
msgstr "...толькі асобныя групы элементаў"
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP2.CAPTION"
msgid "Sort single group of item(s) only"
msgstr "Упарадкаваць толькі адну групу элементаў"
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLESUBMENU.CAPTION"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "...змесціва абранага падменю, без падузроўняў"
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSUBMENUANDSUBLEVEL.CAPTION"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "...змесціва абранага падменю і ўсіх падузроўняў"
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MITESTRESULTINGFAVORITETABSMENU.CAPTION"
msgid "Test resulting menu"
msgstr "Праверыць выніковае меню"
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Дадаць"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
msgid "Add"
msgstr "&Дадаць"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
msgid "A&dd"
msgstr "&Дадаць"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "C&lone"
msgstr "Кланаваць"
#: tfrmoptionsfileassoc.btncommands.hint
msgctxt "tfrmoptionsfileassoc.btncommands.hint"
msgid "Select your internal command"
msgstr "Абраць унутраны загад"
#: tfrmoptionsfileassoc.btndownact.caption
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "Do&wn"
msgstr "&Уніз"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION"
msgid "Edi&t"
msgstr "Рэдагаваць"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Уставіць"
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION"
msgid "&Insert"
msgstr "Уставіць"
#: tfrmoptionsfileassoc.btnparametershelper.hint
msgctxt "tfrmoptionsfileassoc.btnparametershelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsfileassoc.btnrelativecommand.hint
msgctxt "tfrmoptionsfileassoc.btnrelativecommand.hint"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionsfileassoc.btnremoveact.caption
msgid "Remo&ve"
msgstr "Выда&ліць"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgid "Re&move"
msgstr "Вы&даліць"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
msgid "&Remove"
msgstr "&Выдаліць"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "&Змяніць назву"
#: tfrmoptionsfileassoc.btnstartpathpathhelper.hint
msgctxt "tfrmoptionsfileassoc.btnstartpathpathhelper.hint"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionsfileassoc.btnstartpathvarhelper.hint
msgctxt "tfrmoptionsfileassoc.btnstartpathvarhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
msgid "&Up"
msgstr "&Уверх"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr "Шлях да запуску загаду. Не выкарыстоўваць двукоссі."
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr "Назва дзеяння. Яна ніколі не перадаецца сістэме, гэта толькі мнеманічная назва"
#: tfrmoptionsfileassoc.edtparams.hint
#, fuzzy
#| msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgid "Parameter to pass to the command. Long filename with spaces should be quoted (manually entering)."
msgstr "Параметры, што перадаюцца загаду. Доўгія назвы файлаў з прагаламі мусяць быць у двукоссях (пры непасрэдным уводзе)"
#: tfrmoptionsfileassoc.fnecommand.hint
#, fuzzy
#| msgid "Command to execute. Long filename with space should be quoted."
msgid "Command to execute. Never quote this string."
msgstr "Загад для запуску. Не выкарыстоўваць двукоссі."
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description"
msgstr "Апісанне дзеяння:"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Дзеянні"
#: tfrmoptionsfileassoc.gbexts.caption
msgid "Extensions"
msgstr "Пашырэнні"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Можна ўпарадкаваць &перацягваннем"
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Тыпы файлаў"
#: tfrmoptionsfileassoc.gbicon.caption
msgid "Icon"
msgstr "Значок"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Дзеянні можна ўпарадкаваць пера&цягваннем"
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Пашырэнні можна ўпарадкаваць перацяг&ваннем"
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Тыпы файлаў можна ўпарадкаваць перацяг&ваннем"
#: tfrmoptionsfileassoc.lblaction.caption
msgid "Action &name:"
msgstr "Назва дзеяння:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "Command:"
msgstr "&Загад:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Парамет&ры:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Ш&лях запуску:"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Адвольна з..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Адвольна"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
msgid "Edit"
msgstr "Рэдагаваць"
#: tfrmoptionsfileassoc.mieditor.caption
msgid "Open in Editor"
msgstr "Адкрыць у рэдактары"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Рэдагаваць у..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgid "Get output from command"
msgstr "Атрымаць вывад загада"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Адкрыць ва ўнутраным рэдактары"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Адкрыць ва ўнутранай праграме прагляду"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
msgid "Open"
msgstr "Адкрыць"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Адкрыць у ..."
#: tfrmoptionsfileassoc.mishell.caption
msgid "Run in terminal"
msgstr "Запусціць у тэрмінале"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
msgid "View"
msgstr "Праглядзець"
#: tfrmoptionsfileassoc.miviewer.caption
msgid "Open in Viewer"
msgstr "Адкрыць у праграме прагляду"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Праглядзець у..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Націсніце тут, каб змяніць значок!"
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "Запусціць у абалонцы"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Пашыранае кантэкстнае меню"
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Канфігурацыя асацыяцый файлаў"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr "Прапаноўваць дадаць файл пад курсорам у асацыяцыі файлаў"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Калі даступна асацыяцыя файлаў, прапаноўваць дадаць бягучы абраны файл, калі яго тыпа яшчэ няма"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "Запусціць у тэрмінале і закрыць"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "Запусціць у тэрмінале і пакінуць адкрытым"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Дадатковыя параметры элементаў:"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgid "Show confirmation window for:"
msgstr "Паказваць акно пацверджання для:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Аперацыя капі&равання"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Аперацыя вы&далення"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Выда&ленне ў сметніцу (з Shift - поўнае)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Аперацыя вы&далення ў сметніцу"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgid "D&rop readonly flag"
msgstr "Скінуць сцяг \"Толькі для чытання\""
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "&Аперацыя перамяшчэння"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "&Апрацоўваць каментары з файламі/каталогамі"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Падчас змены назвы &файла абіраць яе без пашырэння"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Паказ&ваць панэль выбару ў дыялогу капіравання/перамяшчэння"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "Мі&наць памылкі падчас аперацый з файламі і выводзіць іх у акно лога"
#: tfrmoptionsfileoperations.cbverifychecksumconfirmation.caption
msgid "Verify checksum operation"
msgstr ""
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Выкананне аперацый"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Інтэрфейс карыстальніка"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "&Памер буфера абмену для файлавых аперацый (КБ):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr "Памер буферу для падліку &хэшу (Кб)"
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Паказваць прагрэс апе&рацый у"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgid "Duplicated name auto-rename style:"
msgstr "Стыль аўтаматычнай змены супадаючых назваў:"
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "&Колькасць перазапісаў пры сціранні:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Скінуць да прадвызначанага DC"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION"
msgid "Allow Overcolor"
msgstr "Дазволіць накладанне колера"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Выкарыстоўваць &рамку курсора"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Выкарыстоўваць індыкатар &градыента"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Выкарыстоўваць курсор у неактыўнай панэлі"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "Вы&карыстоўваць адваротнае вылучэнне"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION"
msgid "Cursor border"
msgstr "Мяжа курсора"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr "Індыкатар вольнага месца на дыску"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "Фо&н:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgid "Backg&round 2:"
msgstr "Ф&он 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgid "C&ursor Color:"
msgstr "Колер кур&сора:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgid "Cursor Te&xt:"
msgstr "Т&экст курсора:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION"
msgid "Inactive Cursor Color:"
msgstr "Колер неактыўнага курсора:"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION"
msgid "Inactive Mark Color:"
msgstr "Колер неактыўнага вылучэння:"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "&Узровень яркасці неактыўнай панэлі"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Колер фону &індыкатара:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Колер інды&катара:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgid "&Mark Color:"
msgstr "&Колер вылучэння:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "Ніжэй знаходзіцца папярэдні прагляд. Вы можаце перамяшчаць курсор і вылучаць файлы, каб паспрабаваць абраныя налады."
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgid "T&ext Color:"
msgstr "&Колер тэксту:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr "Падчас запуску пошуку ачышчаць фільтр маскі файла"
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "&Пошук па частцы назвы файла"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr "Паказваць меню акна ў \"Пошуку файлаў\""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr "Пошук тэксту ў файлах"
#: tfrmoptionsfilesearch.gbfilesearch.caption
msgctxt "TFRMOPTIONSFILESEARCH.GBFILESEARCH.CAPTION"
msgid "File search"
msgstr "Пошук файлаў"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr "Бягучыя фільтры пасля націскання \"Новы пошук\":"
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr "Прадвызначаны шаблон пошуку:"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Выкарыстоўваць адлюстраванне ў па&мяць"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "&Выкарыстоўваць паток"
#: tfrmoptionsfilesviews.btnaddattribute.caption
msgctxt "TFRMOPTIONSFILESVIEWS.BTNADDATTRIBUTE.CAPTION"
msgid "&Add"
msgstr "&Дадаць"
#: tfrmoptionsfilesviews.btnattrshelp.caption
msgctxt "TFRMOPTIONSFILESVIEWS.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Даведка"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr "Дазволіць пераход у &бацькоўскі каталог падвойнай пстрычкай па пустым месцы файлавай панэлі"
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "Не заг&ружаць спіс файлаў падчас актывацыі ўкладкі"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "Паказва&ць квадратныя дужкі вакол назваў каталогаў"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Пад&свечваць новыя і абноўленыя файлы"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Уключыць &змену назвы падвойнай пстрычкай па назве ў радку"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgid "Load &file list in separate thread"
msgstr "Загружаць спіс &файлаў асобна"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgid "Load icons af&ter file list"
msgstr "Загружаць значкі пас&ля спіса файлаў"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgid "Show s&ystem and hidden files"
msgstr "Паказваць сіс&тэмныя і схаваныя файлы"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "&Пры вылучэнні файлаў прагалам перамяшчаць курсор на наступны файл"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr "Фільтр пазначэння файлаў у стылі Windows (\"*.*\" вылучае файлы без пашырэння і г.д.)"
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr "Кожны раз паказваць у акне ўводу незалежны фільтр маскі атрыбутаў"
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Фарматаванне"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr "Вылучэнне/Скід вылучэння"
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Упарадкаванне"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgid "Default attribute mask value to use:"
msgstr "Прадвызначаная маска атрыбута:"
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Адчувальны да &рэгістра:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Хібны фармат"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "&Фармат даты і часу:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Фармат па&меру файла:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "&Уставіць новыя файлы:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Упарад&каванне каталогаў:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "Метад &упарадкавання:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "&Перамяшчаць абноўлёныя файлы:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "&Дадаць"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "У&жыць"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "Вы&даліць"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
msgid "Template..."
msgstr "Шаблон..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Колеры тыпаў файлаў (упарадкаванне пера&цягваннем)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "Атры&буты катэгорыі:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Колер кат&эгорыі:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
msgid "Category &mask:"
msgstr "Ма&ска катэгорыі:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr "&Назва катэгорыі:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNPATHEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSEARCHRESULTSFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "Шрыфт &тэрмінала"
#: tfrmoptionsfonts.lbleditorfont.caption
msgid "&Editor font"
msgstr "Шрыфт &рэдактара"
#: tfrmoptionsfonts.lbllogfont.caption
msgid "&Log font"
msgstr "Шрыфт &лога"
#: tfrmoptionsfonts.lblmainfont.caption
msgid "Main &font"
msgstr "Асноўны &шрыфт"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Шрыфт шляху"
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Шрыфт вынікаў пошуку"
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgid "Viewer&Book Font"
msgstr "Шрыфт прагляду ў рэжыме &кнігі"
#: tfrmoptionsfonts.lblviewerfont.caption
msgid "&Viewer font"
msgstr "Ш&рыфт праглядальніка"
#: tfrmoptionshotkeys.actaddhotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTADDHOTKEY.CAPTION"
msgid "Add &hotkey"
msgstr "Дадаць &гарачую клавішу"
#: tfrmoptionshotkeys.actcopy.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTCOPY.CAPTION"
msgid "Copy"
msgstr "Капіраваць"
#: tfrmoptionshotkeys.actdelete.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Выдаліць"
#: tfrmoptionshotkeys.actdeletehotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETEHOTKEY.CAPTION"
msgid "&Delete hotkey"
msgstr "&Выдаліць гарачую клавішу"
#: tfrmoptionshotkeys.actedithotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTEDITHOTKEY.CAPTION"
msgid "&Edit hotkey"
msgstr "&Рэдагаваць гарачую клавішу"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr "Наступная катэгорыя"
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr "Выплыўное меню дзеянняў"
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr "Папярэдняя катэгорыя"
#: tfrmoptionshotkeys.actrename.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTRENAME.CAPTION"
msgid "Rename"
msgstr "Змяніць назву"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr "Аднавіць прадвызначаныя налады DC"
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr "Захаваць неадкладна"
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr "Упарадкаваць па назве загаду"
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr "Упарадкаваць па гарачым клавішам (групаваць)"
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr "Упарадкаваць па гарачым клавішам (адна на радок)"
#: tfrmoptionshotkeys.lbfilter.caption
msgid "&Filter"
msgstr "&Фільтр"
#: tfrmoptionshotkeys.lblcategories.caption
msgid "C&ategories:"
msgstr "Ка&тэгорыі:"
#: tfrmoptionshotkeys.lblcommands.caption
msgid "Co&mmands:"
msgstr "За&гады:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgid "&Shortcut files:"
msgstr "Файлы &спалучэнняў клавіш:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr "Па&радк сартавання:"
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr "Катэгорыі"
#: tfrmoptionshotkeys.micommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.MICOMMANDS.CAPTION"
msgid "Command"
msgstr "Загад"
#: tfrmoptionshotkeys.miseparator1.caption
msgctxt "TFRMOPTIONSHOTKEYS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr "Парадак сартавання"
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Для выкарыстоўваемых &шляхоў і падкаталогаў па іх:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Паказваць значкі дзеянняў у &меню"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr "Паказваць значкі на кнопках"
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgid "Show o&verlay icons, e.g. for links"
msgstr "Паказваць &накладныя значкі (напрыклад, па спасылках)"
#: tfrmoptionsicons.chkshowhiddendimmed.caption
msgid "&Dimmed hidden files (slower)"
msgstr ""
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Выключыць адмысловыя значкі"
#: tfrmoptionsicons.gbiconssize.caption
msgid " Icon size "
msgstr " Памер значкоў "
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr "Тэма значкоў"
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr "Паказваць значкі"
#: tfrmoptionsicons.gbshowiconsmode.caption
msgid " Show icons to the left of the filename "
msgstr " Паказваць значкі злева ад назвы "
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr "Панэль дыскаў:"
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr "Панэль файлаў:"
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
msgid "A&ll"
msgstr "&Усе"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgid "All associated + &EXE/LNK (slow)"
msgstr "Усе асацыяцыі + &EXE/LINK (slow)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgid "&No icons"
msgstr "&Без значкоў"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgid "Only &standard icons"
msgstr "Толькі &стандартныя значкі"
#: tfrmoptionsignorelist.btnaddsel.caption
msgid "A&dd selected names"
msgstr "Да&даць абраныя назвы"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgid "Add selected names with &full path"
msgstr "Дадаць абраныя назвы разам са шляхам"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Не зважаць на наступныя файлы і каталогі:"
#: tfrmoptionsignorelist.lblsavein.caption
msgid "&Save in:"
msgstr "&Захаваць у:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Лев&ая і правая стрэлкі змяняюць каталогі (паводзіны Lynx)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Увод"
#: tfrmoptionskeyboard.lblalt.caption
msgid "Alt+L&etters:"
msgstr "Alt+бук&вы:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+бук&вы:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "&Буквы:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr "&Плоскія кнопкі"
#: tfrmoptionslayout.cbflatinterface.caption
msgid "Flat i&nterface"
msgstr "Плоскі ін&тэрфейс"
#: tfrmoptionslayout.cbflattoolbar.caption
msgid "Flat b&uttons"
msgstr "Плоскія кно&пкі"
#: tfrmoptionslayout.cbfreespaceind.caption
msgid "Show fr&ee space indicator on drive label"
msgstr "Паказваць індыкатар воль&нага месца на адмецінах дыскаў"
#: tfrmoptionslayout.cblogwindow.caption
msgid "Show lo&g window"
msgstr "Паказваць акно ло&га"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgid "Show panel of operation in background"
msgstr "Паказваць панэль аперацыі ў фоне"
#: tfrmoptionslayout.cbproginmenubar.caption
msgid "Show common progress in menu bar"
msgstr "Паказваць бягучы прагрэс на панэлі меню"
#: tfrmoptionslayout.cbshowcmdline.caption
msgid "Show command l&ine"
msgstr "Паказваць загадны ра&док"
#: tfrmoptionslayout.cbshowcurdir.caption
msgid "Show current director&y"
msgstr "Паказваць бягучы катал&ог"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgid "Show &drive buttons"
msgstr "Паказваць копкі &дыскаў"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgid "Show free s&pace label"
msgstr "Паказваць адмеціну вольнага &месца"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Паказваць кн&опку спіса дыскаў"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgid "Show function &key buttons"
msgstr "Паказваць кнопкі функцыянальных клавіш"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgid "Show &main menu"
msgstr "Паказваць &галоўнае меню"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgid "Show tool&bar"
msgstr "Паказваць &панэль прылад"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Паказваць кароткую &адмеціну наяўнасці вольнага месца"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgid "Show &status bar"
msgstr "Паказваць панэль &стану"
#: tfrmoptionslayout.cbshowtabheader.caption
msgid "S&how tabstop header"
msgstr "&Загалоўкі табуляцый"
#: tfrmoptionslayout.cbshowtabs.caption
msgid "Sho&w folder tabs"
msgstr "Паказ&ваць укладкі каталогаў"
#: tfrmoptionslayout.cbtermwindow.caption
msgid "Show te&rminal window"
msgstr "Паказваць акно тэр&мінала"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Дзве панэлі кнопак дыскаў (па-над файлавымі панэлямі)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgid " Screen layout "
msgstr " Элементы асноўнага акна "
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Праглядзець змесціва лога"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Уключаць дату ў назву лога"
#: tfrmoptionslog.cblogarcop.caption
msgid "&Pack/Unpack"
msgstr "&Запакаваць/распакаваць"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Запуск вонкавага загаднага радка"
#: tfrmoptionslog.cblogcpmvln.caption
msgid "Cop&y/Move/Create link/symlink"
msgstr "Ска&піраваць/перамясціць/стварыць спасылку/сімвалічную спасылку"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "&Выдаліць"
#: tfrmoptionslog.cblogdirop.caption
msgid "Crea&te/Delete directories"
msgstr "Ства&рыць/Выдаліць каталогі"
#: tfrmoptionslog.cblogerrors.caption
msgid "Log &errors"
msgstr "Лог &памылак"
#: tfrmoptionslog.cblogfile.caption
msgid "C&reate a log file:"
msgstr "Ст&варыць файл лога:"
#: tfrmoptionslog.cbloginfo.caption
msgid "Log &information messages"
msgstr "&Інфармацыйныя паведамленні лога"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Уключэнне/выключэнне"
#: tfrmoptionslog.cblogsuccess.caption
msgid "Log &successful operations"
msgstr "&Паспяховыя аперацыі"
#: tfrmoptionslog.cblogvfs.caption
msgid "&File system plugins"
msgstr "Убудовы &файлавай сістэмы"
#: tfrmoptionslog.gblogfile.caption
msgid "File operation log file"
msgstr "Лог аперацый з файламі"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Лог аперацый"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Стан аперацыі"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Выдаляць мініяцюры даўно выдаленых файлаў"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
msgid "View log file content"
msgstr "Праглядзець змесціва лога"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION"
msgid "Create new with the encoding:"
msgstr "Стварыць новыя з кадаваннем:"
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Пры &змене дыска заўсёды вяртацца ў каранёвы каталог"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Паказваць паведамленне &папярэджання (толькі кнопка\"Добра\")"
#: tfrmoptionsmisc.chkthumbsave.caption
msgid "&Save thumbnails in cache"
msgstr "&Захоўваць мініяцюры ў кэшы"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Мініяцюры"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr "Каментары да файлаў (descript.ion)"
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "Да экспарту/імпарту TC:"
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION"
msgid "Default encoding:"
msgstr "Прадвызначанае кадаванне:"
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Файл канфігурацыі:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "Выконваемы файл TC:"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Каталог з панэлямі прылад:"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "пікселяў"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "Памер &мініяцюр:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Вылучэнне мышшу"
#: tfrmoptionsmouse.chkcursornofollow.caption
msgid "The text cursor no longer follows the mouse cursor"
msgstr ""
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
msgid "By clic&king on icon"
msgstr ""
#: tfrmoptionsmouse.gbopenwith.caption
msgctxt "tfrmoptionsmouse.gbopenwith.caption"
msgid "Open with"
msgstr "Адкрыць у"
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Пракрутка"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Вылучэнне"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Рэжым:"
#: tfrmoptionsmouse.rbdoubleclick.caption
msgid "Double click"
msgstr ""
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "&Па радках"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Па радках &за перамяшчэннем курсора"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "П&а старонках"
#: tfrmoptionsmouse.rbsingleclickboth.caption
msgid "Single click (opens files and folders)"
msgstr ""
#: tfrmoptionsmouse.rbsingleclickfolders.caption
msgid "Single click (opens folders, double click for files)"
msgstr ""
#: tfrmoptionspluginsbase.btnaddplugin.caption
msgctxt "tfrmoptionspluginsbase.btnaddplugin.caption"
msgid "A&dd"
msgstr "&Дадаць"
#: tfrmoptionspluginsbase.btnconfigplugin.caption
msgctxt "tfrmoptionspluginsbase.btnconfigplugin.caption"
msgid "Con&figure"
msgstr "Нал&адзіць"
#: tfrmoptionspluginsbase.btnenableplugin.caption
msgctxt "tfrmoptionspluginsbase.btnenableplugin.caption"
msgid "E&nable"
msgstr "Ук&лючыць"
#: tfrmoptionspluginsbase.btnremoveplugin.caption
msgctxt "tfrmoptionspluginsbase.btnremoveplugin.caption"
msgid "&Remove"
msgstr "&Выдаліць"
#: tfrmoptionspluginsbase.btntweakplugin.caption
msgctxt "tfrmoptionspluginsbase.btntweakplugin.caption"
msgid "&Tweak"
msgstr "&Твікі"
#: tfrmoptionspluginsbase.lblplugindescription.caption
msgctxt "tfrmoptionspluginsbase.lblplugindescription.caption"
msgid "Description"
msgstr "Апісанне"
#: tfrmoptionspluginsbase.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Актыўна"
#: tfrmoptionspluginsbase.stgplugins.columns[1].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Убудова"
#: tfrmoptionspluginsbase.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Зарэгістравана на"
#: tfrmoptionspluginsbase.stgplugins.columns[3].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Назва файла"
#: tfrmoptionspluginsdsx.lblplugindescription.caption
msgctxt "tfrmoptionspluginsdsx.lblplugindescription.caption"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Убу&довы пошуку дазваляюць выкарыстоўваць дадатковыя алгарытмы пошуку альбо вонкавыя прылады (напрыклад, \"locate\" і т.п.)"
#: tfrmoptionspluginsgroup.btnpathtoberelativetoall.caption
msgid "Apply current settings to all current configured plugins"
msgstr ""
#: tfrmoptionspluginsgroup.ckbautotweak.caption
msgid "When adding a new plugin, automatically go in tweak window"
msgstr ""
#: tfrmoptionspluginsgroup.gbconfiguration.caption
msgid "Configuration:"
msgstr ""
#: tfrmoptionspluginsgroup.lbpathtoberelativeto.caption
msgid "Path to be relative to:"
msgstr ""
#: tfrmoptionspluginsgroup.lbpluginfilenamestyle.caption
msgid "Plugin filename style when adding a new plugin:"
msgstr ""
#: tfrmoptionspluginswcx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswcx.lblplugindescription.caption"
msgid "Pack&er plugins are used to work with archives"
msgstr "Убудовы &архіватараў дазваляюць працаваць з архівамі"
#: tfrmoptionspluginswcx.stgplugins.columns[0].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Актыўна"
#: tfrmoptionspluginswcx.stgplugins.columns[1].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Убудова"
#: tfrmoptionspluginswcx.stgplugins.columns[2].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Зарэгістравана на"
#: tfrmoptionspluginswcx.stgplugins.columns[3].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Назва файла"
#: tfrmoptionspluginswdx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswdx.lblplugindescription.caption"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Убудо&вы змесціва дазваляюць выводзіць дадатковыя звесткі аб файлах на панэлях пры пошуку альбо змене назваў файлаў"
#: tfrmoptionspluginswfx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswfx.lblplugindescription.caption"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "У&будовы файлавых сістэм дазваляюць злучацца з дыскамі, недаступнымі з аперацыйнай сістэмы альбо вонкавымі прыладамі кшталту Palm/PocketPC."
#: tfrmoptionspluginswlx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswlx.lblplugindescription.caption"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Уб&удовы прагляду дазваляюць праглядаць ва ўнутранай праграме прагляду файлы розных фарматаў (выявы, табліцы, базы даных і т.п.)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgid "&Beginning (name must start with first typed character)"
msgstr "&Пачатак (назва мусіць пачынацца з уведзеных сімвалаў)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgid "En&ding (last character before a typed dot . must match)"
msgstr "&Канец (апошнія сімвалы да ўведзенай кропкі мусяць супадаць)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Параметры"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Дакладнае супадзенне назвы"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Рэгістр пошуку"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Шукаць дадзеныя элементы"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Пакідаць змененую назву падчас разблакавання ўкладкі"
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Актываваць па&нэль націскам на адну з яе ўкладак"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgid "&Show tab header also when there is only one tab"
msgstr "&Паказваць загаловак укладкі нават калі яна адна"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Закрываць дублікаты ўкладак падчас закрыцця праграмы"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgid "Con&firm close all tabs"
msgstr "Патрабаваць пацвердж&ання падчас закрыцця ўсіх укладак"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Патрабаваць пацверджання падчас закрыцця ўсіх укладак"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr "&Найбольшая працягласць загалоўка ўкладкі"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgid "Show locked tabs &with an asterisk *"
msgstr "Пазначаць заблакаваныя ўкладкі \"*\""
#: tfrmoptionstabs.cbtabsmultilines.caption
msgid "&Tabs on multiple lines"
msgstr "&Размяшчаць укладкі ў некалькі радкоў"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&уверх адкрывае новую ўкладку"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgid "Open &new tabs near current tab"
msgstr "Адкрывае &новую ўкладку побач з бягучай"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Выкарыстоўваць бягучыя ўкладкі па магчымасці"
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgid "Show ta&b close button"
msgstr "Паказваць кнопку закрыцця ўк&ладкі"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Заўсёды паказваць літару дыска ў загалоўку ўкладкі"
#: tfrmoptionstabs.gbtabs.caption
msgid "Folder tabs headers"
msgstr "Загалоўкі ўкладак каталогаў"
#: tfrmoptionstabs.lblchar.caption
msgid "characters"
msgstr "сімвалаў"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Дзеянне па падвойнай пстрычцы па ўкладцы:"
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr "Пазіцыі ўк&ладак"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTEXISTINGTABSTOKEEP.TEXT"
msgid "None"
msgstr "Няма"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTSAVEDIRHISTORY.TEXT"
msgid "No"
msgstr "Не"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELLEFTSAVED.TEXT"
msgid "Left"
msgstr "Па леваму краю"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELRIGHTSAVED.TEXT"
msgid "Right"
msgstr "Па праваму краю"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr "Пераходзіць да налад выбраных укладак пасля перазахавання"
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr "Пераходзіць да налад выбраных укладак пасля стварэння новых"
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr "Уключыць дадатковыя параметры выбраных укладак "
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr "Прадвызначаныя дадатковыя налады для новых выбраных укладак:"
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr "Дадатковыя параметры выбраных каталогаў"
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr "Захоўваць існуючыя ўкладкі пасля аднаўлення:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr "Укладкі, захаваныя злева адновяцца:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr "Укладкі, захаваныя зправа, адновяцца:"
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Захоўваць гісторыю каталогаў для выбраных укладак:"
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr "Прадвызначаная пазіцыя ў меню падчас захавання новай выбранай укладкі:"
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} мусіць быць тут, каб задаць загад, што будзе запушчаны ў тэрмінале"
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} мусіць быць тут, каб задаць загад, што будзе запушчаны ў тэрмінале"
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} мусіць быць тут, каб задаць загад, што будзе запушчаны ў тэрмінале"
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Загад на запуск тэрмінала:"
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Загад на запуск загаду ў тэрмінале з закрыццём акна:"
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Загад на запуск загаду ў тэрмінале з адкрытым акном:"
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION"
msgid "Command:"
msgstr "Загад:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Параметры:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION"
msgid "Command:"
msgstr "Загад:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Параметры:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION"
msgid "Command:"
msgstr "Загад:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Параметры:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "Кл&анаваць кнопку"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "&Выдаліць"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgid "Edit hot&key"
msgstr "Рэдагаваць гарачую& клавішу"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgid "&Insert new button"
msgstr "&Уставіць новую клавішу"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Абраць"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Іншае..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr "Выдаліць гарачую& клавішу"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Прапановы"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr "Выплыўныя прапановы на падставе тыпу кнопкі, загаду і параметраў"
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "TFRMOPTIONSTOOLBAR.CBFLATBUTTONS.CAPTION"
msgid "&Flat buttons"
msgstr "&Плоскія кнопкі"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Паведаміць пра памылкі з загадамі"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Увядзіце параметры загаду, кожны ў асобным радку. F1- дапамога."
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Выгляд"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "Памер &панэлі:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgid "Comman&d:"
msgstr "Зага&д:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Парамет&ры:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION"
msgid "Help"
msgstr "Даведка"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Гарачая клавіша:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Зна&чок:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "&Памер значка:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgid "Co&mmand:"
msgstr "За&гад:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgid "&Parameters:"
msgstr "&Параметры:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLSTARTPATH.CAPTION"
msgid "Start pat&h:"
msgstr "Ш&лях запуску:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "&Падказка:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "Дадаць панэль прылад з усімі загадамі DC"
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "для вонкавага загаду"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "для ўнутранага загаду"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "для падзяляльніка"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "для дадатковай панэлі прылад"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION"
msgid "Backup..."
msgstr "Стварэнне файла аднаўлення..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION"
msgid "Export..."
msgstr "Экспарт..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Бягучая панэль прылад..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
msgid "to a Toolbar File (.toolbar)"
msgstr "у файл панэлі прылад (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
msgid "to a TC .BAR file (keep existing)"
msgstr "у файл TC .BAR (пакінуць існуючы)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
msgid "to a TC .BAR file (erase existing)"
msgstr "у файл TC .BAR (выдаліць існуючы)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "у файл \"wincmd.ini\" TC (пакінуць існуючы)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "у файл \"wincmd.ini\" TC (&ыдаліць існуючы)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Верхняя панэль прылад..."
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Захаваць файл аднаўлення панэлі прылад"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "у файл панэлі прылад (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "у файл TC .BAR (пакінуць існуючы)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "у файл TC .BAR (выдаліць існуючы)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "у файл \"wincmd.ini\" TC (пакінуць існуючы)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "у файл \"wincmd.ini\" TC (&ыдаліць існуючы)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "адразу пасля абранага"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "як першы элемент"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "як апошні элемент"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "адразу перад абраным"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION"
msgid "Import..."
msgstr "Імпарт..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Аднавіць панэль прылад з рэзервовай копіі"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "дадаць на бягучую панэль прылад"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "дадаць на новую панэль прылад у бягучай панэлі прылад"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "дадаць на новую панэль прылад найвышэйшай панэлі прылад"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "дадаць на найвышэйшую панэль прылад"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "замяніць найвышэйшую панэль прылад"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "з файла панэлі прылад (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "дадаць на бягучую панэль прылад"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "дадаць на новую панэль прылад у бягучай панэлі прылад"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "дадаць на новую панэль прылад найвышэйшай панэлі прылад"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "дадаць на найвышэйшую панэль прылад"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "замяніць найвышэйшую панэль прылад"
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "з адзіночнага файла TC .BAR"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "дадаць на бягучую панэль прылад"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "дадаць на новую панэль прылад у бягучай панэлі прылад"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "дадаць на новую панэль прылад найвышэйшай панэлі прылад"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "дадаць на найвышэйшую панэль прылад"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "замяніць найвышэйшую панэль прылад"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "з файла ТС \"&wincmd.ini\"..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "дадаць на бягучую панэль прылад"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "дадаць на новую панэль прылад у бягучай панэлі прылад"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "дадаць на новую панэль прылад найвышэйшай панэлі прылад"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "дадаць на найвышэйшую панэль прылад"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "замяніць найвышэйшую панэль прылад"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "адразу пасля абранага"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "як першы элемент"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "як апошні элемент"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "адразу перад абраным"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION"
msgid "Search and replace..."
msgstr "Знайсці і замяніць..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "адразу пасля абранага"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "як першы элемент"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "як апошні элемент"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "адразу перад абраным"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "ва ўсім вышэйзгаданым..."
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "ва ўсіх загадах..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "ва ўсіх назвах значкоў..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "ва ўсіх параметрах..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "ва ўсіх пачатковых шляхах..."
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "адразу пасля абранага"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "як першы элемент"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "як апошні элемент"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "адразу перад абраным"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Тып кнопкі"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "&Пакідаць адкрытым акно тэрмінала пасля запуску праграмы"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "&Запускаць у тэрмінале"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "&Выкарыстоўваць вонкавую праграму"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "&Дадатковыя параметры"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "&Шлях да запускаемай праграмы"
#: tfrmoptionstooltips.btnaddtooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnaddtooltipsfiletype.caption"
msgid "A&dd"
msgstr "&Дадаць"
#: tfrmoptionstooltips.btnapplytooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnapplytooltipsfiletype.caption"
msgid "A&pply"
msgstr "У&жыць"
#: tfrmoptionstooltips.btncopytooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btncopytooltipsfiletype.caption"
msgid "Cop&y"
msgstr "Капіраваць"
#: tfrmoptionstooltips.btndeletetooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btndeletetooltipsfiletype.caption"
msgid "Delete"
msgstr "Вы&даліць"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Шаблон..."
#: tfrmoptionstooltips.btnrenametooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnrenametooltipsfiletype.caption"
msgid "&Rename"
msgstr "&Змяніць назву"
#: tfrmoptionstooltips.btntooltipother.caption
msgctxt "tfrmoptionstooltips.btntooltipother.caption"
msgid "Oth&er..."
msgstr ""
#: tfrmoptionstooltips.bvltooltips1.caption
msgid "Tooltip configuration for selected file type:"
msgstr ""
#: tfrmoptionstooltips.bvltooltips2.caption
msgid "General options about tooltips:"
msgstr ""
#: tfrmoptionstooltips.chkshowtooltip.caption
msgid "&Show tooltip for files in the file panel"
msgstr "&Паказваць на файлавай панэлі выплыўныя падказкі"
#: tfrmoptionstooltips.lblfieldslist.caption
msgid "Category &hint:"
msgstr "Падказка&:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "&Маска катэгорыі:"
#: tfrmoptionstooltips.lbltooltiphidingdelay.caption
msgid "Tooltip hiding delay:"
msgstr ""
#: tfrmoptionstooltips.lbltooltipshowingmode.caption
msgid "Tooltip showing mode:"
msgstr ""
#: tfrmoptionstooltips.lbltooltipslistbox.caption
msgid "&File types:"
msgstr ""
#: tfrmoptionstooltips.mitooltipsfiletypediscardmodification.caption
msgid "Discard Modifications"
msgstr ""
#: tfrmoptionstooltips.mitooltipsfiletypeexport.caption
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeexport.caption"
msgid "Export..."
msgstr "Экспарт..."
#: tfrmoptionstooltips.mitooltipsfiletypeimport.caption
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeimport.caption"
msgid "Import..."
msgstr "Імпарт..."
#: tfrmoptionstooltips.mitooltipsfiletypesortfiletype.caption
msgid "Sort Tooltip File Types"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr "Падвойная пстрычка па верхняму радку файлавай панэлі"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "Пры дапамозе меню і ўнутранага загаду"
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr "Падвойная пстрычка па абранаму ў дрэве і выхад"
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION"
msgid "With the menu and internal command"
msgstr "Пры дапамозе меню і ўнутранага загаду"
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr "Падвойная пстрычка па ўкладцы"
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr "Калі выкарыстоўваецца спалучэнне клавіш, то акно закрыецца пасля выбару"
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr "Пстрычка мышы па абранаму ў дрэве і выхад"
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr "Выкарыстоўваць гісторыю загаднага радка"
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr "Выкарыстоўваць гісторыю каталога"
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr "Выкарыстоўваць гісторыю каталога (наведаныя каталогі)"
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr "Паводзіны пры абіранні:"
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr "Параметры меню ў выглядзе дрэва:"
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr "Дзе выкарыстоўваць меню ў выглядзе дрэва:"
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr "*НАТАТКА: Стан такіх параметраў, як адчувальнасць да рэгістра, ігнараванне акцэнтаў, захоўваецца для наступных выклікаў меню."
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr "З выбранымі каталогамі:"
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr "З выбранымі ўкладкамі:"
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr "З гісторыяй:"
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr "Выкарыстоўваць і паказваць спалучэнні клавіш для выбару элементаў"
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr "Параметры колераў і макет:"
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Колер фону:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Колер курсора:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Колер знойдзенага тэксту:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Колер знойдзенага тэксту пад курсорам:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Колер звычайнага тэксту:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Колер звычайнага тэксту пад курсорам:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Папярэдні прагляд:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr "Колер дадатковага тэксту:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr "Колер дадатковага тэксту пад курсорам:"
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Колер гарачай клавішы:"
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr "Колер гарачай клавішы пад курсорам:"
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr "Колер невылучаемага тэксту:"
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr "Колер невылучаемага тэксту пад курсорам:"
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr "Змяніце колеры злева, і вы ўбачыце як будзе выглядаць вашае меню."
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Прагляд у рэжыме кнігі"
#: tfrmoptionsviewer.gbviewerexample.caption
msgid "Example"
msgstr "Прыклад"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "&Колер фону ў рэжыме кнігі"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "&Колер шрыфту ў рэжыме кнігі"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "&Колькасць слупкоў у рэжыме кнігі"
#: tfrmpackdlg.btnconfig.caption
msgctxt "tfrmpackdlg.btnconfig.caption"
msgid "Con&figure"
msgstr "Нал&адзіць"
#: tfrmpackdlg.caption
msgid "Pack files"
msgstr "Запакаваць файлы"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Ства&рыць асобныя архівы, адзін архіў на кожны абраны файл/каталог"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Самара&спакоўваючыся архіў"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "Шыф&раванне"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Пера&мяшчаць у архіў"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Складаны архіў"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "≠>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "С&пачатку пакаваць у архў TAR"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Захоўваць &шлях"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Файл(ы) у архіве:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Архіватар"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Распакаваць у&сё і запусціць"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "&Распакаваць і запусціць"
#: tfrmpackinfodlg.caption
msgid "Properties of packed file"
msgstr "Уласцівасці запакаванага файла"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Атрыбуты:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Узровень сціскання:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Дата:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Метад:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Першапачатковы памер:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Файл:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Памер запакаванага:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Архіватар:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Час:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Закрыць панэль фільтравання"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Увядзіце тэкст для пошуку і фільтравання"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Зважаць на рэгістр"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "D"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "TFRMQUICKSEARCH.SBDIRECTORIES.HINT"
msgid "Directories"
msgstr "Каталогі"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "TFRMQUICKSEARCH.SBFILES.HINT"
msgid "Files"
msgstr "Файлы"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Супадае з пачаткам"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Супадае з канцом"
#: tfrmquicksearch.tglfilter.caption
msgid "Filter"
msgstr "Фільтраваць"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Пошук альбо фільтр"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "&Дадаць правіла"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "&Выдаліць правіла"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Выкарыстоўваць убудовы &змесціва, камбінаваць з:"
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
msgid "Plugin"
msgstr "Убудова"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Поле"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Аператар"
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Значэнне"
#: tfrmsearchplugin.headercontrol.sections[4].text
msgid "Unit"
msgstr ""
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&І (усе супадзенні)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&АЛЬБО (любое супадзенне)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Скасаваць"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "&Закрыць"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "&Даведка"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "&Абраць сімвалы для ўстаўкі:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmsetfileproperties.caption
msgid "Change attributes"
msgstr "Змяніць атрыбуты"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Мацуючы"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgid "Archive"
msgstr "Архіў"
#: tfrmsetfileproperties.chkcreationtime.caption
msgid "Created:"
msgstr "Створаны:"
#: tfrmsetfileproperties.chkhidden.caption
msgid "Hidden"
msgstr "Схаваны"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Апошні доступ:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Зменены:"
#: tfrmsetfileproperties.chkreadonly.caption
msgid "Read only"
msgstr "Толькі чытанне"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Уключаючы падкаталогі"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "tfrmsetfileproperties.chksystem.caption"
msgid "System"
msgstr "Сістэма"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Уласцівасці адбітку часу"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Атрыбуты"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Атрыбуты"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Біты:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Група"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(шэрае поле адпавядае нязменнаму значэнню)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Іншае"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Уладальнік"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Тэкст:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Выкананне"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION"
msgid "(gray field means unchanged value)"
msgstr "(шэрае поле адпавядае нязменнаму значэнню)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Васьмярковы:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Чытанне"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Запісаць"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmsplitter.caption
msgid "Splitter"
msgstr "Падзяляльнік"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Стварыць файл кантрольнай сумы"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Назва файла"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Памер і нумары частак"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "&Мэтавы каталог"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "&Зыходны файл"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "Колькасць частак"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Байтаў"
#: tfrmsplitter.rbtngigab.caption
msgid "&Gigabytes"
msgstr "&Гігабайтаў"
#: tfrmsplitter.rbtnkilob.caption
msgid "&Kilobytes"
msgstr "&Кілабайтаў"
#: tfrmsplitter.rbtnmegab.caption
msgid "&Megabytes"
msgstr "&Мегабайтаў"
#: tfrmstartingsplash.caption
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
msgid "Build"
msgstr "Зборка"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Аперацыйная сістэма"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Платформа"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Рэвізія"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr "Версія"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr "WidgetsetVer"
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Стварыць сімвалічную спасылку"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&На што паказвае спасылка"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Назва с&пасылкі"
#: tfrmsyncdirsdlg.actselectclear.caption
msgid "Remove selection"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopydefault.caption
msgid "Select for copying (default direction)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
msgid "Select for copying -> (left to right)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
msgid "Reverse copy direction"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
msgid "Select for copying <- (right to left)"
msgstr ""
#: tfrmsyncdirsdlg.actselectdeleteright.caption
msgid "Select for deleting -> (right)"
msgstr ""
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr "Закрыць"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr "Параўнаць"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Сінхранізаваць"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Сінхранізаваць каталогі"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "асіметрычна"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "па змесціву"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "не зважаць на дату"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "толькі абранае"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Падкаталогі"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Паказваць:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
msgid "Name"
msgstr "Назва"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
msgid "Size"
msgstr "Памер"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
msgid "Date"
msgstr "Дата"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
msgid "Date"
msgstr "Дата"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
msgid "Size"
msgstr "Памер"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
msgid "Name"
msgstr "Назва"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(у асноўным акне)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
msgid "Compare"
msgstr "Параўнаць"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Паказаць злева"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Паказаць зправа"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "дублікаты"
#: tfrmsyncdirsdlg.sbequal.caption
msgctxt "tfrmsyncdirsdlg.sbequal.caption"
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgctxt "tfrmsyncdirsdlg.sbnotequal.caption"
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "адзіночныя"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Калі ласка, націсніце \"Параўнаць\" каб пачаць"
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr "Сінхразаваць"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Пацвердзіць перазапіс"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Меню ў выглядзе дрэва"
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr "Абярыце ваш выбраны каталог:"
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr "Пошук ўлічвае рэгістр"
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr "Згарнуць усе"
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr "Разгарнуць усе"
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr "Пошук не ўлічвае акцэнты і лігатуры"
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr "Пошук не ўлічвае рэгістр"
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr "Пошук улічвае акцэнты і лігатуры"
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr "Калі радок знойдзены ў назве галіны, то змесціва галіны не будзе паказвацца"
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr "Калі радок знойдзены ў назве галіны, то будзе паказвацца ўся галіна"
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr "Закрыць меню ў выглядзе дрэва"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT"
msgid "Configuration of Tree View Menu"
msgstr "Наладка меню ў выглядзе дрэва"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT"
msgid "Configuration of Tree View Menu Colors"
msgstr "Наладка колераў меню ў выглядзе дрэва"
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "Д&адаць новы"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Скасаваць"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "&Змяніць"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "&Прадвызначана"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добра"
#: tfrmtweakplugin.btnrelativeplugin1.hint
msgctxt "tfrmtweakplugin.btnrelativeplugin1.hint"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmtweakplugin.btnrelativeplugin2.hint
msgctxt "tfrmtweakplugin.btnrelativeplugin2.hint"
msgid "Some functions to select appropriate path"
msgstr "Некаторыя функцыі для выбару адпаведнага шляху"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "&Выдаліць"
#: tfrmtweakplugin.caption
msgid "Tweak plugin"
msgstr "Наладка ўбудовы"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Выз&начыць тып архіву па змесціву"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Можа вы&даляць файлы"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Падтрымлівае &шыфраванне"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Пака&зваць як звычайныя файлы (хаваць значок архіву)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Падтрымлівае па&каванне ў памяць"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Можа &змяняць існуючыя архівы"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "У &архіве можа быць некалькі файлаў"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Можа ствараць новыя ар&хівы"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "&Мае дыялог параметраў"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Дазваляе шуаць тэкст у архівах"
#: tfrmtweakplugin.lbldescription.caption
msgid "&Description:"
msgstr "&Апісанне:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "&Радок выяўлення:"
#: tfrmtweakplugin.lblextension.caption
msgid "&Extension:"
msgstr "&Пашырэнне:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Сцягі:"
#: tfrmtweakplugin.lblname.caption
msgctxt "tfrmtweakplugin.lblname.caption"
msgid "&Name:"
msgstr "&Назва:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "tfrmtweakplugin.lblplugin.caption"
msgid "&Plugin:"
msgstr "&Убудова:"
#: tfrmtweakplugin.lblplugin2.caption
msgctxt "tfrmtweakplugin.lblplugin2.caption"
msgid "&Plugin:"
msgstr "&Убудова:"
#: tfrmviewer.actabout.caption
msgid "About Viewer..."
msgstr "Пра праграму для прагляду..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Паказвае паведамленне пра праграму"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr "Змяніць кадаванне"
#: tfrmviewer.actcopyfile.caption
msgctxt "tfrmviewer.actcopyfile.caption"
msgid "Copy File"
msgstr "Скапіраваць файл"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Скапіраваць файл"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "TFRMVIEWER.ACTCOPYTOCLIPBOARD.CAPTION"
msgid "Copy To Clipboard"
msgstr "Скапіраваць у буфер абмену"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr "Скапіраваць у буфер абмену з фарматаваннем"
#: tfrmviewer.actdeletefile.caption
msgctxt "tfrmviewer.actdeletefile.caption"
msgid "Delete File"
msgstr "Выдаліць файл"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Выдаліць файл"
#: tfrmviewer.actexitviewer.caption
msgctxt "TFRMVIEWER.ACTEXITVIEWER.CAPTION"
msgid "E&xit"
msgstr "&Выйсці"
#: tfrmviewer.actfind.caption
msgctxt "TFRMVIEWER.ACTFIND.CAPTION"
msgid "Find"
msgstr "Шукаць"
#: tfrmviewer.actfindnext.caption
msgctxt "TFRMVIEWER.ACTFINDNEXT.CAPTION"
msgid "Find next"
msgstr "Шукаць наступнае"
#: tfrmviewer.actfindprev.caption
msgctxt "TFRMVIEWER.ACTFINDPREV.CAPTION"
msgid "Find previous"
msgstr "Шукаць папярэдняе"
#: tfrmviewer.actfullscreen.caption
msgctxt "TFRMVIEWER.ACTFULLSCREEN.CAPTION"
msgid "Full Screen"
msgstr "На ўвесь экран"
#: tfrmviewer.actimagecenter.caption
msgid "Center"
msgstr "Па цэнтры"
#: tfrmviewer.actloadnextfile.caption
msgid "&Next"
msgstr "&Наступны"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Загрузіць наступны файл"
#: tfrmviewer.actloadprevfile.caption
msgid "&Previous"
msgstr "&Папярэдні"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Загрузіць папярэдні файл"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr "Адлюстраваць гарызантальна"
#: tfrmviewer.actmirrorhorz.hint
msgid "Mirror"
msgstr "Адлюстроўванне"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr "Адлюстраваць вертыкальна"
#: tfrmviewer.actmovefile.caption
msgctxt "tfrmviewer.actmovefile.caption"
msgid "Move File"
msgstr "Перамясціць файл"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Перамясціць файл"
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Папярэдні прагляд"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Перазагрузіць"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Перазагрузіць бягучы файл"
#: tfrmviewer.actrotate180.caption
msgid "+ 180"
msgstr "+180"
#: tfrmviewer.actrotate180.hint
msgid "Rotate 180 degrees"
msgstr "Павярнуць на 180 градусаў"
#: tfrmviewer.actrotate270.caption
msgid "- 90"
msgstr "- 90"
#: tfrmviewer.actrotate270.hint
msgid "Rotate -90 degrees"
msgstr "Павярнуць на -90 градусаў"
#: tfrmviewer.actrotate90.caption
msgid "+ 90"
msgstr "+ 90"
#: tfrmviewer.actrotate90.hint
msgid "Rotate +90 degrees"
msgstr "Павярнуць на +90 градусаў"
#: tfrmviewer.actsave.caption
msgctxt "TFRMVIEWER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Захаваць"
#: tfrmviewer.actsaveas.caption
msgid "Save As..."
msgstr "Захаваць як..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Захаваць файл як..."
#: tfrmviewer.actscreenshot.caption
msgctxt "TFRMVIEWER.ACTSCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Здымак экрана"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "Затрымка 3 секунды"
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "Затрымка 5 секунд"
#: tfrmviewer.actselectall.caption
msgctxt "TFRMVIEWER.ACTSELECTALL.CAPTION"
msgid "Select All"
msgstr "Абраць усё"
#: tfrmviewer.actshowasbin.caption
msgid "Show as &Bin"
msgstr "Паказаць у &двайковым выглядзе"
#: tfrmviewer.actshowasbook.caption
msgid "Show as B&ook"
msgstr "Паказаць як к&нігу"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr "Паказаць у д&зесятковым выглядзе"
#: tfrmviewer.actshowashex.caption
msgid "Show as &Hex"
msgstr "Паказаць у ша&снаццатковым выглядзе"
#: tfrmviewer.actshowastext.caption
msgid "Show as &Text"
msgstr "Паказаць як &тэкст"
#: tfrmviewer.actshowaswraptext.caption
msgid "Show as &Wrap text"
msgstr "Паказаць як тэкст з &пераносам"
#: tfrmviewer.actshowgraphics.caption
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Графіка"
#: tfrmviewer.actshowplugins.caption
msgctxt "TFRMVIEWER.ACTSHOWPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Убудовы"
#: tfrmviewer.actstretchimage.caption
msgid "Stretch"
msgstr "Па памерах акна"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Усе выявы па памерах акна"
#: tfrmviewer.actstretchonlylarge.caption
msgid "Stretch only large"
msgstr "Толькі вялікія выявы па памерах акна"
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Маштаб"
#: tfrmviewer.actzoomin.caption
msgid "Zoom In"
msgstr "Наблізіць"
#: tfrmviewer.actzoomout.caption
msgid "Zoom Out"
msgstr "Аддаліць"
#: tfrmviewer.btncuttuimage.hint
msgid "Crop"
msgstr "Пакінуць абранае"
#: tfrmviewer.btnfullscreen.hint
msgctxt "tfrmviewer.btnfullscreen.hint"
msgid "Full Screen"
msgstr "На ўвесь экран"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "Пдз"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Падсвятленне"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Маляванне"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Чырвоныя вочы"
#: tfrmviewer.btnresize.hint
msgid "Resize"
msgstr "Змяніць памер"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Адвярнуць"
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Праграма для прагляду"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Слайдшоў"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Аловак"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "tfrmviewer.gboxhightlight.caption"
msgid "Highlight"
msgstr "Падсвятленне"
#: tfrmviewer.gboxpaint.caption
msgctxt "tfrmviewer.gboxpaint.caption"
msgid "Paint"
msgstr "Маляванне"
#: tfrmviewer.gboxslideshow.caption
msgctxt "tfrmviewer.gboxslideshow.caption"
msgid "Slide Show"
msgstr "Слайдшоў"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Праглядзець"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "Пра праграму"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Рэдагаваць"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Кадаванне"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Файл"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Выява"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Друкаваць..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Павярнуць"
#: tfrmviewer.miscreenshot.caption
msgctxt "tfrmviewer.miscreenshot.caption"
msgid "Screenshot"
msgstr "Здымак экрана"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Праглядзець"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Абраць усё"
#: tfrmviewoperations.btnstartpause.caption
msgctxt "tfrmviewoperations.btnstartpause.caption"
msgid "&Start"
msgstr "&Пачаць"
#: tfrmviewoperations.btnstop.caption
msgid "S&top"
msgstr ""
#: tfrmviewoperations.caption
msgctxt "tfrmviewoperations.caption"
msgid "File operations"
msgstr "Файлавыя аперацыі"
#: tfrmviewoperations.cbalwaysontop.caption
msgid "Always on top"
msgstr ""
#: tfrmviewoperations.lblusedragdrop.caption
msgid "&Use \"drag && drop\" to move operations between queues"
msgstr ""
#: tfrmviewoperations.mnucanceloperation.caption
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
msgid "Cancel"
msgstr "Скасаваць"
#: tfrmviewoperations.mnucancelqueue.caption
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
msgid "Cancel"
msgstr "Скасаваць"
#: tfrmviewoperations.mnunewqueue.caption
msgctxt "tfrmviewoperations.mnunewqueue.caption"
msgid "New queue"
msgstr "Новая чарга"
#: tfrmviewoperations.mnuoperationshowdetached.caption
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.mnuputfirstinqueue.caption
msgid "Put first in queue"
msgstr ""
#: tfrmviewoperations.mnuputlastinqueue.caption
msgid "Put last in queue"
msgstr ""
#: tfrmviewoperations.mnuqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue.caption"
msgid "Queue"
msgstr "Чарга"
#: tfrmviewoperations.mnuqueue0.caption
msgid "Out of queue"
msgstr ""
#: tfrmviewoperations.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Чарга 1"
#: tfrmviewoperations.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Чарга 2"
#: tfrmviewoperations.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Чарга 3"
#: tfrmviewoperations.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Чарга 4"
#: tfrmviewoperations.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Чарга 5"
#: tfrmviewoperations.mnuqueueshowdetached.caption
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.tbpauseall.caption
msgid "&Pause all"
msgstr ""
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Калі файл існуе"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Калі файл існуе"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION"
msgid "Copy d&ate/time"
msgstr "Скапіраваць &дату/час"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Працаваць у фоне (асобнае злучэнне)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Калі файл існуе"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr "Дата здымкі"
#: uexifreader.rsimageheight
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Вышыня"
#: uexifreader.rsimagewidth
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Шырыня"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr "Вытворца"
#: uexifreader.rsmodel
msgid "Camera model"
msgstr "Мадэль камеры:"
#: uexifreader.rsorientation
msgid "Orientation"
msgstr "Арыентацыя"
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
"Файл кантрольнай сумы можа аб'яднаць файл, але яго не атрымалася знайсці:\n"
"%s\n"
"\n"
"Вы можаце зрабіць яго даступным і націснуць \"Добра\",\n"
"альбо націснуць \"Скасаваць\", каб працягнуць без яго.\n"
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Скасаваць хуткае фільтраванне"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Скасаваць бягучую аперацыю"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Увядзіце назву файла з пашырэннем"
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Фармат тэксту для імпартавання"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Памылка:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Асноўны:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Не знойдзена:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Падчас чытання адбылася памылка:"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Паспяхова:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Увядзіце кантрольную суму і абярыце алгарытм:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Праверка кантрольнай сумы"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Агулам:"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr "Хочаце ачысціць фільтры падчас новага пошуку?"
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "У буферы абмену няма патрэбных даных панэлі прылад."
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr "Усе;Актыўная панэль;Левая панэль;Правая панэль;Файлавыя аперацыі;Канфігурацыя;Сетка;Рознае;Паралельны порт;Друк;Пазначэнне;Бяспека;Буфер абмену;FTP;Навігацыя;Дапамога;Акно;Загадны радок;Прылады;Выгляд;Карыстальнік;Укладкі;Упарадкаванне;Лог"
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr "Прадвызначана; па алфавіце"
#: ulng.rscolattr
msgid "Attr"
msgstr "Атр"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Дата"
#: ulng.rscolext
msgid "Ext"
msgstr "Паш"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Назва"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Памер"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Выроўніванне"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Загаловак"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Выдаліць"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Змесціва поля"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Перамясціць"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Шырыня"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Наладзіць слупок"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Наладзіць асацыяцыі файлаў"
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "Пацверджанне загаднага радка і параметры"
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Копія (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Імпартаваная панэль прылад DC"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Імпартаваная панэль прылад TC"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "_DroppedText"
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "_DroppedHTMLtext"
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "_DroppedRichtext"
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "_DroppedSimpleText"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "_DroppedUnicodeUTF16text"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "_DroppedUnicodeUTF8text"
#: ulng.rsdiffadds
msgid " Adds: "
msgstr " Дададзена: "
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr " Выдалена: "
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "Два файла аднолькавыя!"
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr " Супадзенні: "
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr " Змены: "
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "&Скасаваць"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "&Усе"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "Дапісаць у &канец"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "&Аўтаматычная змена назвы зыходных файлаў"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Скасаваць"
#: ulng.rsdlgbuttoncompare
msgid "Compare &by content"
msgstr ""
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Працягнуць"
#: ulng.rsdlgbuttoncopyinto
msgid "&Merge"
msgstr "&Аб'яднаць"
#: ulng.rsdlgbuttoncopyintoall
msgid "Mer&ge All"
msgstr "Аб&'яднаць усе"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "&Выйсці з праграмы"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr "Не &зважаць"
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "&Не зважаць ні на што"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Не"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "Ні&чога"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&Добра"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "&Іншае"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Перазапісаць"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Перазапісаць &усе"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Перазапісаць усе бол&ьшыя"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Перазапісаць усе ста&рэйшыя"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Перазапісаць усе мень&шыя"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "&Змяніць назву"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Працягнуць"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Паў&тарыць"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr "Як ад&міністратар"
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Прамінуць"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Пра&мінуць усё"
#: ulng.rsdlgbuttonunlock
msgid "&Unlock"
msgstr ""
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Так"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Капіраваць файл(ы)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Перамясціць файл(ы)"
#: ulng.rsdlgoppause
msgid "Pau&se"
msgstr "Пры&пыніць"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&Пачаць"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Чарга"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Хуткасць %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Хуткасць %s/s , часу засталося %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr "Фармат RTF;Фармат HTML;Тэкст Unicode;Просты тэкст"
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<няма адмеціны>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<няма медыя>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Унутраны рэдактар Double Commander."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Перайсці ў радок:"
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr "Перайсці ў радок"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "новы.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Назва файла:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Адкрыць файл"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Назад"
#: ulng.rseditsearchcaption
msgid "Search"
msgstr "Пошук"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "&Далей"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Замяніць"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "у вонкавым рэдактары"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "ва унутраным рэдактары"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Запусціць у абалонцы"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Запусціць у тэрмінале і закрыць"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Запусціць у тэрмінале і пакінуць адкрытым"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Злева;Зправа;У актыўнай;У неактыўнай;У абедзвюх;Няма"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Не;Так"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Exported_from_DC"
#: ulng.rsfileopcopymovefileexistsoptions
msgid "Ask;Overwrite;Skip"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
msgid "Ask;Merge;Skip"
msgstr "Пытацца;Аб'ядноўваць;Прамінаць"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Пытацца;Перазапісваць;Перазапісваць старэйшыя;Прамінаць"
#: ulng.rsfileopsetpropertyerroroptions
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Пытацца;Ніколі не прызначаць;Не зважаць на памылкі"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "ФІЛЬТР"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Задаць шаблон"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s узровень(ні)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "усё (неабмежавана)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "толькі бягучы каталог"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Каталог %s не існуе!"
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Знойдзена: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Захаваць шаблон пошуку"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Назва шаблона:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Прасканавана: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Сканаванне"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Пошук файлаў"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Час сканавання: "
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Пачынаць з"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Вольна %s з %s байтаў"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s байт вольна"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Дата/час доступу"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Атрыбуты"
#: ulng.rsfunccomment
msgid "Comment"
msgstr "Каментар"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Памер у сціснутым выглядзе"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Дата/час стварэння"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Пашырэнне"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Група"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Змяніць дату/час"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Спасылка на"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Дата/час змены"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Назва"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Назва без пашырэння"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Уладальнік"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Шлях"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Памер"
#: ulng.rsfunctype
msgid "Type"
msgstr "Тып"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Падчас стварэння жорсткай спасылкі адбылася памылка."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "няма;назва, а-я;назва, я-а;тып, а-я;тып, я-а;памер 9-0;памер 0-9;дата 9-0;дата 0-9"
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"Увага! Аднаўленне з рэзервовай копіі ачысціць спіс існуючых выбраных каталогаў і заменіць імпартуемым.\n"
"\n"
"Хочаце працягнуць?\n"
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Дыялог капіравання/перамяшчэння"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Адрозненні"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Дыялог рэдагавання каментара"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Рэдактар"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Пошук файлаў"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Асноўныя"
#: ulng.rshotkeycategorysyncdirs
msgid "Synchronize Directories"
msgstr ""
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Праграма для прагляду"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
"Файл з такой назвай ужо існуе.\n"
"Перазапісаць яго?\n"
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr "Сапраўды аднавіць прадвызначаныя значэнні?"
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr "Сапраўды хочаце сцерці набор \"%s\"?"
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr "Копія %s"
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr "Увядзіце новую назву"
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr "Вы мусіце пакінуць не менш за адзін файл гарачых клавіш."
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr "Новая назва"
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
"Файл \"%s\" быў зменены.\n"
"Хочаце захаваць яго?\n"
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr "Не выкарыстоўваць \"ENTER\""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr "Па назве загаду; Па гарачых клавішах (групамі); Па гарачых клавішах (па адной)"
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "Не атрымалася знайсці спасылку на файл прадвызначанай панэлі прылад"
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr "Спіс акон \"Пошук файлаў\""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Скасаваць вылучэнне"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Абраць маску"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Уваходная маска:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Набор слупкоў з такой назвай ужо існуе."
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr "Змяніць альбо ЗАХАВАЦЬ, СКАПІРАВАЦЬ альбо ВЫДАЛІЦЬ бягучы набор слупкоў"
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Наладзіць адвольныя слупкі"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Увесці назву новых адвольных слупкоў"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Дзеянні"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr "Скапіраваць назвы ў буфер са шляхам UNC"
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Адлучыць сеткавы дыск..."
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Рэдагаваць"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Выняць"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Распакаваць сюды..."
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Мапа сеткавага дыска..."
#: ulng.rsmnumount
msgid "Mount"
msgstr "Прымантаваць"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Новы"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Няма даступных медыя"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Адкрыць"
#: ulng.rsmnuopenwith
msgctxt "ulng.rsmnuopenwith"
msgid "Open with"
msgstr "Адкрыць у"
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Іншае..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Запакаваць сюды..."
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Упарадкаваць па"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Адмантаваць"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Праглядзець"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Рахунак:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr "Усе ўнутраныя загады Double Commander"
#: ulng.rsmsgapplicationname
msgid "Description: %s"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Дадатковыя парметры для загаднага радка архіватара:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr "Узяць у двукоссі?"
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"Хібны CRC32 выніковага файла:\n"
"\"%s\"\n"
"\n"
"Усё роўна хочаце пакінуць пашкоджаны файл?\n"
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Нельга скапіраваць/перамясціць файл \"%s\" у саіога сябе!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Немагчыма выдаліць каталог %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr "Немагчыма перазапісаць каталог \"%s\" файлам, што не з'яўляецца каталогам \"%s\""
#: ulng.rsmsgchdirfailed
msgid "Change current directory to \"%s\" failed!"
msgstr "Не атрымалася перайсці ў каталог [%s]!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Выдаліць усе неактыўныя ўкладкі?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Гэтая ўкладка (%s) заблакавана! Закрыць усё роўна?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr "Пацверджанне параметра"
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Сапраўды хочаце выйсці?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "Файл %s зменены. Скапіраваць яго назад?"
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "Не атрымалася скапіраваць назад. Захаваць зменены файл?"
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Капіраваць %d абраныя файлы/каталогі?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Капіраваць абраны \"%s\"?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Стварыць новы тып файла \"%s файлы\" >"
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Увядзіце назву і размяшчэнне файла панэлі прылад DC"
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Адвольнае дзеянне"
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Выдаліць часткова скапіраваны файл?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Выдаліць %d абраныя файлы/каталогі?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Выдаліць %d абраныя файлы/каталогі ў сметніцу?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Выдаліць абраны \"%s\"?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Выдаліць абраны \"%s\" у сметніцу?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Не атрымалася выдаліць \"%s\" у сметніцу! Выдаліць назаўжды?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Дыск недаступны"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr "Увядзіце назву адвольнага дзеяння:"
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Увядзіце пашырэнне файла:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Увядзіце назву:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Увядзіце назву новага тыпу для пашырэння \"%s\""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Кантрольная сума архіву пашкоджана"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Хібныя даныя"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Немагчыма злучыцца з серверам : \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Немагчыма скапіраваць файл %s у %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Каталог з назвай \"%s\" ужо існуе."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Дата % не падтрымліваецца"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Каталог %s ужо існуе!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Функцыя скасаваная карыстальнікам"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Пдчас закрыцця файла адбылася памылка"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Немагчыма стварыць файл"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Больш няма файлаў у архіве"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Немагчыма адкрыць існуючы файл"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Падчас чытання файла адбылася памылка"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Падчас запісу ў файл адбылася памылка"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Немагчыма стварыць каталог %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Хібная спасылка"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Файлаў не знойдзена"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Не стае памяці"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Функцыя не падтрымліваецца!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Памылка ў кантэкстным меню загада"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Падчас загрузкі налад адбылася памылка"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Памылка сінтаксісу ў рэгулярным выразе!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Немагчыма змяніць назву файла з %s на %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Не атрымалася захаваць асацыяцыю!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Немагчыма захаваць файл"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Немагчыма прызначыць атрыбуты для \"%s\""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Немагчыма прызначыць дату/час для '%s\""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Немагчыма прызначыць уладальніка/групу для \"%s\""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "Немагчыма прызначыць дазволы для \"%s\""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Буфер абмену занадта малы"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Занадта шмат файлаў для архіву"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Невядомы фармат архіву"
#: ulng.rsmsgexecutablepath
msgid "Executable: %s"
msgstr ""
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "Сапраўды выдаліць усе аб'екты з вашых \"выбраных укладак\"? (Адрабіць не атрымаецца!)"
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Перацягніце сюды іншыя запісы"
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name for this new Favorite Tabs entry:"
msgstr "Увядзіце назву гэтых выбраных укладак"
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "Захаванне новых выбраных укладак"
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Колькасць паспяхова экспартаваных выбраных укладак: %d з %d"
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr "Захаваць гісторыю каталогаў для новых выбраных укладак:"
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Колькасць паспяхова імпартаваных укладк: %d on %d"
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Імпартаваныя ўкладкі"
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr "Абярыце файлы .tab для імпарту (можна некалькі запар!)"
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr "Апошнія змены выбраных укладак яшчэ не захаваліся. Захаваць іх перш чым працягнуць?"
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Захоўваць гісторыю каталогаў для выбраных укладак:"
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Назва падменю"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "Загрузяцца выбраныя ўкладкі: \"%s\""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr "Захаваць бягучыя ўкладкі паверх існуючых выбраных укладак"
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Файл %s быў зменены , захаваць?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s байт, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Перазапісаць:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Файл %s ужо існуе , перазапісаць?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "З файлам:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Файл \"%s\" не знойдзены."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Актыўныя файлавыя аперацыі"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Яшчэ выконваюцца аперацыі з файламі. Калі закрыць Double Commander, даныя могуць страціцца."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
"Даўжыня (%d) перавышае %d сімвалаў!\n"
"%s\n"
"Большасць праграм не зможа звярнуцца да файла/каталога з такой доўгай назвай!\n"
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Файл %s пазначаны як толькі для чытання/схаваны/сістэмны. Выдаліць яго ?"
#: ulng.rsmsgfilereloadwarning
msgid "Are you sure you want to reload the current file and lose the changes?"
msgstr ""
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "Памер файла \"%s\" занадта вялікі для файлавай сістэмы!"
#: ulng.rsmsgfolderexistsrwrt
msgid "Folder %s exists, merge?"
msgstr "Каталог %s ужо існуе , аб'яднаць?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Выкарыстоўваць спасылку \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Абраць фармат тэксту для імпарту"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Дадаць %d абраных каталогаў"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Дадаць абраны каталог: "
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Дадаць бягучы каталог: "
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Выканаць загад"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_somthing"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Налады спіса выбраных каталогаў"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Сапраўды выдаліць усе аб'екты з вашых \"выбраных каталогаў\"? (Адрабіць не атрымаецца!)"
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Гэта запусціць наступны загад:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "Гэта выбраны каталог па назве "
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Гэта зменіць актыўную панэль па наступным шляху:"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "І зменіць неактыўную панэль на наступны шлях:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Падчас стварэння рэзервовай копіі адбылася памылк..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Падчас экспарту адбылася памылка..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Экспартаваць усё!"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Экспарт выбраных каталогаў - абярыце аб'екты для экспарту"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Экспартаваць абранае"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Імпартаваць усе!"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Імпарт выбраных каталогаў - абярыце аб'екты для імпарту"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Імпартаваць абранае"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "&Шлях:"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Абярыце файл \".hotlist\" для імпарту"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Назва выбранага каталога"
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Колькасць новых запісаў: %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "На экспарт нічога не абрана!"
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Шлях да выбранага каталога"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Зноў дадаць выбраны каталог: "
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Зноў дадаць бягучы каталог: "
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Увядзіце размяшчэнне і назву файла выбраных каталогаў для аднаўлення"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Загад:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(канец падменю)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Назва &меню:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "&Назва:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(падзяляльнік)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Назва падменю"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Шлях да мэтавага выбранага каталога"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Вызначае парадак сартавання ў актыўнай панэлі пасля змены каталога"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Вызначае парадак сартавання ў неактыўнай панэлі пасля змены каталога"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Некаторыя функцыі абірання шляху: адносны, абсалютны, адмысловыя каталогі windows і г.д."
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Захавана агулам: %d\n"
"\n"
"Рэзервовая копія: %s\n"
"\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Экспартавана агулам: "
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"Хочаце выдаліць усе элементы ў падменю [%s]?\n"
"Калі адкажаце \"Не\", то выдаляцца толькі падзяляльнікі, элементы застануцца.\n"
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Абярыце размяшчэнне і назву для захавання файла выбраных каталогаў"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Хібная выніковая даўжыня файла : \"%s\""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Калі ласка, ўстаўце наступны дыск альбо носьбіт.\n"
"\n"
"Гэта дазволіць запісаць файл:\n"
"\"%s\"\n"
"\n"
"Колькасць застаўшыхся байтаў: %d\n"
"\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Памылка ў загадным радку"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Хібная назва"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Хібны фармат файла налад"
#: ulng.rsmsginvalidhexnumber
msgid "Invalid hexadecimal number: \"%s\""
msgstr ""
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Хібны шлях"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "У шляху %s ёсць забароненыя сімвалы."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Хібная ўбудова!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Убудова сабрана для Double Commander для %s.%sЯна не будзе працаваць для %s!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Хібнае цытаванне"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Хібнае вылучэнне."
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Спіс файлаў загружаецца..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr "Вызначце файл канфігурацыі (wincmd.ini)"
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "Вызначце запускальны файл (totalcmd.exe or totalcmd64.exe)"
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Скапіраваць файл %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Выдаліць файл %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Памылка: "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr "Запусціць вонкавы загад"
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr "Вынікі вонкавага загаду"
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Распакаваць файл %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Інфармацыя: "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Стварыць спасылку %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Стварыць каталог %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Перамясціць файл %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Запакаваць у файл %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Выдаліць каталог %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Завершана: "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Стварыць спасылку %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Праверыць файл %s на цэласнасць"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Сцерці файл %s"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Сцерці каталог %s"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Галоўны пароль"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Калі ласка, ўвядзіце галоўны пароль:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Новы файл"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Наступны том будзе распакаваны"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Няма файлаў"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Файлаў не абрана."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "На мэтавым дыску не стае вольнага месца. Працягнуць?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "На мэтавым дыску не стае вольнага месца. Паспрабаваць зноў?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Немагчыма выдаліць файл %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Не вызначана."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr "Аб'ект не існуе!"
#: ulng.rsmsgopeninanotherprogram
msgid "The action cannot be completed because the file is open in another program:"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Ніжэй знаходзіцца папярэдні прагляд. Вы можаце перамяшчаць курсор і вылучаць файлы, каб паспрабаваць абраныя налады."
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Пароль:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Паролі адрозніваюцца!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Калі ласка , увядзіце пароль:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Пароль (Firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Калі ласка, увядзіце пароль яшчэ раз для праверкі:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Выдаліць %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Шаблон \"%s\" ужо існуе. Перазапісаць?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Не атрымалася запусціць загад (%s)"
#: ulng.rsmsgprocessid
msgid "PID: %d"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Назва файла перацягваемага тэксту:"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Калі ласка, зрабіце файл даступным. Паўтарыць?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Увядзіце новую прыемную назву для гэтых выбраных укладак"
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Увядзіце новую назву гэтага меню"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Змяніць назву/перамясціць %d абраныя файлы/каталогі?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Змяніць назву/перамясціць абраны \"%s\"?"
#: ulng.rsmsgreplacethistext
msgid "Do you want to replace this text?"
msgstr ""
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Калі ласка, перазапусціце Double Commander, каб ужыць змены"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Абярыце тып файла, каб дадаць пашырэнне \"%s\""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Абрана: %s з %s, файлаў: %d з %d, каталогаў: %d з %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Абярыце запускальны файл для"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Калі ласка, абірайце толькі файлы кантрольнай сумы!"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Калі ласка, абярыце размяшчэнне наступнага раздзела"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Прызначыць тому адмеціну"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Адмысловыя каталогі"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Дадаць шлях з актыўнай панэлі"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Дадаць шлях з неактыўнай панэлі"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Праглядзець і выкарыстаць абраны шлях"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Выкарыстоўваць зменную асяроддзя..."
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Каталог Double Commander..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Зменная асяроддзя..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Адмысловы каталог Windows..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Адмысловы каталог Windows (TC)..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Зрабіць адносным шляху выбраных каталогаў"
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Зрабіць шлях абсалютным"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Зрабіць адносным шляху да адмысловага каталога Double Commander..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Зрабіць адноснай зменнай асяроддзя..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Зрабіць адноснай адмысловаму каталогу Windows (TC)..."
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Зрабіць адноснай адмысловаму каталогу Windows..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Выкарыстаць адмысловыя шляхі Double Commander..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr "Выкарыстаць шлях выбраных каталогаў"
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Выкарыстаць іншы адмысловы каталог Windows..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Выкарыстаць адмысловы каталог Windows(TC)..."
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr "Гэтая ўкладка (%s) заблакавана! Адкрыць каталог у іншай укладцы?"
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Змяніць назву ўкладкі"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Новая назва ўкладкі:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Мэтавы шлях:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Памылка! Не атрымалася знайсці файл канфігурацыі ТС:\n"
" %s\n"
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Памылка! Не атрымалася знайсці запускальны файл ТС:\n"
" %s\n"
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Памылка! ТС яшчэ запушчаны, а для выканання гэтай аперацыі яго неабходна закрыць.\n"
"Закрыйце і націсніце \"Добра\" альбо націсніце \"Скасаваць\".\n"
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Памылка! Не атрымалася знайсці каталог панэлі прылад TC:\n"
"%s\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Увядзіце назву і шлях да захаванага файла панэлі прылад TC"
#: ulng.rsmsgterminateprocess
msgid "WARNING: Terminating a process can cause undesired results including loss of data and system instability. The process will not be given the chance to save its state or data before it is terminated. Are you sure you want to terminate the process?"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr "\"%s\" знаходзіцца ў буферы абмену"
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr "Пашырэнне абранага файла не адпавядае ніводнаму з вядомых тыпаў файлаў"
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Вызначце файл \".toolbar\" для імпарту"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Вызначце файл \".BAR\" для імпарту"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Увядзіце размяшчэнне і назву файла панэлі прылад для аднаўлення"
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Захавана!\n"
"Назва файла панэлі прылал: %s\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Занадта многа файлаў ."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Невызначаны"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr "ПАМЫЛКА: Нечаканае выкарыстанне меню!"
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "< БЕЗ ПАШЫРЭННЯ>"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr "<БЕЗ НАЗВЫ>"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Імя карыстальніка:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Імя карыстальніка (Firewall):"
#: ulng.rsmsgverify
msgid "VERIFICATION:"
msgstr "ПРАВЕРКА:"
#: ulng.rsmsgverifychecksum
msgid "Do you want to verify selected checksums?"
msgstr ""
#: ulng.rsmsgverifywrong
msgid "The target file is corrupted, checksum mismatch!"
msgstr "Мэтавы файл пашкоджаны, кантрольная сума не супадае!"
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Адмеціна раздзела:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Калі ласка, ўвядзіце памер раздзела:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Сцерці %d абраныя файлы/каталогі?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Сцерці абраны \"%s\"?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "з"
#: ulng.rsmsgwrongpasswordtryagain
msgid ""
"Wrong password!\n"
"Please try again!\n"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr "Аўтаматычна змяняць назву на \"name (1).ext\", \"name (2).ext\" и г.д.?"
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Без змен;ВЕРХНІ РЭГІСТР;ніжні рэгістр;З вялікай;Кожнае Слова З Вялікай;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr "Увага, назвы дублюцца!"
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr "Файл змяшчае хібную колькасць радкоў: %d, мусіць быць %d!"
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr "Пакінуць;Ачысціць;Спытаць"
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr "Адпаведны ўнутраны загад адсутнічае"
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr "Выбачайце, вокны пошуку файлаў адсутнічаюць..."
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr "Выбачайце, іншыя вокны пошуку файлаў адсутнічаюць..."
#: ulng.rsopenwithdevelopment
msgid "Development"
msgstr ""
#: ulng.rsopenwitheducation
msgid "Education"
msgstr ""
#: ulng.rsopenwithgames
msgid "Games"
msgstr ""
#: ulng.rsopenwithgraphics
msgctxt "ulng.rsopenwithgraphics"
msgid "Graphics"
msgstr "Графіка"
#: ulng.rsopenwithmultimedia
msgid "Multimedia"
msgstr ""
#: ulng.rsopenwithnetwork
msgctxt "ulng.rsopenwithnetwork"
msgid "Network"
msgstr "Сетка"
#: ulng.rsopenwithoffice
msgid "Office"
msgstr ""
#: ulng.rsopenwithother
#, fuzzy
msgctxt "ulng.rsopenwithother"
msgid "Other"
msgstr "Іншае"
#: ulng.rsopenwithscience
msgid "Science"
msgstr ""
#: ulng.rsopenwithsettings
msgid "Settings"
msgstr ""
#: ulng.rsopenwithsystem
#, fuzzy
msgctxt "ulng.rsopenwithsystem"
msgid "System"
msgstr "Сістэма"
#: ulng.rsopenwithutility
msgid "Accessories"
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Скасавана"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Падлік кантрольнай сумы"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Падлік кантрольнай сумы ў \"%s\""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "Падлік кантрольнай сумы '\"%s\""
#: ulng.rsopercalculatingstatictics
msgid "Calculating"
msgstr "Падлік"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Падлік \"%s\""
#: ulng.rsopercombining
msgid "Joining"
msgstr "Аб'яднанне"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Аб'яднанне файлаў \"%s\" у \"%s\""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Капіраванне"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Капіраванне з \"%s\" у \"%s\""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Капіраванне \"%s\" у \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Стварэнне каталога"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Стварэнне каталога \"%s\""
#: ulng.rsoperdeleting
msgid "Deleting"
msgstr "Выдаленне"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Выдаленне ў \"%s\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Выдаленне \"%s\""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Запуск"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Запуск \"%s\""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Выманне"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Выманне з \"%s\" у \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Завершана"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Спіс"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Спіс \"%s\""
#: ulng.rsopermoving
msgid "Moving"
msgstr "Перамяшчэнне"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Перамяшчэнне з \"%s\" у \"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Перамяшчэнне \"%s\" у \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Не запушчана"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Запакоўванне"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Запакоўванне з \"%s\" у \"%s\""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Запакоўванне \"%s\" у '%s\""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Прыпынена"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Прыпыненне"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Выконваецца"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Вызначэнне ўласцівасці"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Вызначэнне ўласцівасці ў \"%s\""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Вызначэнне ўласцівасці з \"%s\""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Падзяленне"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Падзяленне \"%s\" у \"%s\""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Запуск"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Спынена"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Спыненне"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Праверка"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Праверка \"%s\""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Праверка \"%s\""
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Праверка кантрольнай сумы"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Праверка кантрольнай сумы ў \"%s\""
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "Праверка кантрольнай сумы з \"%s\""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Чаканне доступу да зыходнага файла"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Чаканне адказу ад карыстальніка"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Сціранне"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Сціранне ў \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Сціранне \"%s\""
#: ulng.rsoperworking
msgid "Working"
msgstr "Працуе"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Дадаць у &пачатак; Дадаць у канец; Разумнае даданне"
#: ulng.rsoptaddingtooltipfiletype
msgid "Adding new tooltip file type"
msgstr ""
#: ulng.rsoptarchiveconfiguresavetochange
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsoptarchiveradditonalcmd
msgid "Mode dependent, additional command"
msgstr ""
#: ulng.rsoptarchiveraddonlynotempty
msgid "Add if it is non-empty"
msgstr ""
#: ulng.rsoptarchiverarchivel
msgid "Archive File (long name)"
msgstr ""
#: ulng.rsoptarchiverarchiver
msgid "Select archiver executable"
msgstr ""
#: ulng.rsoptarchiverarchives
msgid "Archive file (short name)"
msgstr ""
#: ulng.rsoptarchiverchangeencoding
msgid "Change Archiver Listing Encoding"
msgstr ""
#: ulng.rsoptarchiverconfirmdelete
msgctxt "ulng.rsoptarchiverconfirmdelete"
msgid "Are you sure you want to delete: \"%s\"?"
msgstr ""
#: ulng.rsoptarchiverdefaultexportfilename
msgid "Exported Archiver Configuration"
msgstr ""
#: ulng.rsoptarchivererrorlevel
msgid "errorlevel"
msgstr ""
#: ulng.rsoptarchiverexportcaption
msgid "Export archiver configuration"
msgstr ""
#: ulng.rsoptarchiverexportdone
msgctxt "ulng.rsoptarchiverexportdone"
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverexportprompt
msgctxt "ulng.rsoptarchiverexportprompt"
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsoptarchiverfilelistl
msgid "Filelist (long names)"
msgstr ""
#: ulng.rsoptarchiverfilelists
msgid "Filelist (short names)"
msgstr ""
#: ulng.rsoptarchiverimportcaption
msgid "Import archiver configuration"
msgstr ""
#: ulng.rsoptarchiverimportdone
msgctxt "ulng.rsoptarchiverimportdone"
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverimportfile
msgid "Select the file to import archiver configuration(s)"
msgstr ""
#: ulng.rsoptarchiverimportprompt
msgctxt "ulng.rsoptarchiverimportprompt"
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsoptarchiverjustname
msgid "Use name only, without path"
msgstr ""
#: ulng.rsoptarchiverjustpath
msgid "Use path only, without name"
msgstr ""
#: ulng.rsoptarchiverprograml
msgid "Archive Program (long name)"
msgstr ""
#: ulng.rsoptarchiverprograms
msgid "Archive Program (short name)"
msgstr ""
#: ulng.rsoptarchiverquoteall
msgid "Quote all names"
msgstr ""
#: ulng.rsoptarchiverquotewithspace
msgid "Quote names with spaces"
msgstr ""
#: ulng.rsoptarchiversinglefprocess
msgid "Single filename to process"
msgstr ""
#: ulng.rsoptarchivertargetsubdir
msgid "Target subdirecory"
msgstr ""
#: ulng.rsoptarchiveruseansi
msgid "Use ANSI encoding"
msgstr ""
#: ulng.rsoptarchiveruseutf8
msgid "Use UTF8 encoding"
msgstr ""
#: ulng.rsoptarchiverwheretosave
msgid "Enter location and filename where to save archiver configuration"
msgstr ""
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Назва тыпу архіва:"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Звязаць убудову \"%s\" з:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Першае;Апошняе;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Класічна; Па алфавіце (мова першая)"
#: ulng.rsoptconfigtreestate
msgid "Full expand;Full collapse"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Актыўная панэль злева, неактыўная зправа;Левая панэль злева, правая зправа"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Увядзіце пашырэнне"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "Дадаць у пачатак; Дадаць у канец; Па алфавіце"
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "асобнае акно;згарнуць асобнае акно;панэль аперацый"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "плаваючы;B;K;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Спалучэнне %s для cm_Delete будзе зарэгістравана, таму яго можна выкарыстаць адваротна гэтаму параметру."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Дадаць гарачую клавішу для %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Дадаць спалучэнне"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Немагчыма вызначыць спалучэнне"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Змяніць спалучэнне"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Загад"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "У спалучэнні %s для cm_Delete ёсць параметр, які супярэчыць наладам. Змяніць параметр для выкарыстання глабальна?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "У спалучэнні %s для cm_Delete неабходна змяніць параметр, што адпавядае %s. Хочаце змяніць?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Апісанне"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Рэдагаваць гарачую клавішу для %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Нязменны параметр"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Гарачая клавіша"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Гарачыя клавішы"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<няма>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Параметры"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Прызначыць спалучэнне для выдалення файла"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Каб гэты параметр працаваў са спалучэннем %s, спалучэнне %s неабходна прызначыць на cm_Delete, але яно ўжо выкарыстоўваецца %s. Хочаце змяніць?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Спалучэнне %s для cm_Delete - спалучэнне клавіш, для якога немагчыма прызначыць рэверсіўную клавішу Shift. Можа не працаваць."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Спалучэнне ўжо выкарыстоўваецца"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "Спалучэнне %s ужо выкарыстоўваецца."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Змяніць на %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "выкарыстоўваецца для %s у %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "ужо выкарыстоўваецца для гэтага загаду з іншымі параметрамі"
#: ulng.rsoptionseditorarchivers
msgid "Archivers"
msgstr "Архіватары"
#: ulng.rsoptionseditorautorefresh
msgid "Auto refresh"
msgstr "Аўтаабнаўленне"
#: ulng.rsoptionseditorbehavior
msgid "Behaviors"
msgstr "Паводзіны"
#: ulng.rsoptionseditorbriefview
msgid "Brief"
msgstr "Скарочаны выгляд"
#: ulng.rsoptionseditorcolors
msgid "Colors"
msgstr "Колеры"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Слупкі"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Канфігурацыя"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Адвольныя слупкі"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Спіс выбраных каталогаў"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "&Перацягванні"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Спіс кнопак дыскаў"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Выбраныя ўкладкі"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Дадатковыя асацыяцыі файлаў"
#: ulng.rsoptionseditorfileassoc
msgid "File associations"
msgstr "Асацыяцыі файлаў"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Новы"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Файлавыя аперацыі"
#: ulng.rsoptionseditorfilepanels
msgid "File panels"
msgstr "Файлавыя панэлі"
#: ulng.rsoptionseditorfilesearch
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Пошук файлаў"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Адлюстраванне файлаў"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Тыпы файлаў"
#: ulng.rsoptionseditorfoldertabs
msgid "Folder tabs"
msgstr "Укладкі каталогаў"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Дадатковыя ўкладкі каталогаў"
#: ulng.rsoptionseditorfonts
msgid "Fonts"
msgstr "Шрыфты"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Падсвятленне"
#: ulng.rsoptionseditorhotkeys
msgid "Hot keys"
msgstr "Гарачыя клавішы"
#: ulng.rsoptionseditoricons
msgid "Icons"
msgstr "Значкі"
#: ulng.rsoptionseditorignorelist
msgid "Ignore list"
msgstr "Спіс выключэнняў"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Ключы"
#: ulng.rsoptionseditorlanguage
msgid "Language"
msgstr "Мова"
#: ulng.rsoptionseditorlayout
msgid "Layout"
msgstr "Выгляд"
#: ulng.rsoptionseditorlog
msgid "Log"
msgstr "Лог"
#: ulng.rsoptionseditormiscellaneous
msgid "Miscellaneous"
msgstr "Рознае"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Мыш"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
"Параметры \"%s\" змяніліся.\n"
"\n"
"Захаваць змены?\n"
"\n"
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Убудовы"
#: ulng.rsoptionseditorquicksearch
msgid "Quick search/filter"
msgstr "Хуткі пошук/фільтраванне"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Тэрмінал"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Панэль прылад"
#: ulng.rsoptionseditortools
msgid "Tools"
msgstr "Прылады"
#: ulng.rsoptionseditortooltips
msgid "Tooltips"
msgstr "Падказкі"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Меню ў выглядзе дрэва"
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr "Колеры меню ў выглядзе дрэва"
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Нічога;Загадны радок;Хуткі пошук;Хуткае фільтраванне"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Левая кнопка;Правая кнопка;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "уверсе спіса файлаў; пасля каталогаў (калі каталогі адсартаваныя перад файламі); на адсартаванай пазіцыі; унізе спіса файлаў"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Убудова %s ужо ўхвалена для наступных пашырэнняў:"
#: ulng.rsoptplugindisable
msgid "D&isable"
msgstr "Выключыць"
#: ulng.rsoptpluginenable
msgctxt "ulng.rsoptpluginenable"
msgid "E&nable"
msgstr "Ук&лючыць"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Актыўна"
#: ulng.rsoptpluginsdescription
msgctxt "ulng.rsoptpluginsdescription"
msgid "Description"
msgstr "Апісанне"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Назва файла"
#: ulng.rsoptpluginshowbyextension
msgid "By extension"
msgstr ""
#: ulng.rsoptpluginshowbyplugin
msgid "By Plugin"
msgstr ""
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Назва"
#: ulng.rsoptpluginsortonlywhenbyextension
msgid "Sorting WCX plugins is only possible when showing plugins by extension!"
msgstr ""
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Зарэгістравана на"
#: ulng.rsoptrenamingtooltipfiletype
msgid "Renaming tooltip file type"
msgstr ""
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Адчувальны;&Неадчувальны"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Файлы;Ка&талогі;Файлы і& Каталогі"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "&Хаваць панэль фільтра, калі тая не ў фокусе; захоўваць налады, змененыя праз панэль"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "неадчувальны да рэгістра;адпаведна лакальным наладам (аАбБгГ);спачатку верхні рэгістр, пасля ніжні (АБВабв)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "парадкаваць па назве і паказваць першымі;парадкаваць як файлы і паказваць першымі;парадкаваць як файлы"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Па алфавіце, з моўнымі асаблівасцямі; натуральнае парадкаванне: буквы і лічбы"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Верх;Ніз;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "&Падзяляльнік;&унутраны загад;&вонкавы загад;&меню"
#: ulng.rsopttooltipconfiguresavetochange
msgid "To change file type tooltip configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsopttooltipfiletype
msgid "Tooltip file type name:"
msgstr "&Назва катэгорыі:"
#: ulng.rsopttooltipfiletypealreadyexists
msgid "\"%s\" already exists!"
msgstr ""
#: ulng.rsopttooltipfiletypeconfirmdelete
msgctxt "ulng.rsopttooltipfiletypeconfirmdelete"
msgid "Are you sure you want to delete: \"%s\"?"
msgstr ""
#: ulng.rsopttooltipfiletypedefaultexportfilename
msgid "Exported tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeexportcaption
msgid "Export tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeexportdone
msgctxt "ulng.rsopttooltipfiletypeexportdone"
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsopttooltipfiletypeexportprompt
msgctxt "ulng.rsopttooltipfiletypeexportprompt"
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsopttooltipfiletypeimportcaption
msgid "Import tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeimportdone
msgctxt "ulng.rsopttooltipfiletypeimportdone"
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsopttooltipfiletypeimportfile
msgid "Select the file to import tooltip file type configuration(s)"
msgstr ""
#: ulng.rsopttooltipfiletypeimportprompt
msgctxt "ulng.rsopttooltipfiletypeimportprompt"
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsopttooltipfiletypewheretosave
msgid "Enter location and filename where to save tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipsfiletypename
msgid "Tooltip file type name"
msgstr ""
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "Стандартны DC - Копія (x) назвафайла.тып;Windows - назвафайла (x).тып;Іншы - назвафайла (x).тып"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "не змяняць пазіцыю;выкарыстоўваць налады як для новых файлаў;ва ўпарадкаванай пазіцыі"
#: ulng.rspluginfilenamestylelist
msgid "With complete absolute path;Path relative to %COMMANDER_PATH%;Relative to the following"
msgstr ""
#: ulng.rspluginsearchcontainscasesenstive
msgid "contains(case)"
msgstr ""
#: ulng.rspluginsearchcontainsnotcase
msgid "contains"
msgstr ""
#: ulng.rspluginsearchequalcasesensitive
msgid "=(case)"
msgstr ""
#: ulng.rspluginsearchequalnotcase
msgctxt "ulng.rspluginsearchequalnotcase"
msgid "="
msgstr "="
#: ulng.rspluginsearchfieldnotfound
msgid "Field \"%s\" not found!"
msgstr ""
#: ulng.rspluginsearchnotcontainscasesenstive
msgid "!contains(case)"
msgstr ""
#: ulng.rspluginsearchnotcontainsnotcase
msgid "!contains"
msgstr ""
#: ulng.rspluginsearchnotequacasesensitive
msgid "!=(case)"
msgstr ""
#: ulng.rspluginsearchnotequalnotcase
msgctxt "ulng.rspluginsearchnotequalnotcase"
msgid "!="
msgstr "!="
#: ulng.rspluginsearchpluginnotfound
msgid "Plugin \"%s\" not found!"
msgstr ""
#: ulng.rspluginsearchunitnotfound
msgid "Unit \"%s\" not found!"
msgstr ""
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Файлы: %d ,каталогі: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Немагчыма змяніць правы доступу для \"%s\""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Немагчыма змяніць уладальніка \"%s\""
#: ulng.rspropsfile
msgid "File"
msgstr "Файл"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Каталог"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Канал з назвай"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Сокет"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Адмысловая блочная прылада"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Адмысловая сімвальная прылада"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Сімвалічная спасылка"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Невядомы тып"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Вынік пошуку"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "ПОШУК"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<шаблон без назвы>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Пошук файлаў з убудовай DSX ужо запушчаны.\n"
"Неабходна завяршыць яго перш чым пачаць новы.\n"
"\n"
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Пошук файлаў з убудовай WDX ужо запушчаны.\n"
"Неабходна завяршыць яго перш чым пачаць новы.\n"
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Абраць каталог"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr "Абраць акно"
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "&Паказаць даведку па %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Усё"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Катэгорыя"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Слупок"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Загад"
#: ulng.rssimplewordfalse
msgid "False"
msgstr ""
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Назва файла"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "файлы"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr "Буква"
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Парам"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Вынік"
#: ulng.rssimplewordtrue
msgid "True"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "ПрацКат"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Байт"
#: ulng.rssizeunitgbytes
msgid "Gigabytes"
msgstr "Гігабайт"
#: ulng.rssizeunitkbytes
msgid "Kilobytes"
msgstr "Кілабайт"
#: ulng.rssizeunitmbytes
msgid "Megabytes"
msgstr "Мегабайт"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Тэрабайт"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Файлаў: %d, Каталогаў: %d, Памер: %s (%s байтаў)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Немагчыма стварыць мэтавы каталог!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Хібны фармат памеру файла!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Немагчыма падзяліць файл!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Колькасць частак большая за 100! Працягнуць?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr "Аўтаматычна;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Абраць каталог:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr "Толькі прагляд"
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr "Іншыя"
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr "OU"
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr "Нататка"
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr "Плоскі"
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr "Абмежаваны"
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr "Просты"
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr "Неверагодны"
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr "Цудоўны"
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr "Шыкоўны"
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr "Абярыце каталог з гісторыі каталогаў"
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr "Абярыце выбраныя ўкладкі:"
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr "Абярыце загад з гісторыі загаднага радка"
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr "Абярыце дзеянне з галоўнага меню"
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr "Абярыце дзеянне з панэлі прылад"
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr "Абярыце каталог з выбраных каталогаў:"
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr "Абярыце каталог з гісторыі прагляду файлаў"
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr "Абярыце файл альбо каталог"
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Памылка падчас стварэння спасылкі."
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr "Прадвызначаны тэкст"
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr "Просты тэкст"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "Нічога не рабіць;Закрыць укладку;Доступ да выбраных укладак;Меню ўкладак"
#: ulng.rstimeunitday
msgid "Day(s)"
msgstr "Дзень(ён)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Гадзіна(ы)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Хвіліна(ы)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Месяц(ы)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Секунда(ы)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Тыдзень(і)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Год(ы)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Змяніць назву укладак"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Змяніць назву падменю укладак"
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Адрозненні"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Рэдактар"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Падчас адкрыцця праграмы параўнання адбылася памылка"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Памылка падчас запуску рэдактара"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Памылка падчас запуску тэрмінала"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Памылка падчас запуску праграмы прагляду"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Тэрмінал"
#: ulng.rstooltiphidetimeoutlist
msgid "System default;1 sec;2 sec;3 sec;5 sec;10 sec;30 sec;1 min;Never hide"
msgstr ""
#: ulng.rstooltipmodelist
msgid "Combine DC and system tooltip, DC first (legacy);Combine DC and system tooltip, system first;Show DC tooltip when possible and system when not;Show DC tooltip only;Show system tooltip only"
msgstr ""
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Праграма для прагляду"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Калі ласка, паведаміце пра памылку на трэкер памылак з апісаннем вашых дзеянняў і файлам:%sНацісніце %s, каб працягнуць працу албо %s, каб выйсці."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "Абедзве панэлі, з актыўнай у неактыўную"
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "Абедзве панэлі, з левай у правую"
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Шлях панэлі"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "Уключыць кожную назву ў квадратныя дужкі альбо іншыя"
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Толькі назва, без пашырэння"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "Поўная назва (шлях і назва)"
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr "Дапамога па зменным \"%\""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr "Запыт уводу параметра з прадвызначаным значэннем"
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Левая панэль"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "Часовы файл са спісам назваў файлаў"
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "Часовы файл са спісам поўных назваў файлаў (шлях і назва)"
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr "Спіс ва UTF-16 з BOM"
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr "Спіс ва UTF-16 з BOM, назвы ў двукоссях"
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr "Спіс ва UTF-8"
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr "Спіс ва UTF-8, назвы ў двукоссях"
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "Часовы файл са спісам назваў файлаў з адносным шляхам"
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Толькі пашырэнне файла"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Толькі назва"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Іншыя магчымыя прыклады"
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr "Шлях без падзяляльніка на канцы"
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr "Адсюль і да канца радка паказальнікам зменнай з адсоткамі будзе \"#\""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr "Вяртае знак адсотка"
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr "Назад, адсюль і да канца радка паказальнікам зменнай з адсоткамі будзе \"%\""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "Увасабіць кожную назву як \"-a \", альбо інш."
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "%[Запыт;значэнне]"
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "Назва файла з адносным шляхам"
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Правая панэль"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "Поўны шлях другога абранага файла ў правай панэлі"
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "Паказаць да запуску загаду"
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "%[простае паведамленне]"
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "Будзе паказана простае паведамленне"
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Актыўная панэль (крыніца)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Неактыўная панэль (мэта)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr "Назвы файлаў заключацца ў двукоссі (прадвызначана)"
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "Загад будзе выкананы ў тэрмінале, тэрмінал застанецца адкрытым"
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr "Шляхі з падзяляльнікам на канцы"
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "Назвы файлаў не заключацца ў двукоссі"
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "Загад будзе выкананы ў тэрмінале, тэрмінал закрыецца"
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr "Шляхі без падзяляльнікаў на канцы"
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Сетка"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Унутраная праграма прагляду Double Commander."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Дрэнная якасць"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Кадаванне"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Тып выявы"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Новы памер"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s не даступны!"
#: ulng.rsviewpainttoolslist
msgid "Pen;Rect;Ellipse"
msgstr ""
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "у вонкавай праграме"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "ва ўнутранай праграме"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Колькасць замен: %d"
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "Замен не адбылося."