mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-21 09:58:13 +00:00
13086 lines
353 KiB
Text
13086 lines
353 KiB
Text
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
|
||
"Report-Msgid-Bugs-To: \n"
|
||
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
|
||
"PO-Revision-Date: 2017-07-17 08:36+0300\n"
|
||
"Last-Translator: sstpr@narod.ru\n"
|
||
"Language-Team: Language <sstpr@narod.ru>\n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=utf-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"Language: bg\n"
|
||
"X-Native-Language: български\n"
|
||
"X-Generator: Poedit 1.8.9\n"
|
||
|
||
#: fsyncdirsdlg.rscomparingpercent
|
||
msgid "Comparing... %d%% (ESC to cancel)"
|
||
msgstr "Сравняване... %d%% (ESC за отказ)"
|
||
|
||
#: fsyncdirsdlg.rsdeleteright
|
||
msgid "Right: Delete %d file(s)"
|
||
msgstr "Дясно: Изтриване на %d файл(а)"
|
||
|
||
#: fsyncdirsdlg.rsfilesfound
|
||
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
||
msgstr "Намерини файлове: %d (еднакви: %d, различни: %d, неповтарящи отляво: %d, неповтарящи отдясно: %d)"
|
||
|
||
#: fsyncdirsdlg.rslefttorightcopy
|
||
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
||
msgstr "Отляво надясно: Презапис на %d файл с общ размер %d байта"
|
||
|
||
#: fsyncdirsdlg.rsrighttoleftcopy
|
||
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
||
msgstr "Отдясно наляво: Презапис на %d файл с общ размер %d байта"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
||
msgid "Choose template..."
|
||
msgstr "Избор на шаблон..."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
||
msgid "C&heck free space"
|
||
msgstr "Проверка на свободното &пространство"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
||
msgid "Cop&y attributes"
|
||
msgstr "Презапис на &принадлежностите"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
||
msgid "Copy o&wnership"
|
||
msgstr "Презапис на &собствеността"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
||
msgid "Copy &permissions"
|
||
msgstr "Презапис на &разрешенията"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Презапис на &времето и датата"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
||
msgid "Correct lin&ks"
|
||
msgstr "Поправяне на в&ръзките"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "Drop readonly fla&g"
|
||
msgstr "Изоставяне на стяга „само за четене“"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
||
msgid "E&xclude empty directories"
|
||
msgstr "Из&ключване на празните папки"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
||
msgid "Fo&llow links"
|
||
msgstr "&Следване на връзките"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
||
msgid "&Reserve space"
|
||
msgstr "Запазване на &място"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
||
msgid "&Verify"
|
||
msgstr ""
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
||
msgid "What to do when cannot set file time, attributes, etc."
|
||
msgstr "Действие, при невъзможност за задаване на време, принадлежности и т.н."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
||
msgid "Use file template"
|
||
msgstr ""
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
||
msgid "When dir&ectory exists"
|
||
msgstr "Когато &папката съществува"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When &file exists"
|
||
msgstr "Когато &файлът съществува"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
||
msgid "When ca&nnot set property"
|
||
msgstr ""
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
||
msgid "<no template>"
|
||
msgstr "<няма шаблон>"
|
||
|
||
#: tfrmabout.btnclose.caption
|
||
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Затваряне"
|
||
|
||
#: tfrmabout.btncopytoclipboard.caption
|
||
msgid "Copy to clipboard"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmabout.caption
|
||
msgctxt "TFRMABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "За"
|
||
|
||
#: tfrmabout.lblbuild.caption
|
||
msgctxt "tfrmabout.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Постройка"
|
||
|
||
#: tfrmabout.lblfreepascalver.caption
|
||
msgctxt "tfrmabout.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmabout.lblhomepage.caption
|
||
msgid "Home Page:"
|
||
msgstr "Домашна страница:"
|
||
|
||
#: tfrmabout.lblhomepageaddress.caption
|
||
msgid "http://doublecmd.sourceforge.net"
|
||
msgstr "http://doublecmd.sourceforge.net"
|
||
|
||
#: tfrmabout.lbllazarusver.caption
|
||
msgctxt "tfrmabout.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmabout.lblrevision.caption
|
||
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
|
||
msgid "Revision"
|
||
msgstr "Преработка"
|
||
|
||
#: tfrmabout.lbltitle.caption
|
||
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmabout.lblversion.caption
|
||
msgctxt "tfrmabout.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Издание"
|
||
|
||
#: tfrmattributesedit.btncancel.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmattributesedit.btnok.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmattributesedit.btnreset.caption
|
||
msgid "&Reset"
|
||
msgstr "О&чистване"
|
||
|
||
#: tfrmattributesedit.caption
|
||
msgid "Choose attributes"
|
||
msgstr "Изберете принадлежности"
|
||
|
||
#: tfrmattributesedit.cbarchive.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
|
||
msgid "&Archive"
|
||
msgstr "&Архив"
|
||
|
||
#: tfrmattributesedit.cbcompressed.caption
|
||
msgid "Co&mpressed"
|
||
msgstr "Уп&лътнен"
|
||
|
||
#: tfrmattributesedit.cbdirectory.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
|
||
msgid "&Directory"
|
||
msgstr "&Папка"
|
||
|
||
#: tfrmattributesedit.cbencrypted.caption
|
||
msgid "&Encrypted"
|
||
msgstr "&Криптиран"
|
||
|
||
#: tfrmattributesedit.cbhidden.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
|
||
msgid "&Hidden"
|
||
msgstr "С&крит"
|
||
|
||
#: tfrmattributesedit.cbreadonly.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
|
||
msgid "Read o&nly"
|
||
msgstr "Само за &четене"
|
||
|
||
#: tfrmattributesedit.cbsgid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr ""
|
||
|
||
#: tfrmattributesedit.cbsparse.caption
|
||
msgid "S&parse"
|
||
msgstr ""
|
||
|
||
#: tfrmattributesedit.cbsticky.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Лепкав"
|
||
|
||
#: tfrmattributesedit.cbsuid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr ""
|
||
|
||
#: tfrmattributesedit.cbsymlink.caption
|
||
msgid "&Symlink"
|
||
msgstr "&Мека връзка"
|
||
|
||
#: tfrmattributesedit.cbsystem.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
|
||
msgid "S&ystem"
|
||
msgstr "&Системен"
|
||
|
||
#: tfrmattributesedit.cbtemporary.caption
|
||
msgid "&Temporary"
|
||
msgstr "&Временен"
|
||
|
||
#: tfrmattributesedit.gbntfsattributes.caption
|
||
msgid "NTFS attributes"
|
||
msgstr "Принадлежности по NTFS"
|
||
|
||
#: tfrmattributesedit.gbwingeneral.caption
|
||
msgid "General attributes"
|
||
msgstr "Об щи принадлежности"
|
||
|
||
#: tfrmattributesedit.lblattrbitsstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Разряда:"
|
||
|
||
#: tfrmattributesedit.lblattrgroupstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: tfrmattributesedit.lblattrotherstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Друго:"
|
||
|
||
#: tfrmattributesedit.lblattrownerstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Собственик"
|
||
|
||
#: tfrmattributesedit.lblexec.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Изпълнение"
|
||
|
||
#: tfrmattributesedit.lblread.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Запис"
|
||
|
||
#: tfrmattributesedit.lbltextattrs.caption
|
||
msgid "As te&xt:"
|
||
msgstr "Като &текст:"
|
||
|
||
#: tfrmattributesedit.lblwrite.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Четене"
|
||
|
||
#: tfrmbenchmark.caption
|
||
msgid "Benchmark"
|
||
msgstr ""
|
||
|
||
#: tfrmbenchmark.lblbenchmarksize.caption
|
||
msgid "Benchmark data size: %d MB"
|
||
msgstr ""
|
||
|
||
#: tfrmbenchmark.stgresult.columns[0].title.caption
|
||
msgid "Hash"
|
||
msgstr ""
|
||
|
||
#: tfrmbenchmark.stgresult.columns[1].title.caption
|
||
msgid "Time (ms)"
|
||
msgstr ""
|
||
|
||
#: tfrmbenchmark.stgresult.columns[2].title.caption
|
||
msgid "Speed (MB/s)"
|
||
msgstr ""
|
||
|
||
#: tfrmchecksumcalc.caption
|
||
msgctxt "tfrmchecksumcalc.caption"
|
||
msgid "Calculate checksum..."
|
||
msgstr "Изчисляване на проверочен сбор..."
|
||
|
||
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
||
msgid "Open checksum file after job is completed"
|
||
msgstr ""
|
||
|
||
#: tfrmchecksumcalc.cbseparatefile.caption
|
||
msgid "C&reate separate checksum file for each file"
|
||
msgstr "Съз&даване на отделни проверочни сборове за всички файлове"
|
||
|
||
#: tfrmchecksumcalc.lblsaveto.caption
|
||
msgid "&Save checksum file(s) to:"
|
||
msgstr "&Съхраняване на файла/овете с проверочните сборове в:"
|
||
|
||
#: tfrmchecksumverify.btnclose.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Затваряне"
|
||
|
||
#: tfrmchecksumverify.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
|
||
msgid "Verify checksum..."
|
||
msgstr "Сверяване на проверочен сбор..."
|
||
|
||
#: tfrmconnectionmanager.btnadd.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmconnectionmanager.btncancel.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmconnectionmanager.btnconnect.caption
|
||
msgid "C&onnect"
|
||
msgstr "&Закачане"
|
||
|
||
#: tfrmconnectionmanager.btndelete.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmconnectionmanager.btnedit.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Об&работка"
|
||
|
||
#: tfrmconnectionmanager.caption
|
||
msgid "Connection manager"
|
||
msgstr "Управител на свързванията"
|
||
|
||
#: tfrmconnectionmanager.gbconnectto.caption
|
||
msgid "Connect to:"
|
||
msgstr "Закачане към:"
|
||
|
||
#: tfrmcopydlg.btnaddtoqueue.caption
|
||
msgid "A&dd To Queue"
|
||
msgstr "&Добавяне към опашка"
|
||
|
||
#: tfrmcopydlg.btncancel.caption
|
||
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmcopydlg.btnoptions.caption
|
||
msgid "O&ptions"
|
||
msgstr "Въз&можности"
|
||
|
||
#: tfrmcopydlg.btnsaveoptions.caption
|
||
msgid "Sa&ve these options as default"
|
||
msgstr "&Съхраняване на настройките като подразбирани"
|
||
|
||
#: tfrmcopydlg.caption
|
||
msgctxt "TFRMCOPYDLG.CAPTION"
|
||
msgid "Copy file(s)"
|
||
msgstr "Презапис на файл(ове)"
|
||
|
||
#: tfrmcopydlg.mnunewqueue.caption
|
||
msgctxt "tfrmcopydlg.mnunewqueue.caption"
|
||
msgid "New queue"
|
||
msgstr "Нова опашка"
|
||
|
||
#: tfrmcopydlg.mnuqueue1.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue1.caption"
|
||
msgid "Queue 1"
|
||
msgstr "Опашка 1"
|
||
|
||
#: tfrmcopydlg.mnuqueue2.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue2.caption"
|
||
msgid "Queue 2"
|
||
msgstr "Опашка 2"
|
||
|
||
#: tfrmcopydlg.mnuqueue3.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue3.caption"
|
||
msgid "Queue 3"
|
||
msgstr "Опашка 3"
|
||
|
||
#: tfrmcopydlg.mnuqueue4.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue4.caption"
|
||
msgid "Queue 4"
|
||
msgstr "Опашка 4"
|
||
|
||
#: tfrmcopydlg.mnuqueue5.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue5.caption"
|
||
msgid "Queue 5"
|
||
msgstr "Опашка 5"
|
||
|
||
#: tfrmdescredit.actsavedescription.caption
|
||
msgid "Save Description"
|
||
msgstr "Запис на описанието"
|
||
|
||
#: tfrmdescredit.btncancel.caption
|
||
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmdescredit.btnok.caption
|
||
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmdescredit.caption
|
||
msgid "File/folder comment"
|
||
msgstr "Бележки за файл/папка"
|
||
|
||
#: tfrmdescredit.lbleditcommentfor.caption
|
||
msgid "E&dit comment for:"
|
||
msgstr "Про&мяна на бележката за:"
|
||
|
||
#: tfrmdescredit.lblencoding.caption
|
||
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
|
||
msgid "&Encoding:"
|
||
msgstr "&Знаков набор:"
|
||
|
||
#: tfrmdescredit.lblfilename.caption
|
||
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmdiffer.actabout.caption
|
||
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "За"
|
||
|
||
#: tfrmdiffer.actautocompare.caption
|
||
msgid "Auto Compare"
|
||
msgstr "Автоматично сравняване"
|
||
|
||
#: tfrmdiffer.actbinarycompare.caption
|
||
msgid "Binary Mode"
|
||
msgstr "Двоичен режим"
|
||
|
||
#: tfrmdiffer.actcancelcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Отказ"
|
||
|
||
#: tfrmdiffer.actcancelcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
||
msgid "Cancel"
|
||
msgstr "Отказ"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
|
||
msgid "Copy Block Right"
|
||
msgstr "Замяна в дясното крило със съдържанието от лявото"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
||
msgid "Copy Block Right"
|
||
msgstr "Замяна в дясното крило със съдържанието от лявото"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
|
||
msgid "Copy Block Left"
|
||
msgstr "Замяна в лявото крило със съдържанието от дясното"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
||
msgid "Copy Block Left"
|
||
msgstr "Замяна в лявото крило със съдържанието от дясното"
|
||
|
||
#: tfrmdiffer.acteditcopy.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmdiffer.acteditcut.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Изрязване"
|
||
|
||
#: tfrmdiffer.acteditdelete.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Изтриване"
|
||
|
||
#: tfrmdiffer.acteditpaste.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Поставяне"
|
||
|
||
#: tfrmdiffer.acteditredo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Връщане"
|
||
|
||
#: tfrmdiffer.acteditselectall.caption
|
||
msgid "Select &All"
|
||
msgstr "Избор на вси&чко"
|
||
|
||
#: tfrmdiffer.acteditundo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Отмяна"
|
||
|
||
#: tfrmdiffer.actexit.caption
|
||
msgctxt "tfrmdiffer.actexit.caption"
|
||
msgid "E&xit"
|
||
msgstr "Из&ход"
|
||
|
||
#: tfrmdiffer.actfirstdifference.caption
|
||
msgctxt "tfrmdiffer.actfirstdifference.caption"
|
||
msgid "First Difference"
|
||
msgstr "Първа разлика"
|
||
|
||
#: tfrmdiffer.actfirstdifference.hint
|
||
msgctxt "tfrmdiffer.actfirstdifference.hint"
|
||
msgid "First Difference"
|
||
msgstr "Първа разлика"
|
||
|
||
#: tfrmdiffer.actignorecase.caption
|
||
msgid "Ignore Case"
|
||
msgstr "Пренебрегване на ГЛавноСТта"
|
||
|
||
#: tfrmdiffer.actignorewhitespace.caption
|
||
msgid "Ignore Blanks"
|
||
msgstr "Пренебрегване на празните знаци"
|
||
|
||
#: tfrmdiffer.actkeepscrolling.caption
|
||
msgid "Keep Scrolling"
|
||
msgstr "Съгласувано превъртане"
|
||
|
||
#: tfrmdiffer.actlastdifference.caption
|
||
msgctxt "tfrmdiffer.actlastdifference.caption"
|
||
msgid "Last Difference"
|
||
msgstr "Последна разлика"
|
||
|
||
#: tfrmdiffer.actlastdifference.hint
|
||
msgctxt "tfrmdiffer.actlastdifference.hint"
|
||
msgid "Last Difference"
|
||
msgstr "Последна разлика"
|
||
|
||
#: tfrmdiffer.actlinedifferences.caption
|
||
msgid "Line Differences"
|
||
msgstr "Изтъкване на разликите в редовете"
|
||
|
||
#: tfrmdiffer.actnextdifference.caption
|
||
msgctxt "tfrmdiffer.actnextdifference.caption"
|
||
msgid "Next Difference"
|
||
msgstr "Следваща разлика"
|
||
|
||
#: tfrmdiffer.actnextdifference.hint
|
||
msgctxt "tfrmdiffer.actnextdifference.hint"
|
||
msgid "Next Difference"
|
||
msgstr "Следваща разлика"
|
||
|
||
#: tfrmdiffer.actopenleft.caption
|
||
msgid "Open Left..."
|
||
msgstr "Отваряне в лявото крило..."
|
||
|
||
#: tfrmdiffer.actopenright.caption
|
||
msgid "Open Right..."
|
||
msgstr "Отваряне в дясното крило..."
|
||
|
||
#: tfrmdiffer.actpaintbackground.caption
|
||
msgid "Paint Background"
|
||
msgstr ""
|
||
|
||
#: tfrmdiffer.actprevdifference.caption
|
||
msgctxt "tfrmdiffer.actprevdifference.caption"
|
||
msgid "Previous Difference"
|
||
msgstr "Предходна разлика"
|
||
|
||
#: tfrmdiffer.actprevdifference.hint
|
||
msgctxt "tfrmdiffer.actprevdifference.hint"
|
||
msgid "Previous Difference"
|
||
msgstr "Предходна разлика"
|
||
|
||
#: tfrmdiffer.actreload.caption
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
|
||
msgid "&Reload"
|
||
msgstr "&Презареждане"
|
||
|
||
#: tfrmdiffer.actreload.hint
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
|
||
msgid "Reload"
|
||
msgstr "Презареждане"
|
||
|
||
#: tfrmdiffer.actsave.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Съхраняване"
|
||
|
||
#: tfrmdiffer.actsave.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Съхраняване"
|
||
|
||
#: tfrmdiffer.actsaveas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
|
||
msgid "Save as..."
|
||
msgstr "Съхраняване като..."
|
||
|
||
#: tfrmdiffer.actsaveas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
||
msgid "Save as..."
|
||
msgstr "Съхраняване като..."
|
||
|
||
#: tfrmdiffer.actsaveleft.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
|
||
msgid "Save Left"
|
||
msgstr "Съхраняване на съдържанието на лявото крило"
|
||
|
||
#: tfrmdiffer.actsaveleft.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
||
msgid "Save Left"
|
||
msgstr "Съхраняване на съдържанието на лявото крило"
|
||
|
||
#: tfrmdiffer.actsaveleftas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
|
||
msgid "Save Left As..."
|
||
msgstr "Съхраняване на съдържанието на лявото крило като..."
|
||
|
||
#: tfrmdiffer.actsaveleftas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
||
msgid "Save Left As..."
|
||
msgstr "Съхраняване на съдържанието на лявото крило като..."
|
||
|
||
#: tfrmdiffer.actsaveright.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
|
||
msgid "Save Right"
|
||
msgstr "Съхраняване на съдържанието на дясното крило"
|
||
|
||
#: tfrmdiffer.actsaveright.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
||
msgid "Save Right"
|
||
msgstr "Съхраняване на съдържанието на дясното крило"
|
||
|
||
#: tfrmdiffer.actsaverightas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
|
||
msgid "Save Right As..."
|
||
msgstr "Съхраняване на съдържанието на дясното крило като..."
|
||
|
||
#: tfrmdiffer.actsaverightas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
||
msgid "Save Right As..."
|
||
msgstr "Съхраняване на съдържанието на дясното крило като..."
|
||
|
||
#: tfrmdiffer.actstartcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Сравняване"
|
||
|
||
#: tfrmdiffer.actstartcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
||
msgid "Compare"
|
||
msgstr "Сравняване"
|
||
|
||
#: tfrmdiffer.btnleftencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Знаков набор"
|
||
|
||
#: tfrmdiffer.btnrightencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Знаков набор"
|
||
|
||
#: tfrmdiffer.caption
|
||
msgctxt "TFRMDIFFER.CAPTION"
|
||
msgid "Compare files"
|
||
msgstr "Сравняване на файлове"
|
||
|
||
#: tfrmdiffer.midivider1.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider10.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider2.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider3.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider4.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider5.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider6.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider7.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider8.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider9.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miencodingleft.caption
|
||
msgid "&Left"
|
||
msgstr "&Ляво"
|
||
|
||
#: tfrmdiffer.miencodingright.caption
|
||
msgid "&Right"
|
||
msgstr "&Дясно"
|
||
|
||
#: tfrmdiffer.miseparator1.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miseparator2.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.mnuactions.caption
|
||
msgid "&Actions"
|
||
msgstr "&Действия"
|
||
|
||
#: tfrmdiffer.mnuedit.caption
|
||
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Об&работка"
|
||
|
||
#: tfrmdiffer.mnuencoding.caption
|
||
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "&Знаков набор"
|
||
|
||
#: tfrmdiffer.mnufile.caption
|
||
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmdiffer.mnuoptions.caption
|
||
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
|
||
msgid "&Options"
|
||
msgstr "Въз&можности"
|
||
|
||
#: tfrmedithotkey.btnaddshortcut.hint
|
||
msgid "Add new shortcut to sequence"
|
||
msgstr ""
|
||
|
||
#: tfrmedithotkey.btncancel.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmedithotkey.btnok.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmedithotkey.btnremoveshortcut.hint
|
||
msgid "Remove last shortcut from sequence"
|
||
msgstr ""
|
||
|
||
#: tfrmedithotkey.btnselectfromlist.hint
|
||
msgid "Select shortcut from list of remaining free available keys"
|
||
msgstr ""
|
||
|
||
#: tfrmedithotkey.cghkcontrols.caption
|
||
msgctxt "tfrmedithotkey.cghkcontrols.caption"
|
||
msgid "Only for these controls"
|
||
msgstr ""
|
||
|
||
#: tfrmedithotkey.lblparameters.caption
|
||
msgid "&Parameters (each in a separate line):"
|
||
msgstr ""
|
||
|
||
#: tfrmedithotkey.lblshortcuts.caption
|
||
msgid "Shortcuts:"
|
||
msgstr ""
|
||
|
||
#: tfrmeditor.actabout.caption
|
||
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "За"
|
||
|
||
#: tfrmeditor.actabout.hint
|
||
msgctxt "tfrmeditor.actabout.hint"
|
||
msgid "About"
|
||
msgstr "За"
|
||
|
||
#: tfrmeditor.actconfhigh.caption
|
||
msgid "&Configuration"
|
||
msgstr "&Настройка"
|
||
|
||
#: tfrmeditor.actconfhigh.hint
|
||
msgctxt "tfrmeditor.actconfhigh.hint"
|
||
msgid "Configuration"
|
||
msgstr "Настройка"
|
||
|
||
#: tfrmeditor.acteditcopy.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmeditor.acteditcopy.hint
|
||
msgctxt "tfrmeditor.acteditcopy.hint"
|
||
msgid "Copy"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmeditor.acteditcut.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Изрязване"
|
||
|
||
#: tfrmeditor.acteditcut.hint
|
||
msgctxt "tfrmeditor.acteditcut.hint"
|
||
msgid "Cut"
|
||
msgstr "Изрязване"
|
||
|
||
#: tfrmeditor.acteditdelete.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Изтриване"
|
||
|
||
#: tfrmeditor.acteditdelete.hint
|
||
msgctxt "tfrmeditor.acteditdelete.hint"
|
||
msgid "Delete"
|
||
msgstr "Изтриване"
|
||
|
||
#: tfrmeditor.acteditfind.caption
|
||
msgctxt "tfrmeditor.acteditfind.caption"
|
||
msgid "&Find"
|
||
msgstr "&Търсене"
|
||
|
||
#: tfrmeditor.acteditfind.hint
|
||
msgctxt "tfrmeditor.acteditfind.hint"
|
||
msgid "Find"
|
||
msgstr "Търсене"
|
||
|
||
#: tfrmeditor.acteditfindnext.caption
|
||
msgctxt "tfrmeditor.acteditfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Намиране на следващо:"
|
||
|
||
#: tfrmeditor.acteditfindnext.hint
|
||
msgctxt "tfrmeditor.acteditfindnext.hint"
|
||
msgid "Find next"
|
||
msgstr "Намиране на следващо:"
|
||
|
||
#: tfrmeditor.acteditfindprevious.caption
|
||
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
||
msgid "Find previous"
|
||
msgstr "Намиране на предходно:"
|
||
|
||
#: tfrmeditor.acteditgotoline.caption
|
||
msgctxt "tfrmeditor.acteditgotoline.caption"
|
||
msgid "Goto Line..."
|
||
msgstr "Отиване на ред..."
|
||
|
||
#: tfrmeditor.acteditlineendcr.caption
|
||
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
||
msgid "Mac (CR)"
|
||
msgstr "Мак (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcr.hint
|
||
msgctxt "tfrmeditor.acteditlineendcr.hint"
|
||
msgid "Mac (CR)"
|
||
msgstr "Мак (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.hint
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
||
msgid "Unix (LF)"
|
||
msgstr "Юникс (LF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.hint
|
||
msgctxt "tfrmeditor.acteditlineendlf.hint"
|
||
msgid "Unix (LF)"
|
||
msgstr "Юникс (LF)"
|
||
|
||
#: tfrmeditor.acteditpaste.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Поставяне"
|
||
|
||
#: tfrmeditor.acteditpaste.hint
|
||
msgctxt "tfrmeditor.acteditpaste.hint"
|
||
msgid "Paste"
|
||
msgstr "Поставяне"
|
||
|
||
#: tfrmeditor.acteditredo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Връщане"
|
||
|
||
#: tfrmeditor.acteditredo.hint
|
||
msgctxt "tfrmeditor.acteditredo.hint"
|
||
msgid "Redo"
|
||
msgstr "Връщане"
|
||
|
||
#: tfrmeditor.acteditrplc.caption
|
||
msgid "&Replace"
|
||
msgstr "&Замяна"
|
||
|
||
#: tfrmeditor.acteditrplc.hint
|
||
msgctxt "tfrmeditor.acteditrplc.hint"
|
||
msgid "Replace"
|
||
msgstr "Замяна"
|
||
|
||
#: tfrmeditor.acteditselectall.caption
|
||
msgid "Select&All"
|
||
msgstr "Избор на вси&чки"
|
||
|
||
#: tfrmeditor.acteditselectall.hint
|
||
msgctxt "tfrmeditor.acteditselectall.hint"
|
||
msgid "Select All"
|
||
msgstr "Избор на всички"
|
||
|
||
#: tfrmeditor.acteditundo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Отмяна"
|
||
|
||
#: tfrmeditor.acteditundo.hint
|
||
msgctxt "tfrmeditor.acteditundo.hint"
|
||
msgid "Undo"
|
||
msgstr "Отмяна"
|
||
|
||
#: tfrmeditor.actfileclose.caption
|
||
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Затваряне"
|
||
|
||
#: tfrmeditor.actfileclose.hint
|
||
msgctxt "tfrmeditor.actfileclose.hint"
|
||
msgid "Close"
|
||
msgstr "Затваряне"
|
||
|
||
#: tfrmeditor.actfileexit.caption
|
||
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Из&ход"
|
||
|
||
#: tfrmeditor.actfileexit.hint
|
||
msgctxt "tfrmeditor.actfileexit.hint"
|
||
msgid "Exit"
|
||
msgstr "Изход"
|
||
|
||
#: tfrmeditor.actfilenew.caption
|
||
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
|
||
msgid "&New"
|
||
msgstr "&Нов"
|
||
|
||
#: tfrmeditor.actfilenew.hint
|
||
msgctxt "tfrmeditor.actfilenew.hint"
|
||
msgid "New"
|
||
msgstr "Нов"
|
||
|
||
#: tfrmeditor.actfileopen.caption
|
||
msgid "&Open"
|
||
msgstr "&Отваряне"
|
||
|
||
#: tfrmeditor.actfileopen.hint
|
||
msgctxt "tfrmeditor.actfileopen.hint"
|
||
msgid "Open"
|
||
msgstr "Отваряне"
|
||
|
||
#: tfrmeditor.actfilereload.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmeditor.actfilereload.caption"
|
||
msgid "Reload"
|
||
msgstr "Презареждане"
|
||
|
||
#: tfrmeditor.actfilesave.caption
|
||
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Съхраняване"
|
||
|
||
#: tfrmeditor.actfilesave.hint
|
||
msgctxt "tfrmeditor.actfilesave.hint"
|
||
msgid "Save"
|
||
msgstr "Съхраняване"
|
||
|
||
#: tfrmeditor.actfilesaveas.caption
|
||
msgid "Save &As..."
|
||
msgstr "Съхраняване &като..."
|
||
|
||
#: tfrmeditor.actfilesaveas.hint
|
||
msgid "Save As"
|
||
msgstr "Съхраняване &като"
|
||
|
||
#: tfrmeditor.actsaveall.caption
|
||
msgid "Sa&ve All"
|
||
msgstr "Съ&храняване на всички"
|
||
|
||
#: tfrmeditor.actsaveall.hint
|
||
msgid "Save All"
|
||
msgstr "Съхраняване на всички"
|
||
|
||
#: tfrmeditor.caption
|
||
msgctxt "tfrmeditor.caption"
|
||
msgid "Editor"
|
||
msgstr "Обработчик"
|
||
|
||
#: tfrmeditor.help1.caption
|
||
msgctxt "TFRMEDITOR.HELP1.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Помо&щ"
|
||
|
||
#: tfrmeditor.miedit.caption
|
||
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Обработка"
|
||
|
||
#: tfrmeditor.miencoding.caption
|
||
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "&Знаков набор"
|
||
|
||
#: tfrmeditor.miencodingin.caption
|
||
msgid "Open as"
|
||
msgstr "Отваряне като"
|
||
|
||
#: tfrmeditor.miencodingout.caption
|
||
msgctxt "tfrmeditor.miencodingout.caption"
|
||
msgid "Save as"
|
||
msgstr "Съхраняване като"
|
||
|
||
#: tfrmeditor.mifile.caption
|
||
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmeditor.mihighlight.caption
|
||
msgid "Syntax highlight"
|
||
msgstr "Синтактично подчертаване"
|
||
|
||
#: tfrmeditor.milineendtype.caption
|
||
msgid "End Of Line"
|
||
msgstr "Край на реда"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
|
||
msgid "C&ase sensitivity"
|
||
msgstr "Отчитане на &глаВноСТта"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
|
||
msgid "S&earch from caret"
|
||
msgstr "Търсене на&долу"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
|
||
msgid "&Regular expressions"
|
||
msgstr "&Обичайни изрази"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
|
||
msgid "Selected &text only"
|
||
msgstr "Само избрания &текст"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
|
||
msgid "&Whole words only"
|
||
msgstr "&Само цели думи"
|
||
|
||
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
|
||
msgid "Option"
|
||
msgstr "Възможност"
|
||
|
||
#: tfrmeditsearchreplace.lblreplacewith.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
|
||
msgid "&Replace with:"
|
||
msgstr "&Замяна с:"
|
||
|
||
#: tfrmeditsearchreplace.lblsearchfor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
|
||
msgid "&Search for:"
|
||
msgstr "&Търсене от:"
|
||
|
||
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
|
||
msgid "Direction"
|
||
msgstr "Посока"
|
||
|
||
#: tfrmextractdlg.caption
|
||
msgctxt "TFRMEXTRACTDLG.CAPTION"
|
||
msgid "Unpack files"
|
||
msgstr "Извличане на файлове"
|
||
|
||
#: tfrmextractdlg.cbextractpath.caption
|
||
msgid "&Unpack path names if stored with files"
|
||
msgstr "&Разгъване на имената на пътищата, ако са съхранени във файловете"
|
||
|
||
#: tfrmextractdlg.cbfilemask.text
|
||
msgctxt "tfrmextractdlg.cbfilemask.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmextractdlg.cbinseparatefolder.caption
|
||
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
||
msgstr "Разгъване на всеки архив в отделна папка (според името на архива)"
|
||
|
||
#: tfrmextractdlg.cboverwrite.caption
|
||
msgid "O&verwrite existing files"
|
||
msgstr "&Замяна на съществуващите файлове"
|
||
|
||
#: tfrmextractdlg.lblextractto.caption
|
||
msgid "To the &directory:"
|
||
msgstr "Извличане на файл в:"
|
||
|
||
#: tfrmextractdlg.lblfilemask.caption
|
||
msgid "&Extract files matching file mask:"
|
||
msgstr "&Извличане на файловете, отговарящи на пресяването"
|
||
|
||
#: tfrmextractdlg.lblpassword.caption
|
||
msgid "&Password for encrypted files:"
|
||
msgstr "&Парола за кодираните файлове"
|
||
|
||
#: tfrmfileexecuteyourself.btnclose.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Затваряне"
|
||
|
||
#: tfrmfileexecuteyourself.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
|
||
msgid "Wait..."
|
||
msgstr "Изчакване..."
|
||
|
||
#: tfrmfileexecuteyourself.lblfilename.caption
|
||
msgid "File name:"
|
||
msgstr "Файлово име:"
|
||
|
||
#: tfrmfileexecuteyourself.lblfrompath.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
|
||
msgid "From:"
|
||
msgstr "От:"
|
||
|
||
#: tfrmfileexecuteyourself.lblprompt.caption
|
||
msgid "Click on Close when the temporary file can be deleted!"
|
||
msgstr ""
|
||
|
||
#: tfrmfileop.btncancel.caption
|
||
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmfileop.btnminimizetopanel.caption
|
||
msgid "&To panel"
|
||
msgstr "В &крилото"
|
||
|
||
#: tfrmfileop.btnviewoperations.caption
|
||
msgid "&View all"
|
||
msgstr "Показване на вси&чки"
|
||
|
||
#: tfrmfileop.lblcurrentoperation.caption
|
||
msgid "Current operation:"
|
||
msgstr "Текущо действие:"
|
||
|
||
#: tfrmfileop.lblfrom.caption
|
||
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
||
msgid "From:"
|
||
msgstr "От:"
|
||
|
||
#: tfrmfileop.lblto.caption
|
||
msgid "To:"
|
||
msgstr "В:"
|
||
|
||
#: tfrmfileproperties.btnclose.caption
|
||
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Затваряне"
|
||
|
||
#: tfrmfileproperties.btnsetproperties.caption
|
||
msgid "&Set properties"
|
||
msgstr "Задаване на &свойства"
|
||
|
||
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
||
msgid "Set to &all selected files"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.btnskipfile.caption
|
||
msgid "Ski&p this file"
|
||
msgstr "Пропускане на &този файл"
|
||
|
||
#: tfrmfileproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Свойства"
|
||
|
||
#: tfrmfileproperties.cbsgid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.cbsticky.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Лепкав"
|
||
|
||
#: tfrmfileproperties.cbsuid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.chkexecutable.caption
|
||
msgid "Allow &executing file as program"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.gbowner.caption
|
||
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Собственик"
|
||
|
||
#: tfrmfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Разряда:"
|
||
|
||
#: tfrmfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: tfrmfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Друго:"
|
||
|
||
#: tfrmfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Собственик"
|
||
|
||
#: tfrmfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Текст:"
|
||
|
||
#: tfrmfileproperties.lblcontains.caption
|
||
msgctxt "tfrmfileproperties.lblcontains.caption"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblcontainsstr.caption
|
||
msgid "Contains:"
|
||
msgstr "Съдържа:"
|
||
|
||
#: tfrmfileproperties.lblexec.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Изпълнение"
|
||
|
||
#: tfrmfileproperties.lblexecutable.caption
|
||
msgid "Execute:"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.lblfile.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Файлово име"
|
||
|
||
#: tfrmfileproperties.lblfilename.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfilestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Файлово име"
|
||
|
||
#: tfrmfileproperties.lblfolder.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfolderstr.caption
|
||
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
||
msgid "Path:"
|
||
msgstr "Път:"
|
||
|
||
#: tfrmfileproperties.lblgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
|
||
msgid "&Group"
|
||
msgstr "&Група"
|
||
|
||
#: tfrmfileproperties.lbllastaccess.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastaccessstr.caption
|
||
msgid "Last access:"
|
||
msgstr "Последно използване:"
|
||
|
||
#: tfrmfileproperties.lbllastmodif.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastmodifstr.caption
|
||
msgid "Last modification:"
|
||
msgstr "Последна промяна:"
|
||
|
||
#: tfrmfileproperties.lbllaststchange.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllaststchangestr.caption
|
||
msgid "Last status change:"
|
||
msgstr "Последна промяна на състоянието:"
|
||
|
||
#: tfrmfileproperties.lbloctal.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Осмично:"
|
||
|
||
#: tfrmfileproperties.lblownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
|
||
msgid "O&wner"
|
||
msgstr "Со&бственик"
|
||
|
||
#: tfrmfileproperties.lblread.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Запис"
|
||
|
||
#: tfrmfileproperties.lblsize.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsizestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
|
||
msgid "Size:"
|
||
msgstr "Размер:"
|
||
|
||
#: tfrmfileproperties.lblsymlink.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsymlinkstr.caption
|
||
msgid "Symlink to:"
|
||
msgstr "Мека връзка към:"
|
||
|
||
#: tfrmfileproperties.lbltype.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbltypestr.caption
|
||
msgid "Type:"
|
||
msgstr "Вид:"
|
||
|
||
#: tfrmfileproperties.lblwrite.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Четене"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Име"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
||
msgid "Value"
|
||
msgstr "Стойност"
|
||
|
||
#: tfrmfileproperties.tsattributes.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Принадлежности"
|
||
|
||
#: tfrmfileproperties.tsplugins.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Приставки"
|
||
|
||
#: tfrmfileproperties.tsproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Свойства"
|
||
|
||
#: tfrmfileunlock.btnclose.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileunlock.btnclose.caption"
|
||
msgid "Close"
|
||
msgstr "Затваряне"
|
||
|
||
#: tfrmfileunlock.btnterminate.caption
|
||
msgid "Terminate"
|
||
msgstr ""
|
||
|
||
#: tfrmfileunlock.btnunlock.caption
|
||
msgctxt "tfrmfileunlock.btnunlock.caption"
|
||
msgid "Unlock"
|
||
msgstr ""
|
||
|
||
#: tfrmfileunlock.btnunlockall.caption
|
||
msgid "Unlock All"
|
||
msgstr ""
|
||
|
||
#: tfrmfileunlock.caption
|
||
msgctxt "tfrmfileunlock.caption"
|
||
msgid "Unlock"
|
||
msgstr ""
|
||
|
||
#: tfrmfileunlock.stgfilehandles.columns[0].title.caption
|
||
msgid "File Handle"
|
||
msgstr ""
|
||
|
||
#: tfrmfileunlock.stgfilehandles.columns[1].title.caption
|
||
msgid "Process ID"
|
||
msgstr ""
|
||
|
||
#: tfrmfileunlock.stgfilehandles.columns[2].title.caption
|
||
msgid "Executable Path"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actcancel.caption
|
||
#, fuzzy
|
||
#| msgid "Cancel"
|
||
msgctxt "tfrmfinddlg.actcancel.caption"
|
||
msgid "C&ancel"
|
||
msgstr "Отказ"
|
||
|
||
#: tfrmfinddlg.actcancelclose.caption
|
||
msgid "Cancel search and close window"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actclose.caption
|
||
#, fuzzy
|
||
#| msgid "Close"
|
||
msgctxt "tfrmfinddlg.actclose.caption"
|
||
msgid "&Close"
|
||
msgstr "Затваряне"
|
||
|
||
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
||
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actedit.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfinddlg.actedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "&Обработка"
|
||
|
||
#: tfrmfinddlg.actfeedtolistbox.caption
|
||
msgid "Feed to &listbox"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actfreefrommem.caption
|
||
msgid "Cancel search, close and free from memory"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actfreefrommemallothers.caption
|
||
msgid "For all other \"Find files\", cancel, close and free from memory"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actgotofile.caption
|
||
#, fuzzy
|
||
#| msgid "Go to file"
|
||
msgid "&Go to file"
|
||
msgstr "Отиване до файл"
|
||
|
||
#: tfrmfinddlg.actintellifocus.caption
|
||
msgctxt "tfrmfinddlg.actintellifocus.caption"
|
||
msgid "Find Data"
|
||
msgstr "Търсене на данни"
|
||
|
||
#: tfrmfinddlg.actlastsearch.caption
|
||
#, fuzzy
|
||
#| msgid "Last search"
|
||
msgid "&Last search"
|
||
msgstr "Последно търсене"
|
||
|
||
#: tfrmfinddlg.actnewsearch.caption
|
||
#, fuzzy
|
||
#| msgid "New search"
|
||
msgid "&New search"
|
||
msgstr "Ново търсене"
|
||
|
||
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
||
msgid "New search (clear filters)"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageadvanced.caption
|
||
msgid "Go to page \"Advanced\""
|
||
msgstr "Отиване на страница „Разширени‟"
|
||
|
||
#: tfrmfinddlg.actpageloadsave.caption
|
||
msgid "Go to page \"Load/Save\""
|
||
msgstr "Отиване на страница „Зареждане/съхраняване‟"
|
||
|
||
#: tfrmfinddlg.actpagenext.caption
|
||
msgid "Switch to Nex&t Page"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageplugins.caption
|
||
msgid "Go to page \"Plugins\""
|
||
msgstr "Отиване на страница „Приставки‟"
|
||
|
||
#: tfrmfinddlg.actpageprev.caption
|
||
msgid "Switch to &Previous Page"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageresults.caption
|
||
msgid "Go to page \"Results\""
|
||
msgstr "Отиване на страница „Резултат‟"
|
||
|
||
#: tfrmfinddlg.actpagestandard.caption
|
||
msgid "Go to page \"Standard\""
|
||
msgstr "Отиване на страница „Обичайна‟"
|
||
|
||
#: tfrmfinddlg.actstart.caption
|
||
#, fuzzy
|
||
#| msgid "Start"
|
||
msgctxt "tfrmfinddlg.actstart.caption"
|
||
msgid "&Start"
|
||
msgstr "Начало"
|
||
|
||
#: tfrmfinddlg.actview.caption
|
||
#, fuzzy
|
||
#| msgid "View"
|
||
msgctxt "tfrmfinddlg.actview.caption"
|
||
msgid "&View"
|
||
msgstr "Изглед"
|
||
|
||
#: tfrmfinddlg.btnaddattribute.caption
|
||
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmfinddlg.btnattrshelp.caption
|
||
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Помо&щ"
|
||
|
||
#: tfrmfinddlg.btnsavetemplate.caption
|
||
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Съхраняване"
|
||
|
||
#: tfrmfinddlg.btnsearchdelete.caption
|
||
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmfinddlg.btnsearchload.caption
|
||
msgid "L&oad"
|
||
msgstr "За&реждане"
|
||
|
||
#: tfrmfinddlg.btnsearchsave.caption
|
||
msgid "S&ave"
|
||
msgstr "&Съхраняване"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
||
msgid "Sa&ve with \"Start in directory\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
||
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.btnusetemplate.caption
|
||
msgid "Use template"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.caption
|
||
msgctxt "tfrmfinddlg.caption"
|
||
msgid "Find files"
|
||
msgstr "Търсене на файлове"
|
||
|
||
#: tfrmfinddlg.cbcasesens.caption
|
||
msgid "Case sens&itive"
|
||
msgstr "Отчитане на глАВноСТта"
|
||
|
||
#: tfrmfinddlg.cbdatefrom.caption
|
||
msgid "&Date from:"
|
||
msgstr "Дата &от:"
|
||
|
||
#: tfrmfinddlg.cbdateto.caption
|
||
msgid "Dat&e to:"
|
||
msgstr "Дата &до:"
|
||
|
||
#: tfrmfinddlg.cbfilesizefrom.caption
|
||
msgid "S&ize from:"
|
||
msgstr "Файлов &размер от:"
|
||
|
||
#: tfrmfinddlg.cbfilesizeto.caption
|
||
msgid "Si&ze to:"
|
||
msgstr "Файлов раз&мер до:"
|
||
|
||
#: tfrmfinddlg.cbfindinarchive.caption
|
||
msgid "Search in &archives"
|
||
msgstr "Търсене в &архиви"
|
||
|
||
#: tfrmfinddlg.cbfindtext.caption
|
||
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
|
||
msgid "Find &text in file"
|
||
msgstr "Търсене във файл"
|
||
|
||
#: tfrmfinddlg.cbfollowsymlinks.caption
|
||
msgctxt "tfrmfinddlg.cbfollowsymlinks.caption"
|
||
msgid "Follow s&ymlinks"
|
||
msgstr "Следване на &меките връзки"
|
||
|
||
#: tfrmfinddlg.cbnotcontainingtext.caption
|
||
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
|
||
msgid "Find files N&OT containing the text"
|
||
msgstr "Намиране на файлове НЕсъдържащи текста"
|
||
|
||
#: tfrmfinddlg.cbnotolderthan.caption
|
||
msgid "N&ot older than:"
|
||
msgstr "Не по- &стар от:"
|
||
|
||
#: tfrmfinddlg.cbopenedtabs.caption
|
||
msgid "Opened tabs"
|
||
msgstr "Отворени подпрозорци"
|
||
|
||
#: tfrmfinddlg.cbpartialnamesearch.caption
|
||
msgid "Searc&h for part of file name"
|
||
msgstr "Търсене за &част от името"
|
||
|
||
#: tfrmfinddlg.cbregexp.caption
|
||
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
|
||
msgid "&Regular expression"
|
||
msgstr "&Обичайни изрази"
|
||
|
||
#: tfrmfinddlg.cbreplacetext.caption
|
||
msgid "Re&place by"
|
||
msgstr "За&мяна с"
|
||
|
||
#: tfrmfinddlg.cbselectedfiles.caption
|
||
msgid "Selected directories and &files"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.cbtextregexp.caption
|
||
msgid "Regular &expression"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.cbtimefrom.caption
|
||
msgid "&Time from:"
|
||
msgstr "Време &от:"
|
||
|
||
#: tfrmfinddlg.cbtimeto.caption
|
||
msgid "Ti&me to:"
|
||
msgstr "Време &до:"
|
||
|
||
#: tfrmfinddlg.cbuseplugin.caption
|
||
msgid "&Use search plugin:"
|
||
msgstr "Използване на приставка за търсене:"
|
||
|
||
#: tfrmfinddlg.chkhex.caption
|
||
msgid "Hexadecimal"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.cmbexcludedirectories.hint
|
||
msgid "Enter directories names that should be excluded from search separated with \";\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.cmbexcludefiles.hint
|
||
msgid "Enter files names that should be excluded from search separated with \";\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.hint
|
||
msgid "Enter files names separated with \";\""
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.gbdirectories.caption
|
||
msgctxt "tfrmfinddlg.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Папки"
|
||
|
||
#: tfrmfinddlg.gbfiles.caption
|
||
msgctxt "tfrmfinddlg.gbfiles.caption"
|
||
msgid "Files"
|
||
msgstr "Файлове"
|
||
|
||
#: tfrmfinddlg.gbfinddata.caption
|
||
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
||
msgid "Find Data"
|
||
msgstr "Търсене на данни"
|
||
|
||
#: tfrmfinddlg.lblattributes.caption
|
||
msgid "Attri&butes"
|
||
msgstr "Прин&адлежности:"
|
||
|
||
#: tfrmfinddlg.lblencoding.caption
|
||
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
|
||
msgid "Encodin&g:"
|
||
msgstr "Знаков &набор:"
|
||
|
||
#: tfrmfinddlg.lblexcludedirectories.caption
|
||
msgid "E&xclude subdirectories"
|
||
msgstr "Изключване на &подпапките"
|
||
|
||
#: tfrmfinddlg.lblexcludefiles.caption
|
||
msgid "&Exclude files"
|
||
msgstr "Изключване на &файловете"
|
||
|
||
#: tfrmfinddlg.lblfindfilemask.caption
|
||
msgid "&File mask"
|
||
msgstr "Файл"
|
||
|
||
#: tfrmfinddlg.lblfindpathstart.caption
|
||
msgid "Start in &directory"
|
||
msgstr "Започване в &папка"
|
||
|
||
#: tfrmfinddlg.lblsearchdepth.caption
|
||
msgid "Search su&bdirectories:"
|
||
msgstr "Търсене на по&дпапки:"
|
||
|
||
#: tfrmfinddlg.lbltemplateheader.caption
|
||
msgid "&Previous searches:"
|
||
msgstr "Пре&дишни търсения:"
|
||
|
||
#: tfrmfinddlg.miaction.caption
|
||
msgid "&Action"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.mifreefrommemallothers.caption
|
||
msgid "For all others, cancel, close and free from memory"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.miopeninnewtab.caption
|
||
msgid "Open In New Tab(s)"
|
||
msgstr "Отваряне в нов подпрозорец/ци"
|
||
|
||
#: tfrmfinddlg.mioptions.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfinddlg.mioptions.caption"
|
||
msgid "Options"
|
||
msgstr "Възможности"
|
||
|
||
#: tfrmfinddlg.miremovefromllist.caption
|
||
msgid "Remove from list"
|
||
msgstr "изтриване от списъка"
|
||
|
||
#: tfrmfinddlg.miresult.caption
|
||
msgid "&Result"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.mishowallfound.caption
|
||
msgid "Show all found items"
|
||
msgstr "Показване на всички намерени предмети"
|
||
|
||
#: tfrmfinddlg.mishowineditor.caption
|
||
msgid "Show In Editor"
|
||
msgstr "Показване в обработчика"
|
||
|
||
#: tfrmfinddlg.mishowinviewer.caption
|
||
msgid "Show In Viewer"
|
||
msgstr "Показване в прегледа"
|
||
|
||
#: tfrmfinddlg.miviewtab.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfinddlg.miviewtab.caption"
|
||
msgid "&View"
|
||
msgstr "&Преглед"
|
||
|
||
#: tfrmfinddlg.tsadvanced.caption
|
||
msgid "Advanced"
|
||
msgstr "Разширени"
|
||
|
||
#: tfrmfinddlg.tsloadsave.caption
|
||
msgid "Load/Save"
|
||
msgstr "Зареждане/ Съхраняване"
|
||
|
||
#: tfrmfinddlg.tsplugins.caption
|
||
msgctxt "tfrmfinddlg.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Приставки"
|
||
|
||
#: tfrmfinddlg.tsresults.caption
|
||
msgid "Results"
|
||
msgstr "Намерено"
|
||
|
||
#: tfrmfinddlg.tsstandard.caption
|
||
msgid "Standard"
|
||
msgstr "Обичайно"
|
||
|
||
#: tfrmfindview.btnclose.caption
|
||
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmfindview.btnfind.caption
|
||
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
||
msgid "&Find"
|
||
msgstr "&Търсене"
|
||
|
||
#: tfrmfindview.caption
|
||
msgctxt "TFRMFINDVIEW.CAPTION"
|
||
msgid "Find"
|
||
msgstr "Търсене"
|
||
|
||
#: tfrmfindview.cbcasesens.caption
|
||
msgid "C&ase sensitive"
|
||
msgstr "Отчитане на &глаВНостТА"
|
||
|
||
#: tfrmhardlink.btncancel.caption
|
||
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmhardlink.btnok.caption
|
||
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmhardlink.caption
|
||
msgid "Create hard link"
|
||
msgstr "Създаване на твърда връзка"
|
||
|
||
#: tfrmhardlink.lblexistingfile.caption
|
||
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "Съществуваща &цел, към която да сочи връзката"
|
||
|
||
#: tfrmhardlink.lbllinktocreate.caption
|
||
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "&Име на връзката"
|
||
|
||
#: tfrmhotdirexportimport.btnselectall.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
|
||
msgid "Import all!"
|
||
msgstr "Внасяне на всички"
|
||
|
||
#: tfrmhotdirexportimport.btnselectiondone.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
|
||
msgid "Import selected"
|
||
msgstr "Внасяне на избраните"
|
||
|
||
#: tfrmhotdirexportimport.caption
|
||
msgctxt "tfrmhotdirexportimport.caption"
|
||
msgid "Select the entries your want to import"
|
||
msgstr ""
|
||
|
||
#: tfrmhotdirexportimport.lbhint.caption
|
||
msgctxt "tfrmhotdirexportimport.lbhint.caption"
|
||
msgid "When clicking a sub-menu, it will select the whole menu"
|
||
msgstr ""
|
||
|
||
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
||
msgid "Hold CTRL and click entries to select multiple ones"
|
||
msgstr ""
|
||
|
||
#: tfrmlinker.btnsave.caption
|
||
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmlinker.caption
|
||
msgctxt "TFRMLINKER.CAPTION"
|
||
msgid "Linker"
|
||
msgstr "Сглобяване на файл"
|
||
|
||
#: tfrmlinker.gbsaveto.caption
|
||
msgid "Save to..."
|
||
msgstr "Съхраняване в..."
|
||
|
||
#: tfrmlinker.grbxcontrol.caption
|
||
msgid "Item"
|
||
msgstr "Предмет"
|
||
|
||
#: tfrmlinker.lblfilename.caption
|
||
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
|
||
msgid "&File name"
|
||
msgstr "Файлово &име"
|
||
|
||
#: tfrmlinker.spbtndown.caption
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
|
||
msgid "Do&wn"
|
||
msgstr "На&долу"
|
||
|
||
#: tfrmlinker.spbtndown.hint
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
|
||
msgid "Down"
|
||
msgstr "Надолу"
|
||
|
||
#: tfrmlinker.spbtnrem.caption
|
||
msgctxt "tfrmlinker.spbtnrem.caption"
|
||
msgid "&Remove"
|
||
msgstr "Пре&махване"
|
||
|
||
#: tfrmlinker.spbtnrem.hint
|
||
msgctxt "tfrmlinker.spbtnrem.hint"
|
||
msgid "Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmlinker.spbtnup.caption
|
||
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
|
||
msgid "&Up"
|
||
msgstr "На&горе"
|
||
|
||
#: tfrmlinker.spbtnup.hint
|
||
msgctxt "TFRMLINKER.SPBTNUP.HINT"
|
||
msgid "Up"
|
||
msgstr "Нагоре"
|
||
|
||
#: tfrmmain.actabout.caption
|
||
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
|
||
msgid "&About"
|
||
msgstr "&За"
|
||
|
||
#: tfrmmain.actactivatetabbyindex.caption
|
||
msgid "Activate Tab By Index"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actaddfilenametocmdline.caption
|
||
msgid "Add file name to command line"
|
||
msgstr "Добавяне името на файла в командния ред"
|
||
|
||
#: tfrmmain.actaddnewsearch.caption
|
||
msgid "New search instance..."
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
||
msgid "Add path and file name to command line"
|
||
msgstr "Добавяне на пътя и файловото име в командния ред"
|
||
|
||
#: tfrmmain.actaddpathtocmdline.caption
|
||
msgid "Copy path to command line"
|
||
msgstr "Преписване на пътя в реда управление"
|
||
|
||
#: tfrmmain.actbenchmark.caption
|
||
msgid "&Benchmark"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actbriefview.caption
|
||
msgctxt "tfrmmain.actbriefview.caption"
|
||
msgid "Brief view"
|
||
msgstr "Съкратен"
|
||
|
||
#: tfrmmain.actbriefview.hint
|
||
msgid "Brief View"
|
||
msgstr "Съкратен изглед"
|
||
|
||
#: tfrmmain.actcalculatespace.caption
|
||
msgid "Calculate &Occupied Space"
|
||
msgstr "Изчисляване на &заетото място..."
|
||
|
||
#: tfrmmain.actchangedir.caption
|
||
msgid "Change directory"
|
||
msgstr "Смяна на папката"
|
||
|
||
#: tfrmmain.actchangedirtohome.caption
|
||
msgid "Change directory to home"
|
||
msgstr "Отиване в домашната папка"
|
||
|
||
#: tfrmmain.actchangedirtoparent.caption
|
||
msgid "Change Directory To Parent"
|
||
msgstr "Папка нагоре"
|
||
|
||
#: tfrmmain.actchangedirtoroot.caption
|
||
msgid "Change directory to root"
|
||
msgstr "В основната папка"
|
||
|
||
#: tfrmmain.actchecksumcalc.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
|
||
msgid "Calculate Check&sum..."
|
||
msgstr "Изчисляване на проверочен &сбор..."
|
||
|
||
#: tfrmmain.actchecksumverify.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
|
||
msgid "&Verify Checksum..."
|
||
msgstr "&Потвърждаване на проверочен сбор..."
|
||
|
||
#: tfrmmain.actclearlogfile.caption
|
||
msgid "Clear log file"
|
||
msgstr "Изчистване на дневника"
|
||
|
||
#: tfrmmain.actclearlogwindow.caption
|
||
msgid "Clear log window"
|
||
msgstr "Изчистване на прозореца на дневника"
|
||
|
||
#: tfrmmain.actclosealltabs.caption
|
||
msgctxt "tfrmmain.actclosealltabs.caption"
|
||
msgid "Close &All Tabs"
|
||
msgstr "Затваряне на вси&чки подпрозорци"
|
||
|
||
#: tfrmmain.actcloseduplicatetabs.caption
|
||
msgid "Close Duplicate Tabs"
|
||
msgstr "Затваряне на повтарящите се подпрозорци"
|
||
|
||
#: tfrmmain.actclosetab.caption
|
||
msgctxt "tfrmmain.actclosetab.caption"
|
||
msgid "&Close Tab"
|
||
msgstr "&Затваряне на подпрозореца"
|
||
|
||
#: tfrmmain.actcmdlinenext.caption
|
||
msgid "Next Command Line"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcmdlinenext.hint
|
||
msgid "Set command line to next command in history"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcmdlineprev.caption
|
||
msgid "Previous Command Line"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcmdlineprev.hint
|
||
msgid "Set command line to previous command in history"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcolumnsview.caption
|
||
msgid "Full"
|
||
msgstr "Пълен"
|
||
|
||
#: tfrmmain.actcolumnsview.hint
|
||
msgid "Columns View"
|
||
msgstr "Стълбов изглед"
|
||
|
||
#: tfrmmain.actcomparecontents.caption
|
||
msgid "Compare by &Contents"
|
||
msgstr "Сравняване по &съдържание"
|
||
|
||
#: tfrmmain.actcomparedirectories.caption
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
|
||
msgid "Compare Directories"
|
||
msgstr "Сравняване на папките"
|
||
|
||
#: tfrmmain.actcomparedirectories.hint
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
||
msgid "Compare Directories"
|
||
msgstr "Сравняване на папките"
|
||
|
||
#: tfrmmain.actconfigarchivers.caption
|
||
msgid "Configuration of Archivers"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigdirhotlist.caption
|
||
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Настройка на предпочитаните папки"
|
||
|
||
#: tfrmmain.actconfigfavoritetabs.caption
|
||
msgid "Configuration of Favorite Tabs"
|
||
msgstr "Настройка на предпочитаните подпрозорци"
|
||
|
||
#: tfrmmain.actconfigfoldertabs.caption
|
||
msgid "Configuration of folder tabs"
|
||
msgstr "Настройка на подпрозорците за папките"
|
||
|
||
#: tfrmmain.actconfighotkeys.caption
|
||
msgctxt "tfrmmain.actconfighotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigplugins.caption
|
||
msgid "Configuration of Plugins"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigsavesettings.caption
|
||
msgid "Save Settings"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigsearches.caption
|
||
msgid "Configuration of searches"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigtoolbars.caption
|
||
msgid "Toolbar..."
|
||
msgstr "Лента с пособия..."
|
||
|
||
#: tfrmmain.actconfigtooltips.caption
|
||
msgid "Configuration of tooltips"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actconfigtreeviewmenus.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Настройка на дървовидния изглед"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcontextmenu.caption
|
||
msgid "Show context menu"
|
||
msgstr "Показване на изскачащ изборник"
|
||
|
||
#: tfrmmain.actcopy.caption
|
||
msgctxt "tfrmmain.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Презапис"
|
||
|
||
#: tfrmmain.actcopyalltabstoopposite.caption
|
||
msgid "Copy all tabs to opposite side"
|
||
msgstr "Презапис на всички подпрозорци от другата страна"
|
||
|
||
#: tfrmmain.actcopyfiledetailstoclip.caption
|
||
msgid "Copy all shown &columns"
|
||
msgstr "Запомняне на всички из§брани стълбове"
|
||
|
||
#: tfrmmain.actcopyfullnamestoclip.caption
|
||
msgid "Copy Filename(s) with Full &Path"
|
||
msgstr "Запомняне на файловото/ите име/на и пълния &път"
|
||
|
||
#: tfrmmain.actcopynamestoclip.caption
|
||
msgid "Copy &Filename(s) to Clipboard"
|
||
msgstr "Запомняне на &файловото/ите име/на в кошницата"
|
||
|
||
#: tfrmmain.actcopynoask.caption
|
||
msgid "Copy files without asking for confirmation"
|
||
msgstr "Презапис на файловете без искане на потвърждение"
|
||
|
||
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actcopypathoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s)"
|
||
msgstr "Запомняне на пълния път на избрания файл(ове)"
|
||
|
||
#: tfrmmain.actcopysamepanel.caption
|
||
msgid "Copy to same panel"
|
||
msgstr "Презапис в същото крило"
|
||
|
||
#: tfrmmain.actcopytoclipboard.caption
|
||
msgid "&Copy"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmmain.actcountdircontent.caption
|
||
msgid "Sho&w Occupied Space"
|
||
msgstr "&Показване на заетото място"
|
||
|
||
#: tfrmmain.actcuttoclipboard.caption
|
||
msgid "Cu&t"
|
||
msgstr "Изрязване"
|
||
|
||
#: tfrmmain.actdebugshowcommandparameters.caption
|
||
msgid "Show Command Parameters"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actdelete.caption
|
||
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Изтриване"
|
||
|
||
#: tfrmmain.actdeletesearches.caption
|
||
msgid "For all searches, cancel, close and free memory"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actdirhistory.caption
|
||
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
|
||
msgid "Directory history"
|
||
msgstr "Дневник на папката"
|
||
|
||
#: tfrmmain.actdirhotlist.caption
|
||
msgid "Directory &Hotlist"
|
||
msgstr "&Бързодостъпни папки"
|
||
|
||
#: tfrmmain.actdoanycmcommand.caption
|
||
msgid "Select any command and execute it"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actedit.caption
|
||
msgctxt "tfrmmain.actedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Обработка"
|
||
|
||
#: tfrmmain.acteditcomment.caption
|
||
msgid "Edit Co&mment..."
|
||
msgstr "Промяна на &бележката..."
|
||
|
||
#: tfrmmain.acteditnew.caption
|
||
msgid "Edit new file"
|
||
msgstr "Обработка на нов файл"
|
||
|
||
#: tfrmmain.acteditpath.caption
|
||
msgid "Edit path field above file list"
|
||
msgstr "Обработка на полето за пътя над файловия списък"
|
||
|
||
#: tfrmmain.actexchange.caption
|
||
msgid "Swap &Panels"
|
||
msgstr "Размяна на &крилата"
|
||
|
||
#: tfrmmain.actexecutescript.caption
|
||
msgid "Execute Script"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actexit.caption
|
||
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Из&ход"
|
||
|
||
#: tfrmmain.actextractfiles.caption
|
||
msgid "&Extract Files..."
|
||
msgstr "Из&вличане на файлове..."
|
||
|
||
#: tfrmmain.actfileassoc.caption
|
||
msgid "Configuration of File &Associations"
|
||
msgstr "Настройка на файловите об&вързвания..."
|
||
|
||
#: tfrmmain.actfilelinker.caption
|
||
msgid "Com&bine Files..."
|
||
msgstr "С&глобяване на файлове..."
|
||
|
||
#: tfrmmain.actfileproperties.caption
|
||
msgid "Show &File Properties"
|
||
msgstr "Показване на файловите &свойства"
|
||
|
||
#: tfrmmain.actfilespliter.caption
|
||
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
|
||
msgid "Spl&it File..."
|
||
msgstr "Раз&дробяване на файл"
|
||
|
||
#: tfrmmain.actflatview.caption
|
||
msgid "&Flat view"
|
||
msgstr "&Плосък изглед"
|
||
|
||
#: tfrmmain.actfocuscmdline.caption
|
||
msgid "Focus command line"
|
||
msgstr "Сочене на реда за управление"
|
||
|
||
#: tfrmmain.actfocusswap.caption
|
||
msgid "Swap focus"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actfocusswap.hint
|
||
msgid "Switch between left and right file list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actfocustreeview.caption
|
||
msgid "Focus on tree view"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actfocustreeview.hint
|
||
msgid "Switch between current file list and tree view (if enabled)"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actgotofirstfile.caption
|
||
msgid "Place cursor on first file in list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actgotolastfile.caption
|
||
msgid "Place cursor on last file in list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.acthardlink.caption
|
||
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
|
||
msgid "Create &Hard Link..."
|
||
msgstr "Създаване на &твърда връзка..."
|
||
|
||
#: tfrmmain.acthelpindex.caption
|
||
msgid "&Contents"
|
||
msgstr "Съ&държание"
|
||
|
||
#: tfrmmain.acthorizontalfilepanels.caption
|
||
msgid "&Horizontal Panels Mode"
|
||
msgstr "&Водоравно подреждане на крилата"
|
||
|
||
#: tfrmmain.actkeyboard.caption
|
||
msgid "&Keyboard"
|
||
msgstr "&Клавиатура"
|
||
|
||
#: tfrmmain.actleftbriefview.caption
|
||
msgid "Brief view on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftcolumnsview.caption
|
||
msgid "Columns view on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftequalright.caption
|
||
msgid "Left &= Right"
|
||
msgstr "Ляво &= дясно"
|
||
|
||
#: tfrmmain.actleftflatview.caption
|
||
msgid "&Flat view on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftopendrives.caption
|
||
msgid "Open left drive list"
|
||
msgstr "Първо се отваря лявото крило"
|
||
|
||
#: tfrmmain.actleftreverseorder.caption
|
||
msgid "Re&verse order on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbyattr.caption
|
||
msgid "Sort left panel by &Attributes"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbydate.caption
|
||
msgid "Sort left panel by &Date"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbyext.caption
|
||
msgid "Sort left panel by &Extension"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbyname.caption
|
||
msgid "Sort left panel by &Name"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftsortbysize.caption
|
||
msgid "Sort left panel by &Size"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actleftthumbview.caption
|
||
msgid "Thumbnails view on left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actloadfavoritetabs.caption
|
||
msgid "Load tabs from Favorite Tabs"
|
||
msgstr "Зареждане на подпрозорци от списък с предпочитания"
|
||
|
||
#: tfrmmain.actloadselectionfromclip.caption
|
||
msgid "Load Selection from Clip&board"
|
||
msgstr "Зареждане на отбелязването от ко&шницата"
|
||
|
||
#: tfrmmain.actloadselectionfromfile.caption
|
||
msgid "&Load Selection from File..."
|
||
msgstr "&Зареждане на отбелязването от файл"
|
||
|
||
#: tfrmmain.actloadtabs.caption
|
||
msgid "&Load Tabs from File"
|
||
msgstr "&Зареждане на подпрозорци от файл"
|
||
|
||
#: tfrmmain.actmakedir.caption
|
||
msgid "Create &Directory"
|
||
msgstr "&Нова папка"
|
||
|
||
#: tfrmmain.actmarkcurrentextension.caption
|
||
msgid "Select All with the Same E&xtension"
|
||
msgstr "Избор на всички със същото раз&ширение"
|
||
|
||
#: tfrmmain.actmarkcurrentname.caption
|
||
msgid "Select all files with same name"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actmarkcurrentnameext.caption
|
||
msgid "Select all files with same name and extension"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actmarkcurrentpath.caption
|
||
msgid "Select all in same path"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actmarkinvert.caption
|
||
msgid "&Invert Selection"
|
||
msgstr "О&бръщане на избора"
|
||
|
||
#: tfrmmain.actmarkmarkall.caption
|
||
msgid "&Select All"
|
||
msgstr "Избор на вси&чки"
|
||
|
||
#: tfrmmain.actmarkminus.caption
|
||
msgid "Unselect a Gro&up..."
|
||
msgstr "С&немане на избора от група"
|
||
|
||
#: tfrmmain.actmarkplus.caption
|
||
msgid "Select a &Group..."
|
||
msgstr "Избор на &група"
|
||
|
||
#: tfrmmain.actmarkunmarkall.caption
|
||
msgid "&Unselect All"
|
||
msgstr "С&немане на избора от всички"
|
||
|
||
#: tfrmmain.actminimize.caption
|
||
msgid "Minimize window"
|
||
msgstr "Смаляване на прозореца"
|
||
|
||
#: tfrmmain.actmultirename.caption
|
||
msgid "Multi &Rename Tool"
|
||
msgstr "&Множествено преименуване"
|
||
|
||
#: tfrmmain.actnetworkconnect.caption
|
||
msgid "Network &Connect..."
|
||
msgstr "Зака&чане към мрежа..."
|
||
|
||
#: tfrmmain.actnetworkdisconnect.caption
|
||
msgid "Network &Disconnect"
|
||
msgstr "&Разкачане от мрежа"
|
||
|
||
#: tfrmmain.actnetworkquickconnect.caption
|
||
msgid "Network &Quick Connect..."
|
||
msgstr "Бързо зака&чане към мрежа..."
|
||
|
||
#: tfrmmain.actnewtab.caption
|
||
msgid "&New Tab"
|
||
msgstr "&Нов подпрозорец"
|
||
|
||
#: tfrmmain.actnextfavoritetabs.caption
|
||
msgid "Load the Next Favorite Tabs in the list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actnexttab.caption
|
||
msgid "Switch to Nex&t Tab"
|
||
msgstr "Преминаване на следва&щия подпрозорец"
|
||
|
||
#: tfrmmain.actopen.caption
|
||
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Отваряне"
|
||
|
||
#: tfrmmain.actopenarchive.caption
|
||
msgid "Try open archive"
|
||
msgstr "Опит за отваряне на файл"
|
||
|
||
#: tfrmmain.actopenbar.caption
|
||
msgid "Open bar file"
|
||
msgstr "Отваряне на файл за ленти с пособия"
|
||
|
||
#: tfrmmain.actopendirinnewtab.caption
|
||
msgid "Open &Folder in a New Tab"
|
||
msgstr "Отваряне на &папката в нов подпрозорец"
|
||
|
||
#: tfrmmain.actopendrivebyindex.caption
|
||
msgid "Open Drive by Index"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
||
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
|
||
msgid "Open &VFS List"
|
||
msgstr "Отваряне на &VFS списък"
|
||
|
||
#: tfrmmain.actoperationsviewer.caption
|
||
msgid "Operations &Viewer"
|
||
msgstr "Преглед на &действията"
|
||
|
||
#: tfrmmain.actoptions.caption
|
||
msgid "&Options..."
|
||
msgstr "Въз&можности..."
|
||
|
||
#: tfrmmain.actpackfiles.caption
|
||
msgid "&Pack Files..."
|
||
msgstr "Сбиване на файлове..."
|
||
|
||
#: tfrmmain.actpanelssplitterperpos.caption
|
||
msgid "Set splitter position"
|
||
msgstr "Задаване на положението на разделителя"
|
||
|
||
#: tfrmmain.actpastefromclipboard.caption
|
||
msgid "&Paste"
|
||
msgstr "Поставяне"
|
||
|
||
#: tfrmmain.actpreviousfavoritetabs.caption
|
||
msgid "Load the Previous Favorite Tabs in the list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actprevtab.caption
|
||
msgid "Switch to &Previous Tab"
|
||
msgstr "Преминаване към пред&ходния подпрозорец"
|
||
|
||
#: tfrmmain.actquickfilter.caption
|
||
msgid "Quick filter"
|
||
msgstr "Бързо пресяване"
|
||
|
||
#: tfrmmain.actquicksearch.caption
|
||
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
|
||
msgid "Quick search"
|
||
msgstr "Бързо търсене"
|
||
|
||
#: tfrmmain.actquickview.caption
|
||
msgid "&Quick View Panel"
|
||
msgstr "Крило за &бърз преглед"
|
||
|
||
#: tfrmmain.actrefresh.caption
|
||
msgid "&Refresh"
|
||
msgstr "О&пресняване"
|
||
|
||
#: tfrmmain.actreloadfavoritetabs.caption
|
||
msgid "Reload the last Favorite Tabs loaded"
|
||
msgstr "Презареждане на последния зареден списък с предпочитания"
|
||
|
||
#: tfrmmain.actrename.caption
|
||
msgctxt "tfrmmain.actrename.caption"
|
||
msgid "Move"
|
||
msgstr "Местене"
|
||
|
||
#: tfrmmain.actrenamenoask.caption
|
||
msgid "Move/Rename files without asking for confirmation"
|
||
msgstr "Местене/ преименуване без искане на потвърждение"
|
||
|
||
#: tfrmmain.actrenameonly.caption
|
||
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Преименуване"
|
||
|
||
#: tfrmmain.actrenametab.caption
|
||
msgid "&Rename Tab"
|
||
msgstr "Пре&именуване на подпрозореца"
|
||
|
||
#: tfrmmain.actresavefavoritetabs.caption
|
||
msgid "Resave on the last Favorite Tabs loaded"
|
||
msgstr "Съхраняване на текущите подпрозорци в последния зареден списък с предпочитания"
|
||
|
||
#: tfrmmain.actrestoreselection.caption
|
||
msgid "&Restore Selection"
|
||
msgstr "Въз&становяване на отбелязването"
|
||
|
||
#: tfrmmain.actreverseorder.caption
|
||
msgid "Re&verse Order"
|
||
msgstr "О&бръщане на реда"
|
||
|
||
#: tfrmmain.actrightbriefview.caption
|
||
msgid "Brief view on right panel"
|
||
msgstr "Съкратен преглед в дясното крило"
|
||
|
||
#: tfrmmain.actrightcolumnsview.caption
|
||
msgid "Columns view on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightequalleft.caption
|
||
msgid "Right &= Left"
|
||
msgstr "Десен &= Ляв"
|
||
|
||
#: tfrmmain.actrightflatview.caption
|
||
msgid "&Flat view on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightopendrives.caption
|
||
msgid "Open right drive list"
|
||
msgstr "Първо се отваря дясното крило"
|
||
|
||
#: tfrmmain.actrightreverseorder.caption
|
||
msgid "Re&verse order on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbyattr.caption
|
||
msgid "Sort right panel by &Attributes"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbydate.caption
|
||
msgid "Sort right panel by &Date"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbyext.caption
|
||
msgid "Sort right panel by &Extension"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbyname.caption
|
||
msgid "Sort right panel by &Name"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightsortbysize.caption
|
||
msgid "Sort right panel by &Size"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrightthumbview.caption
|
||
msgid "Thumbnails view on right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actrunterm.caption
|
||
msgid "Run &Terminal"
|
||
msgstr "Отваряне на &терминала"
|
||
|
||
#: tfrmmain.actsavefavoritetabs.caption
|
||
msgid "Save current tabs to a New Favorite Tabs"
|
||
msgstr "Съхраняване на текущите подпрозорци в нов списък с предпочитания"
|
||
|
||
#: tfrmmain.actsaveselection.caption
|
||
msgid "Sa&ve Selection"
|
||
msgstr "Съхраняване на от&белязването"
|
||
|
||
#: tfrmmain.actsaveselectiontofile.caption
|
||
msgid "Save S&election to File..."
|
||
msgstr "Съхраняване на отбелязването във &файл"
|
||
|
||
#: tfrmmain.actsavetabs.caption
|
||
msgid "&Save Tabs to File"
|
||
msgstr "&Съхраняване на подпрозорците във файл"
|
||
|
||
#: tfrmmain.actsearch.caption
|
||
msgid "&Search..."
|
||
msgstr "&Търсене..."
|
||
|
||
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
||
msgid "All tabs Locked with Dir Opened in New Tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsetalltabsoptionnormal.caption
|
||
msgid "Set all tabs to Normal"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
||
msgid "Set all tabs to Locked"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
||
msgid "All tabs Locked with Dir Changes Allowed"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actsetfileproperties.caption
|
||
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change &Attributes..."
|
||
msgstr "Промяна на &принадлежностите..."
|
||
|
||
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
||
msgid "Locked with Directories Opened in New &Tabs"
|
||
msgstr "Заключен, с отваряне на папките в нови подпрозор&ци"
|
||
|
||
#: tfrmmain.actsettaboptionnormal.caption
|
||
msgid "&Normal"
|
||
msgstr "&Обикновен"
|
||
|
||
#: tfrmmain.actsettaboptionpathlocked.caption
|
||
msgid "&Locked"
|
||
msgstr "&Заключен"
|
||
|
||
#: tfrmmain.actsettaboptionpathresets.caption
|
||
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
|
||
msgid "Locked with &Directory Changes Allowed"
|
||
msgstr "Заключен, с разрешена смяна на &папката"
|
||
|
||
#: tfrmmain.actshellexecute.caption
|
||
msgctxt "tfrmmain.actshellexecute.caption"
|
||
msgid "Open"
|
||
msgstr "Отваряне"
|
||
|
||
#: tfrmmain.actshellexecute.hint
|
||
msgid "Open using system associations"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actshowbuttonmenu.caption
|
||
msgid "Show button menu"
|
||
msgstr "Показване на изборници на копчетата"
|
||
|
||
#: tfrmmain.actshowcmdlinehistory.caption
|
||
msgid "Show command line history"
|
||
msgstr "Показване на дневник на реда управление"
|
||
|
||
#: tfrmmain.actshowmainmenu.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
|
||
msgid "Menu"
|
||
msgstr "Изборник"
|
||
|
||
#: tfrmmain.actshowsysfiles.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
|
||
msgid "Show &Hidden/System Files"
|
||
msgstr "Показване на &скрити/ системни файлове"
|
||
|
||
#: tfrmmain.actsortbyattr.caption
|
||
msgid "Sort by &Attributes"
|
||
msgstr "Подреждане по &принадлежности"
|
||
|
||
#: tfrmmain.actsortbydate.caption
|
||
msgid "Sort by &Date"
|
||
msgstr "Подреждане по &дата"
|
||
|
||
#: tfrmmain.actsortbyext.caption
|
||
msgid "Sort by &Extension"
|
||
msgstr "Подреждане по раз&ширение"
|
||
|
||
#: tfrmmain.actsortbyname.caption
|
||
msgid "Sort by &Name"
|
||
msgstr "Подреждане по &име"
|
||
|
||
#: tfrmmain.actsortbysize.caption
|
||
msgid "Sort by &Size"
|
||
msgstr "Подреждане по раз&мер"
|
||
|
||
#: tfrmmain.actsrcopendrives.caption
|
||
msgid "Open drive list"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actswitchignorelist.caption
|
||
msgid "Enable/disable ignore list file to not show file names"
|
||
msgstr "Включване/ изключване на пренебрегването"
|
||
|
||
#: tfrmmain.actsymlink.caption
|
||
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
|
||
msgid "Create Symbolic &Link..."
|
||
msgstr "Създаване на &мека връзка..."
|
||
|
||
#: tfrmmain.actsyncdirs.caption
|
||
msgid "Syn&chronize dirs..."
|
||
msgstr "Съгласуване на папки..."
|
||
|
||
#: tfrmmain.acttargetequalsource.caption
|
||
msgid "Target &= Source"
|
||
msgstr "Цел &= източник"
|
||
|
||
#: tfrmmain.acttestarchive.caption
|
||
msgid "&Test Archive(s)"
|
||
msgstr "&Проверка на архив(и)"
|
||
|
||
#: tfrmmain.actthumbnailsview.caption
|
||
msgctxt "tfrmmain.actthumbnailsview.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Миниатюри"
|
||
|
||
#: tfrmmain.actthumbnailsview.hint
|
||
msgid "Thumbnails View"
|
||
msgstr "Изглед с миниатюри"
|
||
|
||
#: tfrmmain.acttogglefullscreenconsole.caption
|
||
msgid "Toggle fullscreen mode console"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.acttransferleft.caption
|
||
msgid "Transfer dir under cursor to left window"
|
||
msgstr "Прехвърляне на папката под показалеца в левия прозорец"
|
||
|
||
#: tfrmmain.acttransferright.caption
|
||
msgid "Transfer dir under cursor to right window"
|
||
msgstr "Прехвърляне на папката под показалеца в десния прозорец"
|
||
|
||
#: tfrmmain.acttreeview.caption
|
||
msgid "&Tree View Panel"
|
||
msgstr "Крило за &дървовиден изглед"
|
||
|
||
#: tfrmmain.actuniversalsingledirectsort.caption
|
||
msgid "Sort according to parameters"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actunmarkcurrentextension.caption
|
||
msgid "Unselect All with the Same Ex&tension"
|
||
msgstr "Снемане на избора на всички със същото раз&ширение"
|
||
|
||
#: tfrmmain.actunmarkcurrentname.caption
|
||
msgid "Unselect all files with same name"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actunmarkcurrentnameext.caption
|
||
msgid "Unselect all files with same name and extension"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actunmarkcurrentpath.caption
|
||
msgid "Unselect all in same path"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actview.caption
|
||
msgctxt "tfrmmain.actview.caption"
|
||
msgid "View"
|
||
msgstr "Преглед"
|
||
|
||
#: tfrmmain.actviewhistory.caption
|
||
msgid "Show history of visited paths for active view"
|
||
msgstr "Показване на списъка на посетените пътища в дейния преглед"
|
||
|
||
#: tfrmmain.actviewhistorynext.caption
|
||
msgid "Go to next entry in history"
|
||
msgstr "Към следващата точка от дневника"
|
||
|
||
#: tfrmmain.actviewhistoryprev.caption
|
||
msgid "Go to previous entry in history"
|
||
msgstr "Към предходната точка от дневника"
|
||
|
||
#: tfrmmain.actviewlogfile.caption
|
||
msgid "View log file"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actviewsearches.caption
|
||
msgid "View current search instances"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.actvisithomepage.caption
|
||
msgid "&Visit Double Commander Website"
|
||
msgstr "&Посещаване на мрежовото място на Double Commander"
|
||
|
||
#: tfrmmain.actwipe.caption
|
||
msgid "Wipe"
|
||
msgstr "Унищожаване"
|
||
|
||
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
||
msgid "Work with Directory Hotlist and parameters"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.btnf10.caption
|
||
msgctxt "tfrmmain.btnf10.caption"
|
||
msgid "Exit"
|
||
msgstr "Изход"
|
||
|
||
#: tfrmmain.btnf7.caption
|
||
msgctxt "tfrmmain.btnf7.caption"
|
||
msgid "Directory"
|
||
msgstr "Папка"
|
||
|
||
#: tfrmmain.btnf8.caption
|
||
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Изтриване"
|
||
|
||
#: tfrmmain.btnf9.caption
|
||
msgctxt "tfrmmain.btnf9.caption"
|
||
msgid "Terminal"
|
||
msgstr "Терминал"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Бързодостъпни папки"
|
||
|
||
#: tfrmmain.btnleftequalright.caption
|
||
msgctxt "tfrmmain.btnleftequalright.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmmain.btnleftequalright.hint
|
||
msgid "Show current directory of the right panel in the left panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.btnlefthome.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnlefthome.hint
|
||
msgid "Go to home directory"
|
||
msgstr "Отиване в домашната папка"
|
||
|
||
#: tfrmmain.btnleftroot.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnleftroot.hint
|
||
msgid "Go to root directory"
|
||
msgstr "Отиване в основната папка"
|
||
|
||
#: tfrmmain.btnleftup.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.btnleftup.hint
|
||
msgid "Go to parent directory"
|
||
msgstr "Отива е по-горната папка"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.hint
|
||
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Бързодостъпни папки"
|
||
|
||
#: tfrmmain.btnrightequalleft.caption
|
||
msgctxt "tfrmmain.btnrightequalleft.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmmain.btnrightequalleft.hint
|
||
msgid "Show current directory of the left panel in the right panel"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.btnrighthome.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnrightroot.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnrightup.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.caption
|
||
msgctxt "tfrmmain.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmain.lblcommandpath.caption
|
||
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
|
||
msgid "Path"
|
||
msgstr "Път"
|
||
|
||
#: tfrmmain.mi2080.caption
|
||
msgid "&20/80"
|
||
msgstr "&20/80"
|
||
|
||
#: tfrmmain.mi3070.caption
|
||
msgid "&30/70"
|
||
msgstr "&30/70"
|
||
|
||
#: tfrmmain.mi4060.caption
|
||
msgid "&40/60"
|
||
msgstr "&40/60"
|
||
|
||
#: tfrmmain.mi5050.caption
|
||
msgid "&50/50"
|
||
msgstr "&50/50"
|
||
|
||
#: tfrmmain.mi6040.caption
|
||
msgid "&60/40"
|
||
msgstr "&60/40"
|
||
|
||
#: tfrmmain.mi7030.caption
|
||
msgid "&70/30"
|
||
msgstr "&70/30"
|
||
|
||
#: tfrmmain.mi8020.caption
|
||
msgid "&80/20"
|
||
msgstr "&80/20"
|
||
|
||
#: tfrmmain.micancel.caption
|
||
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Отказ"
|
||
|
||
#: tfrmmain.micopy.caption
|
||
msgid "Copy..."
|
||
msgstr "Презапис..."
|
||
|
||
#: tfrmmain.mihardlink.caption
|
||
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
|
||
msgid "Create link..."
|
||
msgstr "Създаване на връзка..."
|
||
|
||
#: tfrmmain.milogclear.caption
|
||
msgid "Clear"
|
||
msgstr "Изчистване"
|
||
|
||
#: tfrmmain.milogcopy.caption
|
||
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmmain.miloghide.caption
|
||
msgid "Hide"
|
||
msgstr "Скриване"
|
||
|
||
#: tfrmmain.milogselectall.caption
|
||
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Избор на всички"
|
||
|
||
#: tfrmmain.mimove.caption
|
||
msgid "Move..."
|
||
msgstr "Преместване..."
|
||
|
||
#: tfrmmain.misymlink.caption
|
||
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
|
||
msgid "Create symlink..."
|
||
msgstr "Създаване на мека взръзка..."
|
||
|
||
#: tfrmmain.mitaboptions.caption
|
||
msgid "Tab options"
|
||
msgstr "Възможности за подпрозорците"
|
||
|
||
#: tfrmmain.mitrayiconexit.caption
|
||
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Из&ход"
|
||
|
||
#: tfrmmain.mitrayiconrestore.caption
|
||
msgid "Restore"
|
||
msgstr "Показване"
|
||
|
||
#: tfrmmain.mnualloperpause.caption
|
||
msgctxt "tfrmmain.mnualloperpause.caption"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmmain.mnualloperstart.caption
|
||
msgctxt "tfrmmain.mnualloperstart.caption"
|
||
msgid "Start"
|
||
msgstr "Начало"
|
||
|
||
#: tfrmmain.mnualloperstop.caption
|
||
msgctxt "tfrmmain.mnualloperstop.caption"
|
||
msgid "Cancel"
|
||
msgstr "Отказ"
|
||
|
||
#: tfrmmain.mnucmd.caption
|
||
msgid "&Commands"
|
||
msgstr "&Заповеди"
|
||
|
||
#: tfrmmain.mnuconfig.caption
|
||
msgid "C&onfiguration"
|
||
msgstr "&Настройка"
|
||
|
||
#: tfrmmain.mnufavoritetabs.caption
|
||
msgid "Favorites"
|
||
msgstr "Предпочитани"
|
||
|
||
#: tfrmmain.mnufiles.caption
|
||
msgid "&Files"
|
||
msgstr "&Файлове"
|
||
|
||
#: tfrmmain.mnuhelp.caption
|
||
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Помо&щ"
|
||
|
||
#: tfrmmain.mnumark.caption
|
||
msgid "&Mark"
|
||
msgstr "&Избор"
|
||
|
||
#: tfrmmain.mnunetwork.caption
|
||
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
|
||
msgid "Network"
|
||
msgstr "Мрежа"
|
||
|
||
#: tfrmmain.mnushow.caption
|
||
msgid "&Show"
|
||
msgstr "&Изглед"
|
||
|
||
#: tfrmmain.mnutaboptions.caption
|
||
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
|
||
msgid "Tab &Options"
|
||
msgstr "Въз&можности на подпрозорците"
|
||
|
||
#: tfrmmain.mnutabs.caption
|
||
msgid "&Tabs"
|
||
msgstr "&Подпрозорци"
|
||
|
||
#: tfrmmain.tbchangedir.caption
|
||
msgid "CD"
|
||
msgstr ""
|
||
|
||
#: tfrmmain.tbcopy.caption
|
||
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmmain.tbcut.caption
|
||
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Изрязване"
|
||
|
||
#: tfrmmain.tbdelete.caption
|
||
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Изтриване"
|
||
|
||
#: tfrmmain.tbedit.caption
|
||
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Обработка"
|
||
|
||
#: tfrmmain.tbpaste.caption
|
||
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Поставяне"
|
||
|
||
#: tfrmmaincommandsdlg.btncancel.caption
|
||
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmmaincommandsdlg.btnok.caption
|
||
msgctxt "tfrmmaincommandsdlg.btnok.caption"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmmaincommandsdlg.caption
|
||
msgctxt "tfrmmaincommandsdlg.caption"
|
||
msgid "Select your internal command"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
||
msgid "Select all categories by default"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.gbselection.caption
|
||
msgid "Selection:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblcategory.caption
|
||
msgid "&Categories:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblcommandname.caption
|
||
msgid "Command &name:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
||
msgid "&Filter:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblhint.caption
|
||
msgid "Hint:"
|
||
msgstr "Подсказка\""
|
||
|
||
#: tfrmmaincommandsdlg.lblhotkey.caption
|
||
msgid "Hotkey:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
||
msgid "cm_name"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
||
msgid "Category"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
||
msgid "Help"
|
||
msgstr "Помощ"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
||
msgid "Hint"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
||
msgid "Hotkey"
|
||
msgstr "Клавишно съчетание"
|
||
|
||
#: tfrmmaskinputdlg.btnaddattribute.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmmaskinputdlg.btnattrshelp.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Помо&щ"
|
||
|
||
#: tfrmmaskinputdlg.btncancel.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
||
msgid "&Define..."
|
||
msgstr "За&даване..."
|
||
|
||
#: tfrmmaskinputdlg.btnok.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
||
msgid "Case sensitive"
|
||
msgstr "Отчитане на глАВноСТта"
|
||
|
||
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
||
msgid "Ignore accents and ligatures"
|
||
msgstr ""
|
||
|
||
#: tfrmmaskinputdlg.lblattributes.caption
|
||
msgid "Attri&butes:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaskinputdlg.lblprompt.caption
|
||
msgid "Input Mask:"
|
||
msgstr ""
|
||
|
||
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
||
msgid "O&r select predefined selection type:"
|
||
msgstr ""
|
||
|
||
#: tfrmmkdir.btncancel.caption
|
||
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmmkdir.btnok.caption
|
||
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmmkdir.caption
|
||
msgid "Create new directory"
|
||
msgstr "Създаване на нова папка"
|
||
|
||
#: tfrmmkdir.lblmakedir.caption
|
||
msgid "&Input new directory name:"
|
||
msgstr "Напишете &име за новата папка:"
|
||
|
||
#: tfrmmodview.btnpath1.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath2.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath3.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath4.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath5.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.caption
|
||
msgctxt "TFRMMODVIEW.CAPTION"
|
||
msgid "New Size"
|
||
msgstr "Нова размер"
|
||
|
||
#: tfrmmodview.lblheight.caption
|
||
msgid "Height :"
|
||
msgstr "Височина:"
|
||
|
||
#: tfrmmodview.lblpath1.caption
|
||
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmodview.lblpath2.caption
|
||
msgctxt "tfrmmodview.lblpath2.caption"
|
||
msgid "2"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.lblpath3.caption
|
||
msgctxt "tfrmmodview.lblpath3.caption"
|
||
msgid "3"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.lblpath4.caption
|
||
msgid "4"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.lblpath5.caption
|
||
msgid "5"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.lblquality.caption
|
||
msgid "Quality of compress to Jpg"
|
||
msgstr "Качество на уплътняване в jpg"
|
||
|
||
#: tfrmmodview.lblwidth.caption
|
||
msgid "Width :"
|
||
msgstr "Ширина:"
|
||
|
||
#: tfrmmodview.rbbmp.caption
|
||
msgid "BMP"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.rbico.caption
|
||
msgid "ICO"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.rbjpg.caption
|
||
msgid "JPG"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.rbpng.caption
|
||
msgid "PNG"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.rbpnm.caption
|
||
msgid "PNM"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.teheight.text
|
||
msgctxt "tfrmmodview.teheight.text"
|
||
msgid "Height"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.tequality.text
|
||
msgid "80"
|
||
msgstr ""
|
||
|
||
#: tfrmmodview.tewidth.text
|
||
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
|
||
msgid "Width"
|
||
msgstr "Ширина"
|
||
|
||
#: tfrmmsg.lblmsg.caption
|
||
msgid "456456465465465"
|
||
msgstr ""
|
||
|
||
#: tfrmmultirename.btnclose.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Затваряне"
|
||
|
||
#: tfrmmultirename.btndeletepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmmultirename.btnedit.caption
|
||
msgctxt "tfrmmultirename.btnedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Об&работка"
|
||
|
||
#: tfrmmultirename.btnextmenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnloadpreset.caption
|
||
msgid "&Load"
|
||
msgstr "За&реждане"
|
||
|
||
#: tfrmmultirename.btnnamemenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnrename.caption
|
||
msgctxt "tfrmmultirename.btnrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "Пре&именуване"
|
||
|
||
#: tfrmmultirename.btnrestore.caption
|
||
msgid "Reset &all"
|
||
msgstr "Очистване на вси&чки"
|
||
|
||
#: tfrmmultirename.btnsavepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Съхраняване"
|
||
|
||
#: tfrmmultirename.caption
|
||
msgctxt "tfrmmultirename.caption"
|
||
msgid "MultiRename"
|
||
msgstr "Множествено преименуване"
|
||
|
||
#: tfrmmultirename.cblog.caption
|
||
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
|
||
msgid "Ena&ble"
|
||
msgstr "&Разрешаване"
|
||
|
||
#: tfrmmultirename.cbregexp.caption
|
||
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
|
||
msgid "Regular e&xpressions"
|
||
msgstr "&Обичайни изрази"
|
||
|
||
#: tfrmmultirename.cbusesubs.caption
|
||
msgid "&Use substitution"
|
||
msgstr "Използване на &заместване"
|
||
|
||
#: tfrmmultirename.cmbxwidth.text
|
||
msgid "01"
|
||
msgstr "01"
|
||
|
||
#: tfrmmultirename.edinterval.text
|
||
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.edpoc.text
|
||
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.extension.caption
|
||
msgid "[E] Extension"
|
||
msgstr "[E] Разширение"
|
||
|
||
#: tfrmmultirename.gbcounter.caption
|
||
msgid "Counter"
|
||
msgstr "Брояч"
|
||
|
||
#: tfrmmultirename.gbfindreplace.caption
|
||
msgid "Find && Replace"
|
||
msgstr "Търсене &и замяна"
|
||
|
||
#: tfrmmultirename.gblog.caption
|
||
msgid "Log Result"
|
||
msgstr "Име на дневника"
|
||
|
||
#: tfrmmultirename.gbmaska.caption
|
||
msgid "Mask"
|
||
msgstr "Имена"
|
||
|
||
#: tfrmmultirename.gbpresets.caption
|
||
msgid "Presets"
|
||
msgstr "Предустановки"
|
||
|
||
#: tfrmmultirename.lbext.caption
|
||
msgid "&Extension"
|
||
msgstr "Раз&ширение"
|
||
|
||
#: tfrmmultirename.lbfind.caption
|
||
msgid "&Find..."
|
||
msgstr "&Търсене..."
|
||
|
||
#: tfrmmultirename.lbinterval.caption
|
||
msgid "&Interval"
|
||
msgstr "Про&междутък"
|
||
|
||
#: tfrmmultirename.lbname.caption
|
||
msgid "File &Name"
|
||
msgstr "Файлово &име"
|
||
|
||
#: tfrmmultirename.lbreplace.caption
|
||
msgid "Re&place..."
|
||
msgstr "За&мяна..."
|
||
|
||
#: tfrmmultirename.lbstnb.caption
|
||
msgid "S&tart Number"
|
||
msgstr "&Начална стойност"
|
||
|
||
#: tfrmmultirename.lbwidth.caption
|
||
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
|
||
msgid "&Width"
|
||
msgstr "&Ширина"
|
||
|
||
#: tfrmmultirename.micounter.caption
|
||
msgid "[C] Counter"
|
||
msgstr "[C] Брояч"
|
||
|
||
#: tfrmmultirename.miday.caption
|
||
msgid "[D] Day"
|
||
msgstr "[D] Ден"
|
||
|
||
#: tfrmmultirename.miday1.caption
|
||
msgid "[DD] Day (2 digits)"
|
||
msgstr "[DD] Ден (2 цифри)"
|
||
|
||
#: tfrmmultirename.miday2.caption
|
||
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
||
msgstr ""
|
||
|
||
#: tfrmmultirename.miday3.caption
|
||
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
||
msgstr ""
|
||
|
||
#: tfrmmultirename.miextensionx.caption
|
||
msgid "[Ex] Character at position x"
|
||
msgstr "[Ex] Знак na положение x"
|
||
|
||
#: tfrmmultirename.miextensionxx.caption
|
||
msgid "[Ex:y] Characters from position x to y"
|
||
msgstr "[Ex:y] Знак от положение x на y"
|
||
|
||
#: tfrmmultirename.mihour.caption
|
||
msgid "[h] Hour"
|
||
msgstr "[h] Час"
|
||
|
||
#: tfrmmultirename.mihour1.caption
|
||
msgid "[hh] Hour (2 digits)"
|
||
msgstr "[hh] Час (2 цифри)"
|
||
|
||
#: tfrmmultirename.miminute.caption
|
||
msgid "[n] Minute"
|
||
msgstr "[n] Минута"
|
||
|
||
#: tfrmmultirename.miminute1.caption
|
||
msgid "[nn] Minute (2 digits)"
|
||
msgstr "[nn] Минута (2 цифри)"
|
||
|
||
#: tfrmmultirename.mimonth.caption
|
||
msgid "[M] Month"
|
||
msgstr "[M] Месец"
|
||
|
||
#: tfrmmultirename.mimonth1.caption
|
||
msgid "[MM] Month (2 digits)"
|
||
msgstr "[MM] Месец (2 цифри)"
|
||
|
||
#: tfrmmultirename.mimonth2.caption
|
||
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
||
msgstr "[MMM] Име на месеца (кратко, например „ян‟)"
|
||
|
||
#: tfrmmultirename.mimonth3.caption
|
||
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
||
msgstr "[MMM] Име на месеца (кратко, например „януари‟)"
|
||
|
||
#: tfrmmultirename.miname.caption
|
||
msgid "[N] Name"
|
||
msgstr "[N] Име"
|
||
|
||
#: tfrmmultirename.minamex.caption
|
||
msgid "[Nx] Character at position x"
|
||
msgstr "[Nx] Знак на положение x"
|
||
|
||
#: tfrmmultirename.minamexx.caption
|
||
msgid "[Nx:y] Characters from position x to y"
|
||
msgstr "[Nx:y] Знаци от положение x до положение y"
|
||
|
||
#: tfrmmultirename.minext.caption
|
||
msgid "Time..."
|
||
msgstr "Време..."
|
||
|
||
#: tfrmmultirename.minextextension.caption
|
||
msgid "Extension..."
|
||
msgstr "Разширение..."
|
||
|
||
#: tfrmmultirename.minextname.caption
|
||
msgid "Name..."
|
||
msgstr "Име..."
|
||
|
||
#: tfrmmultirename.miplugin.caption
|
||
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "Приставка"
|
||
|
||
#: tfrmmultirename.misecond.caption
|
||
msgid "[s] Second"
|
||
msgstr "[s] Секунда"
|
||
|
||
#: tfrmmultirename.misecond1.caption
|
||
msgid "[ss] Second (2 digits)"
|
||
msgstr "[ss] Секунда (2 цифри)"
|
||
|
||
#: tfrmmultirename.miyear.caption
|
||
#, fuzzy
|
||
#| msgid "[Y] Year"
|
||
msgid "[Y] Year (2 digits)"
|
||
msgstr "[Y] Година"
|
||
|
||
#: tfrmmultirename.miyear1.caption
|
||
msgid "[YYYY] Year (4 digits)"
|
||
msgstr "[YYYY] Година (4 цифри)"
|
||
|
||
#: tfrmmultirename.mnueditnames.caption
|
||
msgid "Edit names..."
|
||
msgstr "Промяна на имената"
|
||
|
||
#: tfrmmultirename.mnuloadfromfile.caption
|
||
msgid "Load names from file..."
|
||
msgstr "Зареждане на имената от файл..."
|
||
|
||
#: tfrmmultirename.n1.caption
|
||
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n2.caption
|
||
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n3.caption
|
||
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n4.caption
|
||
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n5.caption
|
||
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
|
||
msgid "Old File Name"
|
||
msgstr "Сегашно име"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
|
||
msgid "New File Name"
|
||
msgstr "Бъдещо име"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
|
||
msgid "File Path"
|
||
msgstr "Път"
|
||
|
||
#: tfrmmultirenamewait.caption
|
||
msgctxt "tfrmmultirenamewait.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmultirenamewait.lblmessage.caption
|
||
msgid "Click OK when you have closed the editor to load the changed names!"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.caption
|
||
msgid "Choose an application"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.chkcustomcommand.caption
|
||
msgid "Custom command"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.chksaveassociation.caption
|
||
msgid "Save association"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.chkuseasdefault.caption
|
||
msgid "Set selected application as default action"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.lblmimetype.caption
|
||
msgid "File type to be opened: %s"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.milistoffiles.caption
|
||
msgid "Multiple file names"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.milistoffiles.hint
|
||
msgid "%F"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.milistofurls.caption
|
||
msgid "Multiple URIs"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.milistofurls.hint
|
||
msgid "%U"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.misinglefilename.caption
|
||
msgid "Single file name"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.misinglefilename.hint
|
||
msgid "%f"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.misingleurl.caption
|
||
msgid "Single URI"
|
||
msgstr ""
|
||
|
||
#: tfrmopenwith.misingleurl.hint
|
||
msgid "%u"
|
||
msgstr ""
|
||
|
||
#: tfrmoptions.btnapply.caption
|
||
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
|
||
msgid "&Apply"
|
||
msgstr "&Прилагане"
|
||
|
||
#: tfrmoptions.btncancel.caption
|
||
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmoptions.btnok.caption
|
||
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmoptions.caption
|
||
msgctxt "tfrmoptions.caption"
|
||
msgid "Options"
|
||
msgstr "Възможности"
|
||
|
||
#: tfrmoptions.lblemptyeditor.caption
|
||
msgid "Please select one of the subpages, this page does not contain any settings."
|
||
msgstr "Изберете някоя от подстраниците, тази не съдържа настройки."
|
||
|
||
#: tfrmoptionsarchivers.btnarchiveradd.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverapply.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
|
||
msgid "A&pply"
|
||
msgstr "&Прилагане"
|
||
|
||
#: tfrmoptionsarchivers.btnarchivercopy.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchivercopy.caption"
|
||
msgid "Cop&y"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverdelete.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverother.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverother.caption"
|
||
msgid "Oth&er..."
|
||
msgstr "Друго:..."
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverrename.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "Пре&махване"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.bvlarchiverids.caption
|
||
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
|
||
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
|
||
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
|
||
msgid "Options:"
|
||
msgstr "Възможности:"
|
||
|
||
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
|
||
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
|
||
msgid "Format parsing mode:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.chkarchiverenabled.caption
|
||
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
|
||
msgid "E&nabled"
|
||
msgstr "&Включен"
|
||
|
||
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
|
||
msgid "De&bug mode"
|
||
msgstr "Режим за про&следяване на недъзи"
|
||
|
||
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
|
||
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
|
||
msgid "S&how console output"
|
||
msgstr "Показване на изхода към &конзолата"
|
||
|
||
#: tfrmoptionsarchivers.chkfilenameonlylist.caption
|
||
msgid "Use archive name without extension as list"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
|
||
msgid "Uni&x file attributes"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
|
||
msgid "&Unix path delimiter \"/\""
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
|
||
msgid "Windows &file attributes"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
|
||
msgid "Windows path deli&miter \"\\\""
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveradd.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
|
||
msgid "Add&ing:"
|
||
msgstr "&Добавяне:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
|
||
msgid "Arc&hiver:"
|
||
msgstr "&Архиватор:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverdelete.caption
|
||
msgid "De&lete:"
|
||
msgstr "Изтриване:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverdescription.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
|
||
msgid "De&scription:"
|
||
msgstr "О&писание:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverextension.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
|
||
msgid "E&xtension:"
|
||
msgstr "Раз&ширение:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverextract.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
|
||
msgid "Ex&tract:"
|
||
msgstr "Из&вличане:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
|
||
msgid "Extract &without path:"
|
||
msgstr "Извличане без път:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveridposition.caption
|
||
msgid "ID Po&sition:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverids.caption
|
||
msgid "&ID:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
|
||
msgid "ID See&k Range:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverlist.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
|
||
msgid "&List:"
|
||
msgstr "&Списък:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
|
||
msgid "Archi&vers:"
|
||
msgstr "Архиватори:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverlistend.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
|
||
msgid "Listing &finish (optional):"
|
||
msgstr "&Край на списъка (избираемо):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
|
||
msgid "Listing for&mat:"
|
||
msgstr "Из&писване на списъка:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverliststart.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
|
||
msgid "Listin&g start (optional):"
|
||
msgstr "&Начало на списъка (избираемо):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
|
||
msgid "Password &query string:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
|
||
msgid "Create self extractin&g archive:"
|
||
msgstr "Създаване на саморазгъващ се архив:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivertest.caption
|
||
msgid "Tes&t:"
|
||
msgstr "Проверка:"
|
||
|
||
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
|
||
msgid "Auto Configure"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.miarchiverdisableall.caption
|
||
msgid "Disable all"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
|
||
msgid "Discard modifications"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.miarchiverenableall.caption
|
||
msgid "Enable all"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.miarchiverexport.caption
|
||
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Изнасяне..."
|
||
|
||
#: tfrmoptionsarchivers.miarchiverimport.caption
|
||
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Внасяне..."
|
||
|
||
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
|
||
msgid "Sort archivers"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
|
||
msgid "Additional"
|
||
msgstr "Допълнителни"
|
||
|
||
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
|
||
msgid "General"
|
||
msgstr "Общи"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
|
||
msgid "When &size, date or attributes change"
|
||
msgstr "При промяна на раз&мера, датата и принадлежностите"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "За следните &пътища и подпапките им:"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
|
||
msgid "When &files are created, deleted or renamed"
|
||
msgstr "При съз&даване, изтриване или преименуване на файлове"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
|
||
msgid "When application is in the &background"
|
||
msgstr "Когато приложението е на &заден план"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
|
||
msgid "Disable auto-refresh"
|
||
msgstr "Без самоопресняване"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
|
||
msgid "Refresh file list"
|
||
msgstr "Опресняване на файловия списък"
|
||
|
||
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
|
||
msgid "Al&ways show tray icon"
|
||
msgstr "Винаги да се показва значе в &уведомителката"
|
||
|
||
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
||
msgid "Automatically &hide unmounted devices"
|
||
msgstr "Автоматично с&криване на разкачените устройства"
|
||
|
||
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
|
||
msgid "Mo&ve icon to system tray when minimized"
|
||
msgstr "Смаляване в уведомителката"
|
||
|
||
#: tfrmoptionsbehavior.cbonlyonce.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
|
||
msgid "A&llow only one copy of DC at a time"
|
||
msgstr "Позволено е само &едно пускане на DC наведнъж"
|
||
|
||
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
||
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
||
msgid "Drives &blacklist"
|
||
msgstr "&Черен списък на устройствата"
|
||
|
||
#: tfrmoptionsbriefview.gbcolumns.caption
|
||
msgid "Columns size"
|
||
msgstr "Ширина на стълбовете"
|
||
|
||
#: tfrmoptionsbriefview.gbshowfileext.caption
|
||
msgid "Show file extensions"
|
||
msgstr "Показване на файловите разширения"
|
||
|
||
#: tfrmoptionsbriefview.rbaligned.caption
|
||
msgid "ali&gned (with Tab)"
|
||
msgstr "под&равнени (с ТАБ)"
|
||
|
||
#: tfrmoptionsbriefview.rbdirectly.caption
|
||
msgid "di&rectly after filename"
|
||
msgstr "веднага &зад файловото име"
|
||
|
||
#: tfrmoptionsbriefview.rbuseautosize.caption
|
||
msgid "Auto"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
||
msgid "Fixed columns count"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
||
msgid "Fixed columns width"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
||
#, fuzzy
|
||
#| msgid "Cut text to column width"
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBCUTTEXTTOCOLWIDTH.CAPTION"
|
||
msgid "Cut &text to column width"
|
||
msgstr "Подрязване на &текста до ширината на стълба"
|
||
|
||
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
|
||
msgid "&Extend cell width if text is not fitting into column"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
||
#, fuzzy
|
||
#| msgid "Horizontal lines"
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDHORZLINE.CAPTION"
|
||
msgid "&Horizontal lines"
|
||
msgstr "Водоравни черти"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
||
#, fuzzy
|
||
#| msgid "Vertical lines"
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDVERTLINE.CAPTION"
|
||
msgid "&Vertical lines"
|
||
msgstr "Отвесни черти"
|
||
|
||
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
||
#, fuzzy
|
||
#| msgid "Auto fill columns"
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CHKAUTOFILLCOLUMNS.CAPTION"
|
||
msgid "A&uto fill columns"
|
||
msgstr "Самопопълване на стълбовете"
|
||
|
||
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
||
msgid "Show grid"
|
||
msgstr "Показване на решетка"
|
||
|
||
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
||
msgid "Auto-size columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.LBLAUTOSIZECOLUMN.CAPTION"
|
||
msgid "Auto si&ze column:"
|
||
msgstr "Самооразмеряване на стълба:"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Прилагане"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Об&работка"
|
||
|
||
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
||
#, fuzzy
|
||
#| msgid "Command line history"
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBCMDLINEHISTORY.CAPTION"
|
||
msgid "Co&mmand line history"
|
||
msgstr "Дневник на реда управление"
|
||
|
||
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
||
#, fuzzy
|
||
#| msgid "Directory history"
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
|
||
msgid "&Directory history"
|
||
msgstr "Дневник на папката"
|
||
|
||
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
||
#, fuzzy
|
||
#| msgid "File mask history"
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBFILEMASKHISTORY.CAPTION"
|
||
msgid "&File mask history"
|
||
msgstr "Дневник на търсените файловете"
|
||
|
||
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
||
#, fuzzy
|
||
#| msgid "Save configuration"
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSAVECONFIGURATION.CAPTION"
|
||
msgid "Sa&ve configuration"
|
||
msgstr "Запис на настройките"
|
||
|
||
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
||
#, fuzzy
|
||
#| msgid "Search/Replace history"
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSEARCHREPLACEHISTORY.CAPTION"
|
||
msgid "Searc&h/Replace history"
|
||
msgstr "Дневник на търсенията/ замените"
|
||
|
||
#: tfrmoptionsconfiguration.gbdirectories.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Папки"
|
||
|
||
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.GBLOCCONFIGFILES.CAPTION"
|
||
msgid "Location of configuration files"
|
||
msgstr "Положение на настроечните файлове"
|
||
|
||
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.GBSAVEONEXIT.CAPTION"
|
||
msgid "Save on exit"
|
||
msgstr "Запис при изход"
|
||
|
||
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
||
msgid "Sort order of configuration order in left tree"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.gpconfigurationtreestate.caption
|
||
msgid "Tree state when entering in configuration page"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.LBLCMDLINECONFIGDIR.CAPTION"
|
||
msgid "Set on command line"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.lblhighlighters.caption
|
||
msgid "Highlighters:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.lbliconthemes.caption
|
||
msgid "Icon themes:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.lblthumbcache.caption
|
||
msgid "Thumbnails cache:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
||
#, fuzzy
|
||
#| msgid "Program directory (portable version)"
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.RBPROGRAMDIR.CAPTION"
|
||
msgid "P&rogram directory (portable version)"
|
||
msgstr "Папката на приложението (преносима версия)"
|
||
|
||
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
||
#, fuzzy
|
||
#| msgid "User home directory"
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.RBUSERHOMEDIR.CAPTION"
|
||
msgid "&User home directory"
|
||
msgstr "Домашна папка на потребителя"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
|
||
msgid "&Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmoptionscustomcolumns.btnfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
||
msgid "Go to set default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
|
||
msgid "New"
|
||
msgstr "Нов"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnext.caption
|
||
msgid "Next"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnprev.caption
|
||
msgid "Previous"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
|
||
msgid "Rename"
|
||
msgstr "Преименуване"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
|
||
msgid "Reset to default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
|
||
msgid "Save as"
|
||
msgstr "Съхраняване като"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
|
||
msgid "Save"
|
||
msgstr "Съхраняване"
|
||
|
||
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Позволяване на надцветка"
|
||
|
||
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
||
msgid "When clicking to change something, change for all columns"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
||
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
|
||
msgid "General"
|
||
msgstr "Общи"
|
||
|
||
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Обрамчване на показалеца"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
||
msgid "Use Frame Cursor"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Selection Color"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
||
msgid "Use Inverted Selection"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
||
msgid "Use custom font and color for this view"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
|
||
msgid "BackGround:"
|
||
msgstr "Подцветка:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
|
||
msgid "Background 2:"
|
||
msgstr "Подцветка 2:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
||
#, fuzzy
|
||
#| msgid "Con&figure columns for file system:"
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCONFIGCOLUMNS.CAPTION"
|
||
msgid "Con&figure columns view:"
|
||
msgstr "Настройка на стълбовете за файлова уредба:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
||
msgid "[Current Column Name]"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
|
||
msgid "Cursor Color:"
|
||
msgstr "Цвят на показалеца:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
|
||
msgid "Cursor Text:"
|
||
msgstr "Текст на показалеца:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontname.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
|
||
msgid "Font:"
|
||
msgstr "Шрифт:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
|
||
msgid "Size:"
|
||
msgstr "Размер:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
|
||
msgid "Text Color:"
|
||
msgstr "Цвят на текста:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
|
||
msgid "Mark Color:"
|
||
msgstr "Цвят на отбелязване:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
||
msgid "Settings for column:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
||
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
|
||
msgid "Add column"
|
||
msgstr "Добавяне на стълб"
|
||
|
||
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
||
msgid "Position of frame panel after the comparison:"
|
||
msgstr "Положение на крилото след сравнението"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
|
||
msgid "Add directory of the &active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
|
||
msgid "Add &directories of the active && inactive frames"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
|
||
msgid "Add directory I will bro&wse to"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
|
||
msgid "Add a copy of the selected entry"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
|
||
msgid "Add current &selected or active directories of active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
|
||
msgid "Add a separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
|
||
msgid "Add a sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
|
||
msgid "Add directory I will type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
|
||
msgid "Collapse item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcut.caption
|
||
msgid "Cut selection of entries"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
|
||
msgid "Delete all!"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Изтриване на избрания предмет"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
|
||
msgid "Delete sub-menu and all its elements"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
|
||
msgid "Delete just sub-menu but keep elements"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
|
||
msgid "Expand item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
|
||
msgid "Focus tree window"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
|
||
msgid "Goto first item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
|
||
msgid "Goto last item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
|
||
msgid "Go to next item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
|
||
msgid "Go to previous item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
|
||
msgid "Insert directory of the &active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
|
||
msgid "Insert &directories of the active && inactive frames"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
|
||
msgid "Insert directory I will bro&wse to"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
|
||
msgid "Insert a copy of the selected entry"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
|
||
msgid "Insert current &selected or active directories of active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
|
||
msgid "Insert a separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
|
||
msgid "Insert sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
|
||
msgid "Insert directory I will type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
|
||
msgid "Move to next"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
|
||
msgid "Move to previous"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actpaste.caption
|
||
msgid "Paste what was cut"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
|
||
msgid "Search && replace in &path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
|
||
msgid "Search && replace in both path and target"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
|
||
msgid "Search && replace in &target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
|
||
msgid "Tweak path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
|
||
msgid "Tweak target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
||
#, fuzzy
|
||
#| msgid "Add..."
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
||
msgid "A&dd..."
|
||
msgstr "Добавяне..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
||
#, fuzzy
|
||
#| msgid "Backup..."
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
||
msgid "Bac&kup..."
|
||
msgstr "Запасяване..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
||
#, fuzzy
|
||
#| msgid "Delete..."
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
||
msgid "De&lete..."
|
||
msgstr "Изтриване..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
||
#, fuzzy
|
||
#| msgid "Export..."
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
||
msgid "E&xport..."
|
||
msgstr "Изнасяне..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
||
#, fuzzy
|
||
#| msgid "Help"
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Помощ"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
||
#, fuzzy
|
||
#| msgid "Import..."
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
||
msgid "Impo&rt..."
|
||
msgstr "Внасяне..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
||
#, fuzzy
|
||
#| msgid "Insert..."
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
||
msgid "&Insert..."
|
||
msgstr "Вмъкване..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
||
#, fuzzy
|
||
#| msgid "Miscellaneous..."
|
||
msgid "&Miscellaneous..."
|
||
msgstr "Разни..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
|
||
msgid "Some functions to select appropriate target"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
||
#, fuzzy
|
||
#| msgid "Sort..."
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
||
msgid "&Sort..."
|
||
msgstr "Подреждане..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
||
#, fuzzy
|
||
#| msgid "When adding directory, add also target"
|
||
msgid "&When adding directory, add also target"
|
||
msgstr "При добавяне на папка, да се добавя и цел"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
||
#, fuzzy
|
||
#| msgid "Always expand tree"
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
||
msgid "Alwa&ys expand tree"
|
||
msgstr "Дървото да се разгъва винаги"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
||
#, fuzzy
|
||
#| msgid "Show only valid environment variables"
|
||
msgid "Show only &valid environment variables"
|
||
msgstr "Показване само на важащи променливи на средата"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
||
#, fuzzy
|
||
#| msgid "In popup, show [path also]"
|
||
msgid "In pop&up, show [path also]"
|
||
msgstr "В изкачащия прозорец да се показва [и пътят]"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Име, а-я"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Име, я-а"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
||
msgid "Directory Hotlist (reorder by drag && drop)"
|
||
msgstr "Любими папки (пренареждат се чрез завлачване)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Други възможности"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
|
||
msgid "Name:"
|
||
msgstr "Име"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
|
||
msgid "Path:"
|
||
msgstr "Път:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
||
#, fuzzy
|
||
#| msgid "Target:"
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
|
||
msgid "&Target:"
|
||
msgstr "Цел"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
||
msgid "...current le&vel of item(s) selected only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
|
||
msgid "Scan all &hotdir's path to validate the ones that actually exist"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
|
||
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
||
msgid "to a Directory &Hotlist file (.hotlist)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
||
msgid "Go to &configure TC related info"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
|
||
msgid "Go to &configure TC related info"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
||
msgid "HotDirTestMenu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
||
msgid "from a Directory &Hotlist file (.hotlist)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
||
msgid "from \"&wincmd.ini\" of TC"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.minavigate.caption
|
||
msgid "&Navigate..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
||
msgid "&Restore a backup of Directory Hotlist"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
||
msgid "&Save a backup of current Directory Hotlist"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
||
msgid "Search and &replace..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
||
msgid "...everything, from A to &Z!"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
||
msgid "...single &group of item(s) only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
||
msgid "...&content of submenu(s) selected, no sublevel"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and &all sublevels"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
|
||
msgid "Test resultin&g menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
|
||
msgid "Tweak &path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
|
||
msgid "Tweak &target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
||
msgid "Addition from main panel"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
||
msgid "From all the supported formats, ask which one to use every time"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
||
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
||
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
||
msgid "&Show confirmation dialog after drop"
|
||
msgstr "&Питащ прозорец при пускане"
|
||
|
||
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
||
msgid "When drag && dropping text into panels:"
|
||
msgstr "При завличане в &крилата:"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
||
msgid "Place the most desired format on top of list (use dag && drop):"
|
||
msgstr "Поставяне на предпочитания формат на върха на списъка"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
||
msgid "(if the most desired is not present, we'll take second one and so on)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
||
msgid "(will not work with some source application, so try to uncheck if problem)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
||
msgid "Show &file system"
|
||
msgstr "Показване на &файловата уредба"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
||
msgid "Show fr&ee space"
|
||
msgstr "Показване на &свободното място"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
||
msgid "Show &label"
|
||
msgstr "Показване на &етикет"
|
||
|
||
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
||
msgid "Drives list"
|
||
msgstr "Списък на устройствата"
|
||
|
||
#: tfrmoptionseditor.chkautoindent.caption
|
||
msgid "Auto Indent"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chkautoindent.hint
|
||
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.caption
|
||
msgid "Caret past end of line"
|
||
msgstr "Поставяне на показалеца след края на реда"
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.hint
|
||
msgid "Allows caret to go into empty space beyond end-of-line position"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.caption
|
||
msgid "Show special characters"
|
||
msgstr "Показване на неизобразимите знаци"
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.hint
|
||
msgid "Shows special characters for spaces and tabulations"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chksmarttabs.caption
|
||
msgid "Smart Tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chksmarttabs.hint
|
||
msgid "When using <Tab> key, caret will go to the next non-space character of the previous line"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chktabindent.caption
|
||
msgid "Tab indents blocks"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chktabindent.hint
|
||
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chktabstospaces.caption
|
||
msgid "Use spaces instead tab characters"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chktabstospaces.hint
|
||
msgid "Converts tab characters to a specified number of space characters (when entering)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chktrimtrailingspaces.caption
|
||
msgid "Delete trailing spaces"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.chktrimtrailingspaces.hint
|
||
msgid "Auto delete trailing spaces, this applies only to edited lines"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.edtabwidth.hint
|
||
msgctxt "tfrmoptionseditor.edtabwidth.hint"
|
||
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.gbinternaleditor.caption
|
||
msgid "Internal editor options"
|
||
msgstr "Възможности на вътрешния обработчик"
|
||
|
||
#: tfrmoptionseditor.lbltabwidth.caption
|
||
msgid "Tab width:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditor.lbltabwidth.hint
|
||
msgctxt "tfrmoptionseditor.lbltabwidth.hint"
|
||
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "&Подцветка"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "&Подцветка"
|
||
|
||
#: tfrmoptionseditorcolors.btnresetmask.hint
|
||
msgid "Reset"
|
||
msgstr "Очистване"
|
||
|
||
#: tfrmoptionseditorcolors.btnsavemask.hint
|
||
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
|
||
msgid "Save"
|
||
msgstr "Съхраняване"
|
||
|
||
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
||
msgid "Element Attributes"
|
||
msgstr "Свосйтва на предметите"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
||
msgid "Fo®round"
|
||
msgstr "Цвят на &шрифта"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
|
||
msgid "Fo®round"
|
||
msgstr "&Подцветка"
|
||
|
||
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
||
msgid "&Text-mark"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
||
msgid "Use (and edit) &global scheme settings"
|
||
msgstr "Използване (и обработка) на &обща разцветка"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
||
msgid "Use &local scheme settings"
|
||
msgstr "Използване на &местна разцветка"
|
||
|
||
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
||
msgid "&Bold"
|
||
msgstr "Полу&чер"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "&Обърнат"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "&Изкл"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Вкл"
|
||
|
||
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
||
msgid "&Italic"
|
||
msgstr "&Курсив"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "&Обърнат"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "&Изкл"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Вкл"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
||
msgid "&Strike Out"
|
||
msgstr "&Зачертан"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "&Обърнат"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "&Изкл"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Вкл"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
||
msgid "&Underline"
|
||
msgstr "Под&чертан"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "&Обърнат"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "&Изкл"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Вкл"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnadd.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
|
||
msgid "Add..."
|
||
msgstr "Добавяне..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btndelete.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
|
||
msgid "Delete..."
|
||
msgstr "Изтриване..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
||
msgid "Import/Export"
|
||
msgstr "Внасяне/ изнасяне"
|
||
|
||
#: tfrmoptionsfavoritetabs.btninsert.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
|
||
msgid "Insert..."
|
||
msgstr "Вмъкване..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnrename.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Преименуване"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnsort.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
|
||
msgid "Sort..."
|
||
msgstr "Подреждане..."
|
||
|
||
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
|
||
msgid "Always expand tree"
|
||
msgstr "Дървото да се разгъва винаги"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Не"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
||
msgid "Right"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
||
msgid "Favorite Tabs list (reorder by drag && drop)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Други възможности"
|
||
|
||
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
||
msgid "What to restore where for the selected entry:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
||
msgid "Existing tabs to keep:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
||
msgid "Save dir history:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
||
msgid "Tabs saved on left to be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
||
msgid "Tabs saved on right to be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
|
||
msgid "a separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
||
msgid "Add separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
|
||
msgid "sub-menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
|
||
msgid "Add sub-menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.micutselection.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
|
||
msgid "Cut"
|
||
msgstr "Изрязване"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
|
||
msgid "delete all!"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
|
||
msgid "selected item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Изтриване на избрания предмет"
|
||
|
||
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
||
msgid "Export selection to legacy .tab file(s)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
||
msgid "FavoriteTabsTestMenu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
||
msgid "Import legacy .tab file(s) according to default setting"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
||
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
||
msgid "Insert separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
||
msgid "Insert sub-menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
|
||
msgid "Paste"
|
||
msgstr "Поставяне"
|
||
|
||
#: tfrmoptionsfavoritetabs.mirename.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
|
||
msgid "Rename"
|
||
msgstr "Преименуване"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btnaddact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
|
||
msgid "Add"
|
||
msgstr "Добавяне"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
|
||
msgid "Add"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
||
#, fuzzy
|
||
#| msgid "Add"
|
||
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
|
||
msgid "A&dd"
|
||
msgstr "Добавяне"
|
||
|
||
#: tfrmoptionsfileassoc.btncloneact.caption
|
||
msgid "C&lone"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btncommands.hint
|
||
msgctxt "tfrmoptionsfileassoc.btncommands.hint"
|
||
msgid "Select your internal command"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btndownact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
|
||
msgid "Do&wn"
|
||
msgstr "Надолу"
|
||
|
||
#: tfrmoptionsfileassoc.btneditext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
|
||
msgid "Edi&t"
|
||
msgstr "Обработка"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
||
msgid "Insert"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btninsertext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
|
||
msgid "&Insert"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btnparametershelper.hint
|
||
msgctxt "tfrmoptionsfileassoc.btnparametershelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btnrelativecommand.hint
|
||
msgctxt "tfrmoptionsfileassoc.btnrelativecommand.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveact.caption
|
||
#, fuzzy
|
||
#| msgid "Remove"
|
||
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
|
||
msgid "Remo&ve"
|
||
msgstr "Премахване"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveext.caption
|
||
#, fuzzy
|
||
#| msgid "Remove"
|
||
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
|
||
msgid "Re&move"
|
||
msgstr "Премахване"
|
||
|
||
#: tfrmoptionsfileassoc.btnremovetype.caption
|
||
#, fuzzy
|
||
#| msgid "Remove"
|
||
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
|
||
msgid "&Remove"
|
||
msgstr "Премахване"
|
||
|
||
#: tfrmoptionsfileassoc.btnrenametype.caption
|
||
#, fuzzy
|
||
#| msgid "Rename"
|
||
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
||
msgid "R&ename"
|
||
msgstr "Премахване"
|
||
|
||
#: tfrmoptionsfileassoc.btnstartpathpathhelper.hint
|
||
msgctxt "tfrmoptionsfileassoc.btnstartpathpathhelper.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btnstartpathvarhelper.hint
|
||
msgctxt "tfrmoptionsfileassoc.btnstartpathvarhelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.btnupact.caption
|
||
#, fuzzy
|
||
#| msgid "Up"
|
||
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
|
||
msgid "&Up"
|
||
msgstr "Нагоре"
|
||
|
||
#: tfrmoptionsfileassoc.destartpath.hint
|
||
msgid "Starting path of the command. Never quote this string."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.edbactionname.hint
|
||
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.edtparams.hint
|
||
msgid "Parameter to pass to the command. Long filename with spaces should be quoted (manually entering)."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.fnecommand.hint
|
||
msgid "Command to execute. Never quote this string."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
||
msgid "Action description"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.gbactions.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
||
msgid "Actions"
|
||
msgstr "Действия"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
|
||
msgid "Extensions"
|
||
msgstr "Разширения"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.hint
|
||
msgid "Can be sorted by drag & drop"
|
||
msgstr "Могат да бъдат подредени със завлачване"
|
||
|
||
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
||
msgid "File types"
|
||
msgstr "Видове файлове"
|
||
|
||
#: tfrmoptionsfileassoc.gbicon.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
|
||
msgid "Icon"
|
||
msgstr "Значе"
|
||
|
||
#: tfrmoptionsfileassoc.lbactions.hint
|
||
msgid "Actions may be sorted by drag & drop"
|
||
msgstr "Действията могат да бъдат подредени със завлачване"
|
||
|
||
#: tfrmoptionsfileassoc.lbexts.hint
|
||
msgid "Extensions may be sorted by drag & drop"
|
||
msgstr "Разширенията могат да бъдат подредени със завлачване"
|
||
|
||
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
||
msgid "File types may be sorted by drag & drop"
|
||
msgstr "Видовете на файловете могат да бъдат подредени със завлачване"
|
||
|
||
#: tfrmoptionsfileassoc.lblaction.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
|
||
msgid "Action &name:"
|
||
msgstr "Име на действието:"
|
||
|
||
#: tfrmoptionsfileassoc.lblcommand.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
|
||
msgid "Command:"
|
||
msgstr "&Заповед:"
|
||
|
||
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Клю&чове:"
|
||
|
||
#: tfrmoptionsfileassoc.lblstartpath.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "&Пусков път:"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem3.caption
|
||
msgid "Custom with..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.micustom.caption
|
||
msgid "Custom"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.miedit.caption
|
||
msgctxt "tfrmoptionsfileassoc.miedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Обработка"
|
||
|
||
#: tfrmoptionsfileassoc.mieditor.caption
|
||
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
|
||
msgid "Open in Editor"
|
||
msgstr "Отваряне в обработчика"
|
||
|
||
#: tfrmoptionsfileassoc.mieditwith.caption
|
||
msgid "Edit with..."
|
||
msgstr "Обработка с..."
|
||
|
||
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
||
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
|
||
msgid "Get output from command"
|
||
msgstr "Получаване на изхода от командата"
|
||
|
||
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
||
msgid "Open in Internal Editor"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
||
msgid "Open in Internal Viewer"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassoc.miopen.caption
|
||
msgctxt "tfrmoptionsfileassoc.miopen.caption"
|
||
msgid "Open"
|
||
msgstr "Отваряне"
|
||
|
||
#: tfrmoptionsfileassoc.miopenwith.caption
|
||
msgid "Open with..."
|
||
msgstr "Отваряне с..."
|
||
|
||
#: tfrmoptionsfileassoc.mishell.caption
|
||
msgctxt "tfrmoptionsfileassoc.mishell.caption"
|
||
msgid "Run in terminal"
|
||
msgstr "Пускане в терминал"
|
||
|
||
#: tfrmoptionsfileassoc.miview.caption
|
||
msgctxt "tfrmoptionsfileassoc.miview.caption"
|
||
msgid "View"
|
||
msgstr "Преглед"
|
||
|
||
#: tfrmoptionsfileassoc.miviewer.caption
|
||
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
|
||
msgid "Open in Viewer"
|
||
msgstr "Отваряне в прегледа"
|
||
|
||
#: tfrmoptionsfileassoc.miviewwith.caption
|
||
msgid "View with..."
|
||
msgstr "Преглеждане с..."
|
||
|
||
#: tfrmoptionsfileassoc.sbtnicon.hint
|
||
msgid "Click me to change icon!"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
||
msgid "Execute via shell"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
||
msgid "Extended context menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
||
msgid "File association configuration"
|
||
msgstr "Настройка на файловите обвързвания"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
||
msgid "Offer to add selection to file association when not included already"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
||
msgid "Execute via terminal and close"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
||
msgid "Extended options items:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
||
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
|
||
msgid "Show confirmation window for:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
||
msgid "Cop&y operation"
|
||
msgstr "Действие „пре&запис‟"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
||
msgid "&Delete operation"
|
||
msgstr "Действие „&изтриване‟"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDELETETOTRASH.CAPTION"
|
||
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
||
msgstr "Изтриване в &кошчето (Shift обръща настройката)"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
||
msgid "D&elete to trash operation"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "D&rop readonly flag"
|
||
msgstr "Изоставяне на стяга „само за &четене“"
|
||
|
||
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
||
msgid "&Move operation"
|
||
msgstr "Действие „пре&местване‟"
|
||
|
||
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBPROCESSCOMMENTS.CAPTION"
|
||
msgid "&Process comments with files/folders"
|
||
msgstr "Об&работка на бележките заедно с файловете/папките"
|
||
|
||
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBRENAMESELONLYNAME.CAPTION"
|
||
msgid "Select &file name without extension when renaming"
|
||
msgstr "Избор само на файловото &име при преименуване (без разширението)"
|
||
|
||
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSHOWCOPYTABSELECTPANEL.CAPTION"
|
||
msgid "Sho&w tab select panel in copy/move dialog"
|
||
msgstr "Показване на &крило за избор на подпрозорци в прозореца за презапис/местене"
|
||
|
||
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSKIPFILEOPERROR.CAPTION"
|
||
msgid "S&kip file operations errors and write them to log window"
|
||
msgstr "Грешките при работа с файлове се &прескачат и се записват дневниковия прозорец"
|
||
|
||
#: tfrmoptionsfileoperations.cbverifychecksumconfirmation.caption
|
||
msgid "Verify checksum operation"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
||
msgid "Executing operations"
|
||
msgstr "Изпълняване на действия"
|
||
|
||
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
||
msgid "User interface"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
||
msgid "&Buffer size for file operations (in KB):"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
||
msgid "Buffer size for &hash calculation (in KB):"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
||
msgid "Show operations progress &initially in"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
||
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
|
||
msgid "Duplicated name auto-rename style:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLWIPEPASSNUMBER.CAPTION"
|
||
msgid "&Number of wipe passes:"
|
||
msgstr "Брой на &повторенията:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
||
msgid "Reset to DC default"
|
||
msgstr "Връщане на подразбираните настройки на DC"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Позволяване на надцветка"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEFRAMECURSOR.CAPTION"
|
||
msgid "Use &Frame Cursor"
|
||
msgstr "Използване на о&граждащ показалец"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
||
msgid "Use &Gradient Indicator"
|
||
msgstr "Използване на &преливащ указател"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Sel Color"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "U&se Inverted Selection"
|
||
msgstr "Използване на &обърнато избиране"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Обрамчване на показалеца"
|
||
|
||
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
|
||
msgid "Drive Free Space Indicator"
|
||
msgstr "Указател за свободното място"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR.CAPTION"
|
||
msgid "Bac&kground:"
|
||
msgstr "Подц&ветка:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
|
||
msgid "Backg&round 2:"
|
||
msgstr "Подцветка &2:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
|
||
msgid "C&ursor Color:"
|
||
msgstr "Цвят на &показалеца:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
|
||
msgid "Cursor Te&xt:"
|
||
msgstr "&Текст на показалеца:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEPANELBRIGHTNESS.CAPTION"
|
||
msgid "&Brightness level of inactive panel"
|
||
msgstr "&Яркост на бездейното крило"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
||
msgid "In&dicator Back Color:"
|
||
msgstr "&Подцветка на указателя"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
||
msgid "&Indicator Fore Color:"
|
||
msgstr "&Основен цвят на указателя"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
|
||
msgid "&Mark Color:"
|
||
msgstr "Цвят на от&белязване:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
||
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
|
||
msgid "T&ext Color:"
|
||
msgstr "Цвят на &текста:"
|
||
|
||
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
||
msgid "When launching file search, clear file mask filter"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesearch.cbpartialnamesearch.caption"
|
||
msgid "&Search for part of file name"
|
||
msgstr "Търсене за &част от файловото име"
|
||
|
||
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
||
msgid "Show menu bar in \"Find files\""
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesearch.dbtextsearch.caption"
|
||
msgid "Text search in files"
|
||
msgstr "Търсене на текст във файловете"
|
||
|
||
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
|
||
msgid "File search"
|
||
msgstr "Файлово търсене"
|
||
|
||
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
||
msgid "Current filters with \"New search\" button:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
||
msgctxt "tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption"
|
||
msgid "Default search template:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesearch.rbusemmapinsearch.caption"
|
||
msgid "Use memory mapping for search te&xt in files"
|
||
msgstr "Разпределено в паметта търсене на &текст във файловете"
|
||
|
||
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesearch.rbusestreaminsearch.caption"
|
||
msgid "&Use stream for search text in files"
|
||
msgstr "&Поточно търсене на текст във файловете"
|
||
|
||
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Помо&щ"
|
||
|
||
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
||
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
||
msgid "Do&n't load file list until a tab is activated"
|
||
msgstr "Файловият списък да не се зарежда до задействане на попрозореца"
|
||
|
||
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBDIRBRACKETS.CAPTION"
|
||
msgid "S&how square brackets around directories"
|
||
msgstr "Показване на средни &скоби около папките"
|
||
|
||
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
||
msgid "Hi&ghlight new and updated files"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
||
msgid "Enable inplace &renaming when clicking twice on a name"
|
||
msgstr "Преименуване на място, при двойно цъкане върху файл"
|
||
|
||
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
|
||
msgid "Load &file list in separate thread"
|
||
msgstr "Зареждане на &файловите списъци в отделна нишка"
|
||
|
||
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
|
||
msgid "Load icons af&ter file list"
|
||
msgstr "Зареждане на значетата &след файловия списък"
|
||
|
||
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
|
||
msgid "Show s&ystem and hidden files"
|
||
msgstr "Показване на &скрити/ системни файлове"
|
||
|
||
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBSPACEMOVESDOWN.CAPTION"
|
||
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
||
msgstr "При избор на файлове с <&Интервал> се преминава на следващия файл (като с <Insert>)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
|
||
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
||
msgid "Use an independent attribute filter in mask input dialog each time"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.gbformatting.caption
|
||
msgid "Formatting"
|
||
msgstr "Изписване"
|
||
|
||
#: tfrmoptionsfilesviews.gbmarking.caption
|
||
msgid "Marking/Unmarking entries"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.gbsorting.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.GBSORTING.CAPTION"
|
||
msgid "Sorting"
|
||
msgstr "Подреждане"
|
||
|
||
#: tfrmoptionsfilesviews.lbattributemask.caption
|
||
msgid "Default attribute mask value to use:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
||
msgid "Case s&ensitivity:"
|
||
msgstr "Отчитане на &гЛАВносТтА"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
||
msgid "Incorrect format"
|
||
msgstr "Неправилен начин на изписване"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.LBLDATETIMEFORMAT.CAPTION"
|
||
msgid "&Date and time format:"
|
||
msgstr "Изписване на &датата и времето:"
|
||
|
||
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
||
msgid "File si&ze format:"
|
||
msgstr "Изписване на файловите &размери:"
|
||
|
||
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
||
msgid "&Insert new files:"
|
||
msgstr "&Вмъкване на нови файлове:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
||
msgid "So&rting directories:"
|
||
msgstr "Подреждане на &папките:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.LBLSORTMETHOD.CAPTION"
|
||
msgid "&Sort method:"
|
||
msgstr "Начин на под&реждане:"
|
||
|
||
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
||
msgid "&Move updated files:"
|
||
msgstr "Преместване на об&новените файлове:"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Прилагане"
|
||
|
||
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Шаблон..."
|
||
|
||
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.GBFILETYPESCOLORS.CAPTION"
|
||
msgid "File types colors (sort by drag&&drop)"
|
||
msgstr "Оцветяване на файловете според вида им (подреждане със за&влачване)"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYATTR.CAPTION"
|
||
msgid "Category a&ttributes:"
|
||
msgstr "&Принадлежности на раздела:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYCOLOR.CAPTION"
|
||
msgid "Category co&lor:"
|
||
msgstr "&Цвят на раздела:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "Раз&ширения на раздела:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "&Име на раздела:"
|
||
|
||
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnseleditfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsellogfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselmainfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.lblconsolefont.caption
|
||
msgid "&Console font"
|
||
msgstr "Шрифт на &конзолата"
|
||
|
||
#: tfrmoptionsfonts.lbleditorfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
|
||
msgid "&Editor font"
|
||
msgstr "Шрифт на об&работчика"
|
||
|
||
#: tfrmoptionsfonts.lbllogfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
|
||
msgid "&Log font"
|
||
msgstr "&Шрифт на дневника"
|
||
|
||
#: tfrmoptionsfonts.lblmainfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
|
||
msgid "Main &font"
|
||
msgstr "&Основен шрифт"
|
||
|
||
#: tfrmoptionsfonts.lblpatheditfont.caption
|
||
msgid "Path font"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
||
msgid "Search results font"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
|
||
msgid "Viewer&Book Font"
|
||
msgstr "Шрифт на &книгоподобния изглед"
|
||
|
||
#: tfrmoptionsfonts.lblviewerfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
|
||
msgid "&Viewer font"
|
||
msgstr "Шрифт на &прегледа"
|
||
|
||
#: tfrmoptionshotkeys.actaddhotkey.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
|
||
msgid "Add &hotkey"
|
||
msgstr "Добавяне на клавишно &съчетание"
|
||
|
||
#: tfrmoptionshotkeys.actcopy.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmoptionshotkeys.actdelete.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "Изтриване"
|
||
|
||
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
|
||
msgid "&Delete hotkey"
|
||
msgstr "Из&триване на клавишно съчетание"
|
||
|
||
#: tfrmoptionshotkeys.actedithotkey.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
|
||
msgid "&Edit hotkey"
|
||
msgstr "Про&мяна на клавишно съчетание"
|
||
|
||
#: tfrmoptionshotkeys.actnextcategory.caption
|
||
msgid "Next category"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
||
msgid "Make popup the file related menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
||
msgid "Previous category"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actrename.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.actrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Преименуване"
|
||
|
||
#: tfrmoptionshotkeys.actrestoredefault.caption
|
||
msgid "Restore DC default"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actsavenow.caption
|
||
msgid "Save now"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actsortbycommand.caption
|
||
msgid "Sort by command name"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
||
msgid "Sort by hotkeys (grouped)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
||
msgid "Sort by hotkeys (one per row)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.lbfilter.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
|
||
msgid "&Filter"
|
||
msgstr "Пре&сяване:"
|
||
|
||
#: tfrmoptionshotkeys.lblcategories.caption
|
||
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
|
||
msgid "C&ategories:"
|
||
msgstr "Раз&дели:"
|
||
|
||
#: tfrmoptionshotkeys.lblcommands.caption
|
||
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
|
||
msgid "Co&mmands:"
|
||
msgstr "&Заповеди:"
|
||
|
||
#: tfrmoptionshotkeys.lblscfiles.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
|
||
msgid "&Shortcut files:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.lblsortorder.caption
|
||
msgid "So&rt order:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.micategories.caption
|
||
msgid "Categories"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionshotkeys.micommands.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.micommands.caption"
|
||
msgid "Command"
|
||
msgstr "Заповед"
|
||
|
||
#: tfrmoptionshotkeys.miseparator1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionshotkeys.misortorder.caption
|
||
msgid "Sort order"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.cbiconsexclude.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "За следните &пътища и подпапките им:"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenus.caption
|
||
msgid "Show icons for actions in &menus"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenussize.text
|
||
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
||
msgid "Show icons on buttons"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
|
||
msgid "Show o&verlay icons, e.g. for links"
|
||
msgstr "Показване на &наслоени значета, например за връзки"
|
||
|
||
#: tfrmoptionsicons.chkshowhiddendimmed.caption
|
||
msgid "&Dimmed hidden files (slower)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
||
msgid "Disable special icons"
|
||
msgstr "Забраняване на особени значета"
|
||
|
||
#: tfrmoptionsicons.gbiconssize.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
|
||
msgid " Icon size "
|
||
msgstr "Размер на значетата"
|
||
|
||
#: tfrmoptionsicons.gbicontheme.caption
|
||
msgid "Icon theme"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.gbshowicons.caption
|
||
msgid "Show icons"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.gbshowiconsmode.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
|
||
msgid " Show icons to the left of the filename "
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.lbldiskpanel.caption
|
||
msgid "Disk panel:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.lblfilepanel.caption
|
||
msgid "File panel:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.rbiconsshowall.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
||
msgid "A&ll"
|
||
msgstr "&Всички"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
|
||
msgid "All associated + &EXE/LNK (slow)"
|
||
msgstr "Всички свързани + &EXE/LNK (бавно)"
|
||
|
||
#: tfrmoptionsicons.rbiconsshownone.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
|
||
msgid "&No icons"
|
||
msgstr "&Без значета"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
||
#, fuzzy
|
||
#| msgid "&Only standard icons"
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
|
||
msgid "Only &standard icons"
|
||
msgstr "&Само обичайните значета"
|
||
|
||
#: tfrmoptionsignorelist.btnaddsel.caption
|
||
#, fuzzy
|
||
#| msgid "&Add selected names"
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
|
||
msgid "A&dd selected names"
|
||
msgstr "&Добавяне на избраните имена"
|
||
|
||
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
|
||
msgid "Add selected names with &full path"
|
||
msgstr "Добавяне на избраните имена с пълните пътища"
|
||
|
||
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
||
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsignorelist.chkignoreenable.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
|
||
msgid "&Ignore (don't show) the following files and folders:"
|
||
msgstr "&Пренебрегване (скриване) на следните файлове и папки:"
|
||
|
||
#: tfrmoptionsignorelist.lblsavein.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
|
||
msgid "&Save in:"
|
||
msgstr "&Съхраняване в:"
|
||
|
||
#: tfrmoptionskeyboard.cblynxlike.caption
|
||
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
||
msgstr "&Лявата и дясната стрелка сменят папките (като в Lynx)"
|
||
|
||
#: tfrmoptionskeyboard.gbtyping.caption
|
||
msgid "Typing"
|
||
msgstr "Набиране"
|
||
|
||
#: tfrmoptionskeyboard.lblalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
|
||
msgid "Alt+L&etters:"
|
||
msgstr "Alt+&букви:"
|
||
|
||
#: tfrmoptionskeyboard.lblctrlalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
|
||
msgid "Ctrl+Alt+Le&tters:"
|
||
msgstr "Ctrl+&Alt+букви:"
|
||
|
||
#: tfrmoptionskeyboard.lblnomodifier.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
|
||
msgid "&Letters:"
|
||
msgstr "&Букви:"
|
||
|
||
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
|
||
msgid "&Flat buttons"
|
||
msgstr "&Плоски бутони"
|
||
|
||
#: tfrmoptionslayout.cbflatinterface.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
|
||
msgid "Flat i&nterface"
|
||
msgstr "&Плосък облик"
|
||
|
||
#: tfrmoptionslayout.cbflattoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
|
||
msgid "Flat b&uttons"
|
||
msgstr "&Плоски бутони"
|
||
|
||
#: tfrmoptionslayout.cbfreespaceind.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
|
||
msgid "Show fr&ee space indicator on drive label"
|
||
msgstr "Показване на указател за &свободно място в етикета на устройството"
|
||
|
||
#: tfrmoptionslayout.cblogwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
|
||
msgid "Show lo&g window"
|
||
msgstr "Прозорец на &дневника"
|
||
|
||
#: tfrmoptionslayout.cbpanelofoperations.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
|
||
msgid "Show panel of operation in background"
|
||
msgstr "Показване на крилото за действия на заден план"
|
||
|
||
#: tfrmoptionslayout.cbproginmenubar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
|
||
msgid "Show common progress in menu bar"
|
||
msgstr "Показване на общия ход в лентата на изборника"
|
||
|
||
#: tfrmoptionslayout.cbshowcmdline.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
|
||
msgid "Show command l&ine"
|
||
msgstr "Показване на &ред за управление"
|
||
|
||
#: tfrmoptionslayout.cbshowcurdir.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
|
||
msgid "Show current director&y"
|
||
msgstr "Показване на &текущата папка"
|
||
|
||
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
|
||
msgid "Show &drive buttons"
|
||
msgstr "Показване на &бутони за устройствата"
|
||
|
||
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
|
||
msgid "Show free s&pace label"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
||
msgid "Show drives list bu&tton"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
|
||
msgid "Show function &key buttons"
|
||
msgstr "Показване на &служебни бутони"
|
||
|
||
#: tfrmoptionslayout.cbshowmainmenu.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
|
||
msgid "Show &main menu"
|
||
msgstr "Показване на главния изборник"
|
||
|
||
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
|
||
msgid "Show tool&bar"
|
||
msgstr "Показване на лента с &бутони"
|
||
|
||
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
||
msgid "Show short free space &label"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionslayout.cbshowstatusbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
|
||
msgid "Show &status bar"
|
||
msgstr "Показване на лента на &състоянието"
|
||
|
||
#: tfrmoptionslayout.cbshowtabheader.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
|
||
msgid "S&how tabstop header"
|
||
msgstr "Заглавия на &подпрозорците"
|
||
|
||
#: tfrmoptionslayout.cbshowtabs.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
|
||
msgid "Sho&w folder tabs"
|
||
msgstr "Показване на &подстраници за папките"
|
||
|
||
#: tfrmoptionslayout.cbtermwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
|
||
msgid "Show te&rminal window"
|
||
msgstr "Показване на &терминален прозорец"
|
||
|
||
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
|
||
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
||
msgstr "Показване на &две ленти с устройствата (неизменна ширина, над файловите прозорци)"
|
||
|
||
#: tfrmoptionslayout.gbscreenlayout.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
|
||
msgid " Screen layout "
|
||
msgstr "Екранна подредба"
|
||
|
||
#: tfrmoptionslog.btnrelativelogfile.hint
|
||
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionslog.btnviewlogfile.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Преглед на дневника на файловото съдържание"
|
||
|
||
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
||
msgid "Include date in log filename"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionslog.cblogarcop.caption
|
||
#, fuzzy
|
||
#| msgid "Pack/Unpack"
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
|
||
msgid "&Pack/Unpack"
|
||
msgstr "Сгъване/ разгъване"
|
||
|
||
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
||
msgid "External command line execution"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionslog.cblogcpmvln.caption
|
||
#, fuzzy
|
||
#| msgid "Copy/Move/Create link/symlink"
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
|
||
msgid "Cop&y/Move/Create link/symlink"
|
||
msgstr "Презапис/Преместване/Създаване на връзка/мека връзка"
|
||
|
||
#: tfrmoptionslog.cblogdelete.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmoptionslog.cblogdirop.caption
|
||
#, fuzzy
|
||
#| msgid "Create/Delete directories"
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
|
||
msgid "Crea&te/Delete directories"
|
||
msgstr "Създаване/ изтриване на папки"
|
||
|
||
#: tfrmoptionslog.cblogerrors.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
|
||
msgid "Log &errors"
|
||
msgstr "Записване на &грешките"
|
||
|
||
#: tfrmoptionslog.cblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
|
||
msgid "C&reate a log file:"
|
||
msgstr "&Водене на дневник"
|
||
|
||
#: tfrmoptionslog.cbloginfo.caption
|
||
#, fuzzy
|
||
#| msgid "Log information messages"
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
|
||
msgid "Log &information messages"
|
||
msgstr "Записване на осведомяващите съобщения"
|
||
|
||
#: tfrmoptionslog.cblogstartshutdown.caption
|
||
msgid "Start/shutdown"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionslog.cblogsuccess.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
|
||
msgid "Log &successful operations"
|
||
msgstr "Записване на &успешните действия"
|
||
|
||
#: tfrmoptionslog.cblogvfs.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
|
||
msgid "&File system plugins"
|
||
msgstr "Приставки за файлови &уредби"
|
||
|
||
#: tfrmoptionslog.gblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
|
||
msgid "File operation log file"
|
||
msgstr "Дневник на действията с файлове"
|
||
|
||
#: tfrmoptionslog.gblogfileop.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILEOP.CAPTION"
|
||
msgid "Log operations"
|
||
msgstr "Дневник на действията"
|
||
|
||
#: tfrmoptionslog.gblogfilestatus.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILESTATUS.CAPTION"
|
||
msgid "Operation status"
|
||
msgstr "Ход на действието"
|
||
|
||
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
||
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
||
msgid "&Remove thumbnails for no longer existing files"
|
||
msgstr "&Изтриване на миниатюрите за изчезнали файлове"
|
||
|
||
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Преглед на дневника на файловото съдържание"
|
||
|
||
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
||
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
|
||
msgid "Create new with the encoding:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.chkgotoroot.caption
|
||
msgid "Always &go to the root of a drive when changing drives"
|
||
msgstr "При смяна на устройството, да се отива в &основната папка"
|
||
|
||
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
||
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
|
||
msgid "Show &warning messages (\"OK\" button only)"
|
||
msgstr "Показване на &предупреждения (само с копче „Добре“)"
|
||
|
||
#: tfrmoptionsmisc.chkthumbsave.caption
|
||
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
|
||
msgid "&Save thumbnails in cache"
|
||
msgstr "&Съхраняване на миниатюрите"
|
||
|
||
#: tfrmoptionsmisc.dblthumbnails.caption
|
||
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Миниатюри"
|
||
|
||
#: tfrmoptionsmisc.gbfilecomments.caption
|
||
msgid "File comments (descript.ion)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.gbtcexportimport.caption
|
||
msgid "Regarding TC export/import:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
||
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
|
||
msgid "Default encoding:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.lbltcconfig.caption
|
||
msgid "Configuration file:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.lbltcexecutable.caption
|
||
msgid "TC executable:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
||
msgid "Toolbar output path:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.lblthumbpixels.caption
|
||
msgid "pixels"
|
||
msgstr "точки"
|
||
|
||
#: tfrmoptionsmisc.lblthumbseparator.caption
|
||
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
|
||
msgid "X"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmisc.lblthumbsize.caption
|
||
msgid "&Thumbnail size:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
||
msgid "&Selection by mouse"
|
||
msgstr "&Избиране с мишката"
|
||
|
||
#: tfrmoptionsmouse.chkcursornofollow.caption
|
||
msgid "The text cursor no longer follows the mouse cursor"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
|
||
msgid "By clic&king on icon"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmouse.gbopenwith.caption
|
||
msgctxt "tfrmoptionsmouse.gbopenwith.caption"
|
||
msgid "Open with"
|
||
msgstr "Отваряне с"
|
||
|
||
#: tfrmoptionsmouse.gbscrolling.caption
|
||
msgid "Scrolling"
|
||
msgstr "Превъртане"
|
||
|
||
#: tfrmoptionsmouse.gbselection.caption
|
||
msgid "Selection"
|
||
msgstr "Избиране"
|
||
|
||
#: tfrmoptionsmouse.lblmousemode.caption
|
||
msgid "&Mode:"
|
||
msgstr "&Режим"
|
||
|
||
#: tfrmoptionsmouse.rbdoubleclick.caption
|
||
msgid "Double click"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
||
msgid "&Line by line"
|
||
msgstr "&Ред по ред"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
||
msgid "Line by line &with cursor movement"
|
||
msgstr "Ред по ред с местене на &показалеца"
|
||
|
||
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
||
msgid "&Page by page"
|
||
msgstr "&Страница по страница"
|
||
|
||
#: tfrmoptionsmouse.rbsingleclickboth.caption
|
||
msgid "Single click (opens files and folders)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsmouse.rbsingleclickfolders.caption
|
||
msgid "Single click (opens folders, double click for files)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionspluginsbase.btnaddplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btnaddplugin.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmoptionspluginsbase.btnconfigplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btnconfigplugin.caption"
|
||
msgid "Con&figure"
|
||
msgstr "&Настройка"
|
||
|
||
#: tfrmoptionspluginsbase.btnenableplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btnenableplugin.caption"
|
||
msgid "E&nable"
|
||
msgstr "&Разрешаване"
|
||
|
||
#: tfrmoptionspluginsbase.btnremoveplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btnremoveplugin.caption"
|
||
msgid "&Remove"
|
||
msgstr "Пре&махване"
|
||
|
||
#: tfrmoptionspluginsbase.btntweakplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btntweakplugin.caption"
|
||
msgid "&Tweak"
|
||
msgstr "&Настройка"
|
||
|
||
#: tfrmoptionspluginsbase.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginsbase.lblplugindescription.caption"
|
||
msgid "Description"
|
||
msgstr "Описание"
|
||
|
||
#: tfrmoptionspluginsbase.stgplugins.columns[0].title.caption
|
||
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[0].title.caption"
|
||
msgid "Active"
|
||
msgstr "Деен"
|
||
|
||
#: tfrmoptionspluginsbase.stgplugins.columns[1].title.caption
|
||
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[1].title.caption"
|
||
msgid "Plugin"
|
||
msgstr "Приставка"
|
||
|
||
#: tfrmoptionspluginsbase.stgplugins.columns[2].title.caption
|
||
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[2].title.caption"
|
||
msgid "Registered for"
|
||
msgstr "Записано на"
|
||
|
||
#: tfrmoptionspluginsbase.stgplugins.columns[3].title.caption
|
||
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[3].title.caption"
|
||
msgid "File name"
|
||
msgstr "Файлово име"
|
||
|
||
#: tfrmoptionspluginsdsx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginsdsx.lblplugindescription.caption"
|
||
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
||
msgstr "Приставките за &търсене позволяват изполването на заместващ алгоритъм за търсене или на въшни пособия от рода на „locate“ и т.н."
|
||
|
||
#: tfrmoptionspluginsgroup.btnpathtoberelativetoall.caption
|
||
msgid "Apply current settings to all current configured plugins"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionspluginsgroup.ckbautotweak.caption
|
||
msgid "When adding a new plugin, automatically go in tweak window"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionspluginsgroup.gbconfiguration.caption
|
||
msgid "Configuration:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionspluginsgroup.lbpathtoberelativeto.caption
|
||
msgid "Path to be relative to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionspluginsgroup.lbpluginfilenamestyle.caption
|
||
msgid "Plugin filename style when adding a new plugin:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionspluginswcx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginswcx.lblplugindescription.caption"
|
||
msgid "Pack&er plugins are used to work with archives"
|
||
msgstr "У&плътняващите приставки се използват за работа със сбивки (архиви)."
|
||
|
||
#: tfrmoptionspluginswcx.stgplugins.columns[0].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[0].title.caption"
|
||
msgid "Active"
|
||
msgstr "Деен"
|
||
|
||
#: tfrmoptionspluginswcx.stgplugins.columns[1].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[1].title.caption"
|
||
msgid "Plugin"
|
||
msgstr "Приставка"
|
||
|
||
#: tfrmoptionspluginswcx.stgplugins.columns[2].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[2].title.caption"
|
||
msgid "Registered for"
|
||
msgstr "Записано на"
|
||
|
||
#: tfrmoptionspluginswcx.stgplugins.columns[3].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[3].title.caption"
|
||
msgid "File name"
|
||
msgstr "Файлово име"
|
||
|
||
#: tfrmoptionspluginswdx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginswdx.lblplugindescription.caption"
|
||
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
||
msgstr "Приставките за &съдържание позволяват показването на допълнителни подробности за файловете, от рода на mp3 означители или свосйтв ана изображения във файловите списъци. Могат да се използват и при търсене и в пособието за множествено преименуване."
|
||
|
||
#: tfrmoptionspluginswfx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginswfx.lblplugindescription.caption"
|
||
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
||
msgstr "Приставките за &файлови уредби позволяват достъп до дискове, недостъпни от работната уредба или до външи устройства като Palm и PocketPC."
|
||
|
||
#: tfrmoptionspluginswlx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginswlx.lblplugindescription.caption"
|
||
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
||
msgstr "Приставките за пре&глед позволяват показването на файлови формати от рода на изображения, таблици, бази от данни и т.н. в прегеда (F3, Ctrl+Q)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
|
||
msgid "&Beginning (name must start with first typed character)"
|
||
msgstr "&Начало (името трябва да започва с първия набран знак)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
|
||
msgid "En&ding (last character before a typed dot . must match)"
|
||
msgstr "&Край (последният знак преди точката . трябва да съвпада)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Възможности"
|
||
|
||
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.GBEXACTNAMEMATCH.CAPTION"
|
||
msgid "Exact name match"
|
||
msgstr "Точно съвпадение на имената"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
||
msgid "Search case"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
||
msgid "Search for these items"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
||
msgid "Keep renamed name when unlocking a tab"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
|
||
msgid "Activate target &panel when clicking on one of its Tabs"
|
||
msgstr "Задействане на целевото &крило при цъкане на някой от подпрозорците му"
|
||
|
||
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
|
||
msgid "&Show tab header also when there is only one tab"
|
||
msgstr "Показване на &заглавки на подпрозорците, дори когато има само един"
|
||
|
||
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
||
msgid "Close duplicate tabs when closing application"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
|
||
msgid "Con&firm close all tabs"
|
||
msgstr "&Искане на потвърждение при затваряне на всички подпрозорци"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
||
msgid "Confirm close locked tabs"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabslimitoption.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
|
||
msgid "&Limit tab title length to"
|
||
msgstr "&Ширина на заглавията на подстраниците до:"
|
||
|
||
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
|
||
msgid "Show locked tabs &with an asterisk *"
|
||
msgstr "Означаване на заключените подпрозорци със звездичка *"
|
||
|
||
#: tfrmoptionstabs.cbtabsmultilines.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
|
||
msgid "&Tabs on multiple lines"
|
||
msgstr "Многоредово разположение на &подстраниците"
|
||
|
||
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
|
||
msgid "Ctrl+&Up opens new tab in foreground"
|
||
msgstr "Ctrl+&Up отваря нов подпрозорец на преден план"
|
||
|
||
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
|
||
msgid "Open &new tabs near current tab"
|
||
msgstr "Отваряне на &новите подпрозорци до текущия"
|
||
|
||
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
||
msgid "Reuse existing tab when possible"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
|
||
msgid "Show ta&b close button"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
||
msgid "Always show drive letter in tab title"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.gbtabs.caption
|
||
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
|
||
msgid "Folder tabs headers"
|
||
msgstr "Заглавки на подстраниците на папките"
|
||
|
||
#: tfrmoptionstabs.lblchar.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
|
||
msgid "characters"
|
||
msgstr "знака"
|
||
|
||
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
||
msgid "Action to do when double click on a tab:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabs.lbltabsposition.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
|
||
msgid "Ta&bs position"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Не"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
||
msgid "Right"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after resaving"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
||
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
||
msgid "Default extra settings when saving new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.gbtabs.caption
|
||
msgid "Folder tabs headers extra"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
||
msgid "When restoring tab, existing tabs to keep:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
||
msgid "Tabs saved on left will be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
||
msgid "Tabs saved on right will be restored to:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
||
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
||
msgid "Default position in menu when saving a new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.edruntermparams.hint
|
||
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
||
msgid "Command for just running terminal:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
||
msgid "Command for running a command in terminal and close after:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
||
msgid "Command for running a command in terminal and stay open:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Заповед:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Ключове:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Заповед:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Ключове:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermcmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Заповед:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Ключове:"
|
||
|
||
#: tfrmoptionstoolbar.btnclonebutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btnclonebutton.caption"
|
||
msgid "C&lone button"
|
||
msgstr "Удвояване"
|
||
|
||
#: tfrmoptionstoolbar.btndeletebutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
|
||
msgid "&Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmoptionstoolbar.btnedithotkey.caption
|
||
msgctxt "tfrmoptionstoolbar.btnedithotkey.caption"
|
||
msgid "Edit hot&key"
|
||
msgstr "Об&работка"
|
||
|
||
#: tfrmoptionstoolbar.btninsertbutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btninsertbutton.caption"
|
||
msgid "&Insert new button"
|
||
msgstr "&Добавяне на бутон"
|
||
|
||
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
||
msgid "Select"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.btnopenfile.caption
|
||
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnother.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
||
msgid "Other..."
|
||
msgstr "Друго..."
|
||
|
||
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
||
msgctxt "tfrmoptionstoolbar.btnremovehotkey.caption"
|
||
msgid "Remove hotke&y"
|
||
msgstr "Премахване на клавишно съ&четание"
|
||
|
||
#: tfrmoptionstoolbar.btnstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
||
msgid "Suggest"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
||
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
||
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
||
msgid "&Flat buttons"
|
||
msgstr "Плоски бутони"
|
||
|
||
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
||
msgid "Report errors with commands"
|
||
msgstr "Докладване на грешки в заповедите"
|
||
|
||
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
||
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.gbgroupbox.caption
|
||
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
|
||
msgid "Appearance"
|
||
msgstr "Облик"
|
||
|
||
#: tfrmoptionstoolbar.lblbarsize.caption
|
||
msgctxt "tfrmoptionstoolbar.lblbarsize.caption"
|
||
msgid "&Bar size:"
|
||
msgstr "&Размер на лентата:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblexternalcommand.caption"
|
||
msgid "Comman&d:"
|
||
msgstr "&Заповед:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Клю&чове:"
|
||
|
||
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
|
||
msgid "Help"
|
||
msgstr "Помощ"
|
||
|
||
#: tfrmoptionstoolbar.lblhotkey.caption
|
||
msgid "Hot key:"
|
||
msgstr "Клавишно съчетание:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconfile.caption
|
||
msgctxt "tfrmoptionstoolbar.lbliconfile.caption"
|
||
msgid "Ico&n:"
|
||
msgstr "&Значе:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconsize.caption
|
||
msgctxt "tfrmoptionstoolbar.lbliconsize.caption"
|
||
msgid "Icon si&ze:"
|
||
msgstr "Размер на &значетата:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
|
||
msgid "Co&mmand:"
|
||
msgstr "&Заповед"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
|
||
msgid "&Parameters:"
|
||
msgstr "&Ключове"
|
||
|
||
#: tfrmoptionstoolbar.lblstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "&Пусков път:"
|
||
|
||
#: tfrmoptionstoolbar.lbltooltip.caption
|
||
msgctxt "tfrmoptionstoolbar.lbltooltip.caption"
|
||
msgid "&Tooltip:"
|
||
msgstr "&Подсказка:"
|
||
|
||
#: tfrmoptionstoolbar.miaddallcmds.caption
|
||
msgid "Add toolbar with ALL DC commands"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
||
msgid "for an external command"
|
||
msgstr "за външна заповед"
|
||
|
||
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
||
msgid "for an internal command"
|
||
msgstr "за вътрешна заповед"
|
||
|
||
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
||
msgid "for a separator"
|
||
msgstr "за разделител"
|
||
|
||
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
||
msgid "for a sub-tool bar"
|
||
msgstr "за под-лента"
|
||
|
||
#: tfrmoptionstoolbar.mibackup.caption
|
||
msgctxt "tfrmoptionstoolbar.mibackup.caption"
|
||
msgid "Backup..."
|
||
msgstr "Запасяване..."
|
||
|
||
#: tfrmoptionstoolbar.miexport.caption
|
||
msgctxt "tfrmoptionstoolbar.miexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Изнасяне..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrent.caption
|
||
msgid "Current toolbar..."
|
||
msgstr "Текущата лента..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "във файл за лента с пособия (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "във файла .BAR за TC (запазване на съществуващия)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "във файла .BAR за TC (изтриване на съществуващия)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "във „wincmd.ini‟ за TC (запазване на съществуващия)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "във „wincmd.ini‟ за TC (изтриване на съществуващия)"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator3.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator4.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexporttop.caption
|
||
msgid "Top toolbar..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
||
msgid "Save a backup of Toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "във файл за лента с пособия (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "във файла .BAR за TC (запазване на съществуващия)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "във файла .BAR за TC (изтриване на съществуващия)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "в „wincmd.ini‟ за TC (запазване на съществуващия)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "в „wincmd.ini‟ за TC (изтриване на съществуващия)"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "точно след избрания предмет"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "като първи предмет"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "като последен предмет"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "точно преди избрания предмет"
|
||
|
||
#: tfrmoptionstoolbar.miimport.caption
|
||
msgctxt "tfrmoptionstoolbar.miimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Внасяне..."
|
||
|
||
#: tfrmoptionstoolbar.miimportbackup.caption
|
||
msgid "Restore a backup of Toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbar.caption
|
||
msgid "from a Toolbar File (.toolbar)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimportseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbar.caption
|
||
msgid "from a single TC .BAR file"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttcini.caption
|
||
msgid "from \"wincmd.ini\" of TC..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "точно след избрания предмет"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "като първи предмет"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "като последен предмет"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "точно преди избрания предмет"
|
||
|
||
#: tfrmoptionstoolbar.misearchandreplace.caption
|
||
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
|
||
msgid "Search and replace..."
|
||
msgstr "Търсене и замяна..."
|
||
|
||
#: tfrmoptionstoolbar.miseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator10.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator11.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator13.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator14.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator6.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator7.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator8.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator9.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "точно след избрания предмет"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
||
msgid "as first element"
|
||
msgstr "като първи предмет"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "като последен предмет"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "точно преди избрания предмет"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
||
msgid "in all of all the above..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
||
msgid "in all commands..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
||
msgid "in all icon names..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
||
msgid "in all parameters..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
||
msgid "in all start path..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "точно след избрания предмет"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "като първи предмет"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "като последен предмет"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "точно преди избрания предмет"
|
||
|
||
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
||
msgid "Button type"
|
||
msgstr "Вид на бутона"
|
||
|
||
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
||
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSKEEPTERMINALOPEN.CAPTION"
|
||
msgid "&Keep terminal window open after executing program"
|
||
msgstr "Прозорецът на терминала остава &отворен след изпълнение на приложението"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSRUNINTERMINAL.CAPTION"
|
||
msgid "&Execute in terminal"
|
||
msgstr "Изпълняване в &терминал"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSUSEEXTERNALPROGRAM.CAPTION"
|
||
msgid "&Use external program"
|
||
msgstr "Ползване на &външно приложение"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPARAMETERS.CAPTION"
|
||
msgid "A&dditional parameters"
|
||
msgstr "&Допълнителни ключове"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolspath.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPATH.CAPTION"
|
||
msgid "&Path to program to execute"
|
||
msgstr "&Път към приложението"
|
||
|
||
#: tfrmoptionstooltips.btnaddtooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btnaddtooltipsfiletype.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Добавяне"
|
||
|
||
#: tfrmoptionstooltips.btnapplytooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btnapplytooltipsfiletype.caption"
|
||
msgid "A&pply"
|
||
msgstr "&Прилагане"
|
||
|
||
#: tfrmoptionstooltips.btncopytooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btncopytooltipsfiletype.caption"
|
||
msgid "Cop&y"
|
||
msgstr "Запомняне"
|
||
|
||
#: tfrmoptionstooltips.btndeletetooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btndeletetooltipsfiletype.caption"
|
||
msgid "Delete"
|
||
msgstr "Из&триване"
|
||
|
||
#: tfrmoptionstooltips.btnfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Шаблон..."
|
||
|
||
#: tfrmoptionstooltips.btnrenametooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btnrenametooltipsfiletype.caption"
|
||
msgid "&Rename"
|
||
msgstr "Пре&махване"
|
||
|
||
#: tfrmoptionstooltips.btntooltipother.caption
|
||
msgctxt "tfrmoptionstooltips.btntooltipother.caption"
|
||
msgid "Oth&er..."
|
||
msgstr "Друго:..."
|
||
|
||
#: tfrmoptionstooltips.bvltooltips1.caption
|
||
msgid "Tooltip configuration for selected file type:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstooltips.bvltooltips2.caption
|
||
msgid "General options about tooltips:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstooltips.chkshowtooltip.caption
|
||
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
|
||
msgid "&Show tooltip for files in the file panel"
|
||
msgstr "Показване на &подсказки"
|
||
|
||
#: tfrmoptionstooltips.lblfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
|
||
msgid "Category &hint:"
|
||
msgstr "Подсказки според раз&дела"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsmask.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "Раз&ширения на раздела:"
|
||
|
||
#: tfrmoptionstooltips.lbltooltiphidingdelay.caption
|
||
msgid "Tooltip hiding delay:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstooltips.lbltooltipshowingmode.caption
|
||
msgid "Tooltip showing mode:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstooltips.lbltooltipslistbox.caption
|
||
msgid "&File types:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstooltips.mitooltipsfiletypediscardmodification.caption
|
||
msgid "Discard Modifications"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstooltips.mitooltipsfiletypeexport.caption
|
||
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Изнасяне..."
|
||
|
||
#: tfrmoptionstooltips.mitooltipsfiletypeimport.caption
|
||
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Внасяне..."
|
||
|
||
#: tfrmoptionstooltips.mitooltipsfiletypesortfiletype.caption
|
||
msgid "Sort Tooltip File Types"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
||
msgid "With double-click on the bar on top of a file panel"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
||
msgid "Double click in tree select and exit"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
||
msgid "With double-click on a tab (if configured for it)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
||
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
||
msgid "Single mouse click in tree select and exit"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
||
msgid "Use it for Command Line History"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
||
msgid "Use it for the Dir History"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
||
msgid "Use it for the View History (Visited paths for active view)"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
||
msgid "Behavior regarding selection:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
||
msgid "Tree View Menus related options:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
||
msgid "Where to use Tree View Menus:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lblnote.caption
|
||
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
||
msgid "With Directory Hotlist:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
||
msgid "With Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
||
msgid "With History:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
||
msgid "Use and display keyboard shortcut for choosing items"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
||
msgid "Layout and colors options:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
||
msgid "Background color:"
|
||
msgstr "Подцветка:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
||
msgid "Cursor color:"
|
||
msgstr "Цвят на показалеца:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
||
msgid "Found text color:"
|
||
msgstr "Цвят на намерения текст:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
||
msgid "Found text under cursor:"
|
||
msgstr "Цвят на текста под показалеца:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
||
msgid "Normal text color:"
|
||
msgstr "Обичаен цвят на текста:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
||
msgid "Normal text under cursor:"
|
||
msgstr "Обичаен цвят на текста под показалеца:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
||
msgid "Tree View Menu Preview:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
||
msgid "Secondary text color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
||
msgid "Secondary text under cursor:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
||
msgid "Shortcut color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
||
msgid "Shortcut under cursor:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
||
msgid "Unselectable text color:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
||
msgid "Unselectable under cursor:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
||
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWERBOOKMODE.CAPTION"
|
||
msgid "Viewer Book Mode"
|
||
msgstr "Книговиден изглед на прегледа"
|
||
|
||
#: tfrmoptionsviewer.gbviewerexample.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
|
||
msgid "Example"
|
||
msgstr "Пример"
|
||
|
||
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLBACKGROUNDCOLORVIEWERBOOK.CAPTION"
|
||
msgid "&Background color in book viewer"
|
||
msgstr "&Подцветка на книговидния преглед"
|
||
|
||
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLFONTCOLORVIEWERBOOK.CAPTION"
|
||
msgid "&Font color in book viewer"
|
||
msgstr "Цвят на &шрифта на книговидния преглед"
|
||
|
||
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLNUMBERCOLUMNSVIEWER.CAPTION"
|
||
msgid "&Number of columns in book viewer"
|
||
msgstr "Брой на &стълбовете в книговидния преглед"
|
||
|
||
#: tfrmpackdlg.btnconfig.caption
|
||
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "&Настройка"
|
||
|
||
#: tfrmpackdlg.caption
|
||
msgctxt "TFRMPACKDLG.CAPTION"
|
||
msgid "Pack files"
|
||
msgstr "Сбиване на файлове"
|
||
|
||
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
||
msgid "C&reate separate archives, one per selected file/dir"
|
||
msgstr "Създаване на разделни архиви, по &един на файл/папка"
|
||
|
||
#: tfrmpackdlg.cbcreatesfx.caption
|
||
msgid "Create self e&xtracting archive"
|
||
msgstr "Създаване на саморазгъващ се файл"
|
||
|
||
#: tfrmpackdlg.cbencrypt.caption
|
||
msgid "Encr&ypt"
|
||
msgstr "&Криптиране"
|
||
|
||
#: tfrmpackdlg.cbmovetoarchive.caption
|
||
msgid "Mo&ve to archive"
|
||
msgstr "Пре&местване в архив"
|
||
|
||
#: tfrmpackdlg.cbmultivolume.caption
|
||
msgid "&Multiple disk archive"
|
||
msgstr "&Многотомов архив"
|
||
|
||
#: tfrmpackdlg.cbotherplugins.caption
|
||
msgid "=>"
|
||
msgstr "=>"
|
||
|
||
#: tfrmpackdlg.cbputintarfirst.caption
|
||
msgid "P&ut in the TAR archive first"
|
||
msgstr "&Първо да се поставя в TAR"
|
||
|
||
#: tfrmpackdlg.cbstoredir.caption
|
||
msgid "Also &pack path names (only recursed)"
|
||
msgstr "&Сбиване и на имената на пътищата (само вложено)"
|
||
|
||
#: tfrmpackdlg.lblprompt.caption
|
||
msgid "Pack file(s) to the file:"
|
||
msgstr "Сбиване на фал(овете) във файл:"
|
||
|
||
#: tfrmpackdlg.rgpacker.caption
|
||
msgid "Packer"
|
||
msgstr "Сбивачка"
|
||
|
||
#: tfrmpackinfodlg.btnclose.caption
|
||
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Затваряне"
|
||
|
||
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
||
msgid "Unpack &all and execute"
|
||
msgstr "Разгъване на вси&чки и изпълняване"
|
||
|
||
#: tfrmpackinfodlg.btnunpackandexec.caption
|
||
msgid "&Unpack and execute"
|
||
msgstr "&Разгъване и изпълняване"
|
||
|
||
#: tfrmpackinfodlg.caption
|
||
msgctxt "TFRMPACKINFODLG.CAPTION"
|
||
msgid "Properties of packed file"
|
||
msgstr "Свойства на сбития файл"
|
||
|
||
#: tfrmpackinfodlg.lblattributes.caption
|
||
msgid "Attributes:"
|
||
msgstr "Принадлежности:"
|
||
|
||
#: tfrmpackinfodlg.lblcompressionratio.caption
|
||
msgid "Compression ratio:"
|
||
msgstr "Степен на уплътняване:"
|
||
|
||
#: tfrmpackinfodlg.lbldate.caption
|
||
msgid "Date:"
|
||
msgstr "Дата:"
|
||
|
||
#: tfrmpackinfodlg.lblmethod.caption
|
||
msgid "Method:"
|
||
msgstr "Способ:"
|
||
|
||
#: tfrmpackinfodlg.lbloriginalsize.caption
|
||
msgid "Original size:"
|
||
msgstr "Първоначален размер:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedfile.caption
|
||
msgid "File:"
|
||
msgstr "Файл:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedsize.caption
|
||
msgid "Packed size:"
|
||
msgstr "Размер след сбиване:"
|
||
|
||
#: tfrmpackinfodlg.lblpacker.caption
|
||
msgid "Packer:"
|
||
msgstr "Сбивачка:"
|
||
|
||
#: tfrmpackinfodlg.lbltime.caption
|
||
msgid "Time:"
|
||
msgstr "Време:"
|
||
|
||
#: tfrmquicksearch.btncancel.caption
|
||
msgctxt "tfrmquicksearch.btncancel.caption"
|
||
msgid "X"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.btncancel.hint
|
||
msgid "Close filter panel"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.edtsearch.hint
|
||
msgid "Enter text to search for or filter by"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.caption
|
||
msgid "Aa"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.hint
|
||
msgid "Case Sensitive"
|
||
msgstr "Отчитане на глАВноСТта"
|
||
|
||
#: tfrmquicksearch.sbdirectories.caption
|
||
msgid "D"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.sbdirectories.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
||
msgid "Directories"
|
||
msgstr "Папки"
|
||
|
||
#: tfrmquicksearch.sbfiles.caption
|
||
msgid "F"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.sbfiles.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmquicksearch.sbfiles.hint"
|
||
msgid "Files"
|
||
msgstr "Файлове"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.caption
|
||
msgid "{"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.hint
|
||
msgid "Match Beginning"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.sbmatchending.caption
|
||
msgid "}"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.sbmatchending.hint
|
||
msgid "Match Ending"
|
||
msgstr ""
|
||
|
||
#: tfrmquicksearch.tglfilter.caption
|
||
msgctxt "tfrmquicksearch.tglfilter.caption"
|
||
msgid "Filter"
|
||
msgstr "Пресяване"
|
||
|
||
#: tfrmquicksearch.tglfilter.hint
|
||
msgid "Toggle between search or filter"
|
||
msgstr ""
|
||
|
||
#: tfrmsearchplugin.btnadd.caption
|
||
msgid "&More rules"
|
||
msgstr ""
|
||
|
||
#: tfrmsearchplugin.btndelete.caption
|
||
msgid "L&ess rules"
|
||
msgstr ""
|
||
|
||
#: tfrmsearchplugin.chkuseplugins.caption
|
||
msgid "Use &content plugins, combine with:"
|
||
msgstr ""
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[0].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
|
||
msgid "Plugin"
|
||
msgstr "Приставка"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[1].text
|
||
msgid "Field"
|
||
msgstr "Поле"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[2].text
|
||
msgid "Operator"
|
||
msgstr ""
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[3].text
|
||
#, fuzzy
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
||
msgid "Value"
|
||
msgstr "Стойност"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[4].text
|
||
msgid "Unit"
|
||
msgstr ""
|
||
|
||
#: tfrmsearchplugin.rband.caption
|
||
msgid "&AND (all match)"
|
||
msgstr ""
|
||
|
||
#: tfrmsearchplugin.rbor.caption
|
||
msgid "&OR (any match)"
|
||
msgstr ""
|
||
|
||
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Отказ"
|
||
|
||
#: tfrmselecttextrange.btppanel.closebutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Затваряне"
|
||
|
||
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Помо&щ"
|
||
|
||
#: tfrmselecttextrange.btppanel.okbutton.caption
|
||
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmselecttextrange.lblselecttext.caption
|
||
msgid "&Select the characters to insert:"
|
||
msgstr ""
|
||
|
||
#: tfrmsetfileproperties.btncancel.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmsetfileproperties.btnok.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmsetfileproperties.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change attributes"
|
||
msgstr "Промяна на принадлежностите"
|
||
|
||
#: tfrmsetfileproperties.cbsgid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr ""
|
||
|
||
#: tfrmsetfileproperties.cbsticky.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Лепкав"
|
||
|
||
#: tfrmsetfileproperties.cbsuid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr ""
|
||
|
||
#: tfrmsetfileproperties.chkarchive.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
|
||
msgid "Archive"
|
||
msgstr "Архив"
|
||
|
||
#: tfrmsetfileproperties.chkcreationtime.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
|
||
msgid "Created:"
|
||
msgstr "Саздаден:"
|
||
|
||
#: tfrmsetfileproperties.chkhidden.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
|
||
msgid "Hidden"
|
||
msgstr "Скрит"
|
||
|
||
#: tfrmsetfileproperties.chklastaccesstime.caption
|
||
msgid "Accessed:"
|
||
msgstr "Ползван:"
|
||
|
||
#: tfrmsetfileproperties.chklastwritetime.caption
|
||
msgid "Modified:"
|
||
msgstr "Променен:"
|
||
|
||
#: tfrmsetfileproperties.chkreadonly.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
|
||
msgid "Read only"
|
||
msgstr "Само за четене"
|
||
|
||
#: tfrmsetfileproperties.chkrecursive.caption
|
||
msgid "Including subfolders"
|
||
msgstr "Включително подпапките"
|
||
|
||
#: tfrmsetfileproperties.chksystem.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
|
||
msgid "System"
|
||
msgstr "Системен"
|
||
|
||
#: tfrmsetfileproperties.gbtimesamp.caption
|
||
msgid "Timestamp properties"
|
||
msgstr ""
|
||
|
||
#: tfrmsetfileproperties.gbunixattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Принадлежности"
|
||
|
||
#: tfrmsetfileproperties.gbwinattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Принадлежности"
|
||
|
||
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Разряда:"
|
||
|
||
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: tfrmsetfileproperties.lblattrinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(сиво = непроменено, отметнато = включено)"
|
||
|
||
#: tfrmsetfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Друго:"
|
||
|
||
#: tfrmsetfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Собственик"
|
||
|
||
#: tfrmsetfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmsetfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Словесно представяне:"
|
||
|
||
#: tfrmsetfileproperties.lblexec.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Изпълнение"
|
||
|
||
#: tfrmsetfileproperties.lblmodeinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(сиво = непроменено, отметнато = включено)"
|
||
|
||
#: tfrmsetfileproperties.lbloctal.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Осмично:"
|
||
|
||
#: tfrmsetfileproperties.lblread.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Запис"
|
||
|
||
#: tfrmsetfileproperties.lblwrite.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Четене"
|
||
|
||
#: tfrmsplitter.btncancel.caption
|
||
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmsplitter.btnftchoice.caption
|
||
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmsplitter.btnok.caption
|
||
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmsplitter.btnrelativeftchoice.hint
|
||
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmsplitter.caption
|
||
msgctxt "TFRMSPLITTER.CAPTION"
|
||
msgid "Splitter"
|
||
msgstr "Разделител"
|
||
|
||
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
||
msgid "Require a CRC32 verification file"
|
||
msgstr ""
|
||
|
||
#: tfrmsplitter.cmbxsize.text
|
||
msgid "1457664B - 3.5\""
|
||
msgstr "1457664B - 3.5\""
|
||
|
||
#: tfrmsplitter.grbxfile.caption
|
||
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Файлово име"
|
||
|
||
#: tfrmsplitter.grbxsize.caption
|
||
msgid "Size and number of parts"
|
||
msgstr "Размер и брой на частите"
|
||
|
||
#: tfrmsplitter.lbdirtarget.caption
|
||
msgid "Directory &target"
|
||
msgstr "&Целева папка"
|
||
|
||
#: tfrmsplitter.lbfilesource.caption
|
||
msgid "File &source"
|
||
msgstr ""
|
||
"Файлов &\n"
|
||
"източник\n"
|
||
|
||
#: tfrmsplitter.lblnumberparts.caption
|
||
msgid "&Number of parts"
|
||
msgstr "&Брой на частите"
|
||
|
||
#: tfrmsplitter.rbtnbyte.caption
|
||
msgid "&Bytes"
|
||
msgstr "&байта"
|
||
|
||
#: tfrmsplitter.rbtngigab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
|
||
msgid "&Gigabytes"
|
||
msgstr "&гигабайта"
|
||
|
||
#: tfrmsplitter.rbtnkilob.caption
|
||
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
|
||
msgid "&Kilobytes"
|
||
msgstr "&килобайта"
|
||
|
||
#: tfrmsplitter.rbtnmegab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
|
||
msgid "&Megabytes"
|
||
msgstr "&мегабайта"
|
||
|
||
#: tfrmstartingsplash.caption
|
||
msgctxt "tfrmstartingsplash.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblbuild.caption
|
||
msgctxt "tfrmstartingsplash.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Постройка"
|
||
|
||
#: tfrmstartingsplash.lblfreepascalver.caption
|
||
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmstartingsplash.lbllazarusver.caption
|
||
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmstartingsplash.lbloperatingsystem.caption
|
||
msgid "Operating System"
|
||
msgstr ""
|
||
|
||
#: tfrmstartingsplash.lblplatform.caption
|
||
msgid "Platform"
|
||
msgstr ""
|
||
|
||
#: tfrmstartingsplash.lblrevision.caption
|
||
msgctxt "tfrmstartingsplash.lblrevision.caption"
|
||
msgid "Revision"
|
||
msgstr "Преработка"
|
||
|
||
#: tfrmstartingsplash.lbltitle.caption
|
||
msgctxt "tfrmstartingsplash.lbltitle.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblversion.caption
|
||
msgctxt "tfrmstartingsplash.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Издание"
|
||
|
||
#: tfrmstartingsplash.lblwidgetsetver.caption
|
||
msgid "WidgetsetVer"
|
||
msgstr ""
|
||
|
||
#: tfrmsymlink.btncancel.caption
|
||
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmsymlink.btnok.caption
|
||
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmsymlink.caption
|
||
msgid "Create symbolic link"
|
||
msgstr "Създаване на мека връзка"
|
||
|
||
#: tfrmsymlink.chkuserelativepath.caption
|
||
msgid "Use &relative path when possible"
|
||
msgstr ""
|
||
|
||
#: tfrmsymlink.lblexistingfile.caption
|
||
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "Съществуваща &цел, към която да сочи връзката"
|
||
|
||
#: tfrmsymlink.lbllinktocreate.caption
|
||
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "&Име на връзката"
|
||
|
||
#: tfrmsyncdirsdlg.actselectclear.caption
|
||
msgid "Remove selection"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.actselectcopydefault.caption
|
||
msgid "Select for copying (default direction)"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
|
||
msgid "Select for copying -> (left to right)"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
|
||
msgid "Reverse copy direction"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
|
||
msgid "Select for copying <- (right to left)"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.actselectdeleteright.caption
|
||
msgid "Select for deleting -> (right)"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.btnclose.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
|
||
msgid "Close"
|
||
msgstr "Затваряне"
|
||
|
||
#: tfrmsyncdirsdlg.btncompare.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Сравняване"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir1.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir2.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Съгласуване"
|
||
|
||
#: tfrmsyncdirsdlg.caption
|
||
msgid "Synchronize directories"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.cbextfilter.text
|
||
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
||
msgid "asymmetric"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.chkbycontent.caption
|
||
msgid "by content"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.chkignoredate.caption
|
||
msgid "ignore date"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
||
msgid "only selected"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.chksubdirs.caption
|
||
msgid "Subdirs"
|
||
msgstr "Подпапки"
|
||
|
||
#: tfrmsyncdirsdlg.groupbox1.caption
|
||
msgid "Show:"
|
||
msgstr "Показване:"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Име"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
|
||
msgid "Size"
|
||
msgstr "Размер"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
||
msgid "<=>"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
|
||
msgid "Size"
|
||
msgstr "Размер"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
|
||
msgid "Name"
|
||
msgstr "Име"
|
||
|
||
#: tfrmsyncdirsdlg.label1.caption
|
||
msgid "(in main window)"
|
||
msgstr "(в главния прозорец)"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
||
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Сравняване"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
||
msgid "View left"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
||
msgid "View right"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyright.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmsyncdirsdlg.sbduplicates.caption
|
||
msgid "duplicates"
|
||
msgstr "повтарящи"
|
||
|
||
#: tfrmsyncdirsdlg.sbequal.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbequal.caption"
|
||
msgid "="
|
||
msgstr "="
|
||
|
||
#: tfrmsyncdirsdlg.sbnotequal.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbnotequal.caption"
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: tfrmsyncdirsdlg.sbsingles.caption
|
||
msgid "singles"
|
||
msgstr ""
|
||
|
||
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
||
msgid "Please press \"Compare\" to start"
|
||
msgstr "Натиснете „Сравняване‟ за начало"
|
||
|
||
#: tfrmsyncdirsperformdlg.caption
|
||
msgctxt "tfrmsyncdirsperformdlg.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Съгласуване"
|
||
|
||
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
||
msgid "Confirm overwrites"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.caption
|
||
msgctxt "tfrmtreeviewmenu.caption"
|
||
msgid "Tree View Menu"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
||
msgid "Select your hot directory:"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
||
msgid "Search is case sensitive"
|
||
msgstr "Търсене с отчитане на глАВноСТта"
|
||
|
||
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
||
msgid "Full collapse"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmifullexpand.caption
|
||
msgid "Full expand"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
||
msgid "Search ignore accents and ligatures"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
||
msgid "Search is not case sensitive"
|
||
msgstr "Търсене без отчитане на глАВноСТта"
|
||
|
||
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
||
msgid "Search is strict regarding accents and ligatures"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
||
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
||
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
||
msgid "Close Tree View Menu"
|
||
msgstr ""
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
||
#, fuzzy
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Настройка на дървовидния изглед"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr ""
|
||
|
||
#: tfrmtweakplugin.btnadd.caption
|
||
msgid "A&dd new"
|
||
msgstr "Добавяне на &ново"
|
||
|
||
#: tfrmtweakplugin.btncancel.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: tfrmtweakplugin.btnchange.caption
|
||
msgid "C&hange"
|
||
msgstr "Про&мяна"
|
||
|
||
#: tfrmtweakplugin.btndefault.caption
|
||
msgid "De&fault"
|
||
msgstr "Под&разбирано"
|
||
|
||
#: tfrmtweakplugin.btnok.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: tfrmtweakplugin.btnrelativeplugin1.hint
|
||
msgctxt "tfrmtweakplugin.btnrelativeplugin1.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmtweakplugin.btnrelativeplugin2.hint
|
||
msgctxt "tfrmtweakplugin.btnrelativeplugin2.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr ""
|
||
|
||
#: tfrmtweakplugin.btnremove.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Пре&махване"
|
||
|
||
#: tfrmtweakplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
|
||
msgid "Tweak plugin"
|
||
msgstr "Настройка на приставката"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
||
msgid "De&tect archive type by content"
|
||
msgstr "Разпознаване на &архивите според съдържанието"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
||
msgid "Can de&lete files"
|
||
msgstr "Възможно е из&триването на файлове"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
||
msgid "Supports e&ncryption"
|
||
msgstr "Поддържа кодиране:"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
||
msgid "Sho&w as normal files (hide packer icon)"
|
||
msgstr "Показване като обичайни файлове (скриване на значето на архиватора)"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
||
msgid "Supports pac&king in memory"
|
||
msgstr "Поддръжка на сбиване в &паметта"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
||
msgid "Can &modify existing archives"
|
||
msgstr "Възможна е про&мяната на съществуващи архиви"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
||
msgid "&Archive can contain multiple files"
|
||
msgstr "Архивът може да съдържа &много файлове"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_new.caption
|
||
msgid "Can create new archi&ves"
|
||
msgstr "Възможно е създаването на &нови архиви"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_options.caption
|
||
msgid "S&upports the options dialogbox"
|
||
msgstr "Поддръжка на &питащ прозорец с възможности"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
||
msgid "Allow searchin&g for text in archives"
|
||
msgstr "Позволяване на &търсене на текст в архиви"
|
||
|
||
#: tfrmtweakplugin.lbldescription.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
|
||
msgid "&Description:"
|
||
msgstr "О&писание:"
|
||
|
||
#: tfrmtweakplugin.lbldetectstr.caption
|
||
msgid "D&etect string:"
|
||
msgstr "Раз&познавателен низ:"
|
||
|
||
#: tfrmtweakplugin.lblextension.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
|
||
msgid "&Extension:"
|
||
msgstr "Раз&ширение:"
|
||
|
||
#: tfrmtweakplugin.lblflags.caption
|
||
msgid "Flags:"
|
||
msgstr "Знамена:"
|
||
|
||
#: tfrmtweakplugin.lblname.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
|
||
msgid "&Name:"
|
||
msgstr "&Име"
|
||
|
||
#: tfrmtweakplugin.lblplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "&Приставка:"
|
||
|
||
#: tfrmtweakplugin.lblplugin2.caption
|
||
msgctxt "tfrmtweakplugin.lblplugin2.caption"
|
||
msgid "&Plugin:"
|
||
msgstr "&Приставка:"
|
||
|
||
#: tfrmviewer.actabout.caption
|
||
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
|
||
msgid "About Viewer..."
|
||
msgstr "За прегледа..."
|
||
|
||
#: tfrmviewer.actabout.hint
|
||
msgid "Displays the About message"
|
||
msgstr "Показване на прозорец „За приложението‟"
|
||
|
||
#: tfrmviewer.actchangeencoding.caption
|
||
msgid "Change encoding"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actcopyfile.caption
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
||
msgid "Copy File"
|
||
msgstr "Презапис на файла"
|
||
|
||
#: tfrmviewer.actcopyfile.hint
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
||
msgid "Copy File"
|
||
msgstr "Презапис на файла"
|
||
|
||
#: tfrmviewer.actcopytoclipboard.caption
|
||
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
||
msgid "Copy To Clipboard"
|
||
msgstr "Запомняне в кошницата"
|
||
|
||
#: tfrmviewer.actcopytoclipboardformatted.caption
|
||
msgid "Copy To Clipboard Formatted"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actdeletefile.caption
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
||
msgid "Delete File"
|
||
msgstr "Изтриване на файла"
|
||
|
||
#: tfrmviewer.actdeletefile.hint
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
||
msgid "Delete File"
|
||
msgstr "Изтриване на файла"
|
||
|
||
#: tfrmviewer.actexitviewer.caption
|
||
msgctxt "tfrmviewer.actexitviewer.caption"
|
||
msgid "E&xit"
|
||
msgstr "Из&ход"
|
||
|
||
#: tfrmviewer.actfind.caption
|
||
msgctxt "tfrmviewer.actfind.caption"
|
||
msgid "Find"
|
||
msgstr "Търсене"
|
||
|
||
#: tfrmviewer.actfindnext.caption
|
||
msgctxt "tfrmviewer.actfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Намиране на следващото"
|
||
|
||
#: tfrmviewer.actfindprev.caption
|
||
msgctxt "tfrmviewer.actfindprev.caption"
|
||
msgid "Find previous"
|
||
msgstr "Намиране на предходна поява"
|
||
|
||
#: tfrmviewer.actfullscreen.caption
|
||
msgctxt "tfrmviewer.actfullscreen.caption"
|
||
msgid "Full Screen"
|
||
msgstr "Цял екран"
|
||
|
||
#: tfrmviewer.actimagecenter.caption
|
||
msgctxt "tfrmviewer.actimagecenter.caption"
|
||
msgid "Center"
|
||
msgstr "В средата на прозореца"
|
||
|
||
#: tfrmviewer.actloadnextfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
|
||
msgid "&Next"
|
||
msgstr "На&пред"
|
||
|
||
#: tfrmviewer.actloadnextfile.hint
|
||
msgid "Load Next File"
|
||
msgstr "Зареждане на следващия файл"
|
||
|
||
#: tfrmviewer.actloadprevfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
|
||
msgid "&Previous"
|
||
msgstr "На&зад"
|
||
|
||
#: tfrmviewer.actloadprevfile.hint
|
||
msgid "Load Previous File"
|
||
msgstr "Зареждане на предходния файл"
|
||
|
||
#: tfrmviewer.actmirrorhorz.caption
|
||
msgid "Mirror Horizontally"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actmirrorhorz.hint
|
||
msgctxt "tfrmviewer.actmirrorhorz.hint"
|
||
msgid "Mirror"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actmirrorvert.caption
|
||
msgid "Mirror Vertically"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actmovefile.caption
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
||
msgid "Move File"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actmovefile.hint
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
||
msgid "Move File"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actpreview.caption
|
||
msgctxt "tfrmviewer.actpreview.caption"
|
||
msgid "Preview"
|
||
msgstr "Преглед"
|
||
|
||
#: tfrmviewer.actreload.caption
|
||
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
||
msgid "Reload"
|
||
msgstr "Презареждане"
|
||
|
||
#: tfrmviewer.actreload.hint
|
||
msgid "Reload current file"
|
||
msgstr "Презареждане на текущия файл"
|
||
|
||
#: tfrmviewer.actrotate180.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
|
||
msgid "+ 180"
|
||
msgstr "+180"
|
||
|
||
#: tfrmviewer.actrotate180.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
|
||
msgid "Rotate 180 degrees"
|
||
msgstr "Завъртане на 180 °"
|
||
|
||
#: tfrmviewer.actrotate270.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
|
||
msgid "- 90"
|
||
msgstr "-90"
|
||
|
||
#: tfrmviewer.actrotate270.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
|
||
msgid "Rotate -90 degrees"
|
||
msgstr "Завъртане на -90 °"
|
||
|
||
#: tfrmviewer.actrotate90.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
|
||
msgid "+ 90"
|
||
msgstr "+90"
|
||
|
||
#: tfrmviewer.actrotate90.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
|
||
msgid "Rotate +90 degrees"
|
||
msgstr "Завъртане на +90 °"
|
||
|
||
#: tfrmviewer.actsave.caption
|
||
msgctxt "tfrmviewer.actsave.caption"
|
||
msgid "Save"
|
||
msgstr "Съхраняване"
|
||
|
||
#: tfrmviewer.actsaveas.caption
|
||
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
|
||
msgid "Save As..."
|
||
msgstr "Съхраняване като..."
|
||
|
||
#: tfrmviewer.actsaveas.hint
|
||
msgid "Save File As..."
|
||
msgstr "Съхраняване на файла като..."
|
||
|
||
#: tfrmviewer.actscreenshot.caption
|
||
msgctxt "tfrmviewer.actscreenshot.caption"
|
||
msgid "Screenshot"
|
||
msgstr "Снимка на екрана"
|
||
|
||
#: tfrmviewer.actscreenshotdelay3sec.caption
|
||
msgid "Delay 3 sec"
|
||
msgstr "Забавяне 3 секунди"
|
||
|
||
#: tfrmviewer.actscreenshotdelay5sec.caption
|
||
msgid "Delay 5 sec"
|
||
msgstr "Забавяне 5 секунди"
|
||
|
||
#: tfrmviewer.actselectall.caption
|
||
msgctxt "tfrmviewer.actselectall.caption"
|
||
msgid "Select All"
|
||
msgstr "Избор на всички"
|
||
|
||
#: tfrmviewer.actshowasbin.caption
|
||
msgctxt "tfrmviewer.actshowasbin.caption"
|
||
msgid "Show as &Bin"
|
||
msgstr "&Двоично изобразяване"
|
||
|
||
#: tfrmviewer.actshowasbook.caption
|
||
msgctxt "tfrmviewer.actshowasbook.caption"
|
||
msgid "Show as B&ook"
|
||
msgstr "Изобразяване като &книга"
|
||
|
||
#: tfrmviewer.actshowasdec.caption
|
||
msgid "Show as &Dec"
|
||
msgstr "Изобразяване като &десетични числа"
|
||
|
||
#: tfrmviewer.actshowashex.caption
|
||
msgctxt "tfrmviewer.actshowashex.caption"
|
||
msgid "Show as &Hex"
|
||
msgstr "&Шестнадесетично изобразяване"
|
||
|
||
#: tfrmviewer.actshowastext.caption
|
||
msgctxt "tfrmviewer.actshowastext.caption"
|
||
msgid "Show as &Text"
|
||
msgstr "&Словесно изобразяване"
|
||
|
||
#: tfrmviewer.actshowaswraptext.caption
|
||
msgctxt "tfrmviewer.actshowaswraptext.caption"
|
||
msgid "Show as &Wrap text"
|
||
msgstr "Изобразяване като &редоделен текст"
|
||
|
||
#: tfrmviewer.actshowgraphics.caption
|
||
msgctxt "tfrmviewer.actshowgraphics.caption"
|
||
msgid "Graphics"
|
||
msgstr "Графики"
|
||
|
||
#: tfrmviewer.actshowplugins.caption
|
||
msgctxt "tfrmviewer.actshowplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Приставки"
|
||
|
||
#: tfrmviewer.actstretchimage.caption
|
||
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
|
||
msgid "Stretch"
|
||
msgstr "Разпъване"
|
||
|
||
#: tfrmviewer.actstretchimage.hint
|
||
msgid "Stretch Image"
|
||
msgstr "Разпъване на изображението"
|
||
|
||
#: tfrmviewer.actstretchonlylarge.caption
|
||
msgctxt "tfrmviewer.actstretchonlylarge.caption"
|
||
msgid "Stretch only large"
|
||
msgstr "Разпъване само на големите изображения"
|
||
|
||
#: tfrmviewer.actzoom.caption
|
||
msgid "Zoom"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actzoomin.caption
|
||
msgctxt "tfrmviewer.actzoomin.caption"
|
||
msgid "Zoom In"
|
||
msgstr "Увеличаване"
|
||
|
||
#: tfrmviewer.actzoomout.caption
|
||
msgctxt "tfrmviewer.actzoomout.caption"
|
||
msgid "Zoom Out"
|
||
msgstr "Смаляване"
|
||
|
||
#: tfrmviewer.btncuttuimage.hint
|
||
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
|
||
msgid "Crop"
|
||
msgstr "Орязване"
|
||
|
||
#: tfrmviewer.btnfullscreen.hint
|
||
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
||
msgid "Full Screen"
|
||
msgstr "Цял екран"
|
||
|
||
#: tfrmviewer.btngifmove.caption
|
||
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmviewer.btngiftobmp.caption
|
||
msgid "S"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.btnhightlight.hint
|
||
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
||
msgid "Highlight"
|
||
msgstr "Изтъкване"
|
||
|
||
#: tfrmviewer.btnnextgifframe.caption
|
||
msgid "||>"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.btnpaint.hint
|
||
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
||
msgid "Paint"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.btnprevgifframe.caption
|
||
msgid "<||"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.btnredeye.hint
|
||
msgid "Red Eyes"
|
||
msgstr "Червени очи"
|
||
|
||
#: tfrmviewer.btnresize.hint
|
||
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
|
||
msgid "Resize"
|
||
msgstr "Преоразмеряване"
|
||
|
||
#: tfrmviewer.btnundo.hint
|
||
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Отмяна"
|
||
|
||
#: tfrmviewer.caption
|
||
msgctxt "tfrmviewer.caption"
|
||
msgid "Viewer"
|
||
msgstr "Преглед"
|
||
|
||
#: tfrmviewer.cbslideshow.caption
|
||
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.comboboxpaint.text
|
||
msgid "Pen"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.comboboxwidth.text
|
||
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmviewer.gboxhightlight.caption
|
||
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
||
msgid "Highlight"
|
||
msgstr "Изтъкване"
|
||
|
||
#: tfrmviewer.gboxpaint.caption
|
||
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
||
msgid "Paint"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.gboxslideshow.caption
|
||
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.gboxview.caption
|
||
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Преглед"
|
||
|
||
#: tfrmviewer.lblhightlight.caption
|
||
msgid "0x0"
|
||
msgstr "0x0"
|
||
|
||
#: tfrmviewer.miabout.caption
|
||
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "За"
|
||
|
||
#: tfrmviewer.miedit.caption
|
||
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Обработка"
|
||
|
||
#: tfrmviewer.miencoding.caption
|
||
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "&Знаков набор"
|
||
|
||
#: tfrmviewer.mifile.caption
|
||
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmviewer.miimage.caption
|
||
msgid "&Image"
|
||
msgstr "Из&ображение"
|
||
|
||
#: tfrmviewer.miprint.caption
|
||
msgid "Print..."
|
||
msgstr "Разпечатване..."
|
||
|
||
#: tfrmviewer.mirotate.caption
|
||
msgid "Rotate"
|
||
msgstr "Завъртане"
|
||
|
||
#: tfrmviewer.miscreenshot.caption
|
||
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
||
msgid "Screenshot"
|
||
msgstr "Снимка на екрана"
|
||
|
||
#: tfrmviewer.miview.caption
|
||
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
||
msgid "&View"
|
||
msgstr "&Преглед"
|
||
|
||
#: tfrmviewer.pmiselectall.caption
|
||
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Избор на всички"
|
||
|
||
#: tfrmviewoperations.btnstartpause.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.btnstartpause.caption"
|
||
msgid "&Start"
|
||
msgstr "&Начало"
|
||
|
||
#: tfrmviewoperations.btnstop.caption
|
||
msgid "S&top"
|
||
msgstr ""
|
||
|
||
#: tfrmviewoperations.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.caption"
|
||
msgid "File operations"
|
||
msgstr "Действия с файлове"
|
||
|
||
#: tfrmviewoperations.cbalwaysontop.caption
|
||
msgid "Always on top"
|
||
msgstr ""
|
||
|
||
#: tfrmviewoperations.lblusedragdrop.caption
|
||
msgid "&Use \"drag && drop\" to move operations between queues"
|
||
msgstr ""
|
||
|
||
#: tfrmviewoperations.mnucanceloperation.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
|
||
msgid "Cancel"
|
||
msgstr "Отказ"
|
||
|
||
#: tfrmviewoperations.mnucancelqueue.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
|
||
msgid "Cancel"
|
||
msgstr "Отказ"
|
||
|
||
#: tfrmviewoperations.mnunewqueue.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnunewqueue.caption"
|
||
msgid "New queue"
|
||
msgstr "Нова опашка"
|
||
|
||
#: tfrmviewoperations.mnuoperationshowdetached.caption
|
||
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
|
||
msgid "Show in detached window"
|
||
msgstr ""
|
||
|
||
#: tfrmviewoperations.mnuputfirstinqueue.caption
|
||
msgid "Put first in queue"
|
||
msgstr ""
|
||
|
||
#: tfrmviewoperations.mnuputlastinqueue.caption
|
||
msgid "Put last in queue"
|
||
msgstr ""
|
||
|
||
#: tfrmviewoperations.mnuqueue.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnuqueue.caption"
|
||
msgid "Queue"
|
||
msgstr "Опашка"
|
||
|
||
#: tfrmviewoperations.mnuqueue0.caption
|
||
msgid "Out of queue"
|
||
msgstr ""
|
||
|
||
#: tfrmviewoperations.mnuqueue1.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnuqueue1.caption"
|
||
msgid "Queue 1"
|
||
msgstr "Опашка 1"
|
||
|
||
#: tfrmviewoperations.mnuqueue2.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnuqueue2.caption"
|
||
msgid "Queue 2"
|
||
msgstr "Опашка 2"
|
||
|
||
#: tfrmviewoperations.mnuqueue3.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnuqueue3.caption"
|
||
msgid "Queue 3"
|
||
msgstr "Опашка 3"
|
||
|
||
#: tfrmviewoperations.mnuqueue4.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnuqueue4.caption"
|
||
msgid "Queue 4"
|
||
msgstr "Опашка 4"
|
||
|
||
#: tfrmviewoperations.mnuqueue5.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmviewoperations.mnuqueue5.caption"
|
||
msgid "Queue 5"
|
||
msgstr "Опашка 5"
|
||
|
||
#: tfrmviewoperations.mnuqueueshowdetached.caption
|
||
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
|
||
msgid "Show in detached window"
|
||
msgstr ""
|
||
|
||
#: tfrmviewoperations.tbpauseall.caption
|
||
msgid "&Pause all"
|
||
msgstr ""
|
||
|
||
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Когато файлът съществува"
|
||
|
||
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Когато файлът съществува"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Презапис на &времето и датата"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
||
msgid "Work in background (separate connection)"
|
||
msgstr ""
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Когато файлът съществува"
|
||
|
||
#: uexifreader.rsdatetimeoriginal
|
||
msgid "Date taken"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsimageheight
|
||
msgctxt "uexifreader.rsimageheight"
|
||
msgid "Height"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsimagewidth
|
||
#, fuzzy
|
||
msgctxt "uexifreader.rsimagewidth"
|
||
msgid "Width"
|
||
msgstr "Ширина"
|
||
|
||
#: uexifreader.rsmake
|
||
msgid "Manufacturer"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsmodel
|
||
msgid "Camera model"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsorientation
|
||
msgid "Orientation"
|
||
msgstr ""
|
||
|
||
#: ulng.msgtrytolocatecrcfile
|
||
msgid ""
|
||
"This file cannot be found and could help to validate final combination of files:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Could you make it available and press \"OK\" when ready,\n"
|
||
"or press \"CANCEL\" to continue without it?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rscancelfilter
|
||
msgid "Cancel Quick Filter"
|
||
msgstr ""
|
||
|
||
#: ulng.rscanceloperation
|
||
msgid "Cancel Current Operation"
|
||
msgstr "Отмяна на текущото действие"
|
||
|
||
#: ulng.rscaptionforaskingfilename
|
||
msgid "Enter filename, with extension, for dropped text"
|
||
msgstr ""
|
||
|
||
#: ulng.rscaptionfortextformattoimport
|
||
msgid "Text format to import"
|
||
msgstr ""
|
||
|
||
#: ulng.rschecksumverifybroken
|
||
msgid "Broken:"
|
||
msgstr ""
|
||
|
||
#: ulng.rschecksumverifygeneral
|
||
msgid "General:"
|
||
msgstr ""
|
||
|
||
#: ulng.rschecksumverifymissing
|
||
msgid "Missing:"
|
||
msgstr "Липсващи:"
|
||
|
||
#: ulng.rschecksumverifyreaderror
|
||
msgid "Read error:"
|
||
msgstr ""
|
||
|
||
#: ulng.rschecksumverifysuccess
|
||
msgid "Success:"
|
||
msgstr ""
|
||
|
||
#: ulng.rschecksumverifytext
|
||
msgid "Enter checksum and select algorithm:"
|
||
msgstr ""
|
||
|
||
#: ulng.rschecksumverifytitle
|
||
msgid "Verify checksum"
|
||
msgstr ""
|
||
|
||
#: ulng.rschecksumverifytotal
|
||
msgid "Total:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsclearfiltersornot
|
||
msgid "Do you want to clear filters for this new search?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
||
msgid "Clipboard doesn't contain any valid toolbar data."
|
||
msgstr ""
|
||
|
||
#: ulng.rscmdcategorylistinorder
|
||
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
||
msgstr ""
|
||
|
||
#: ulng.rscmdkindofsort
|
||
msgid "Legacy sorted;A-Z sorted"
|
||
msgstr ""
|
||
|
||
#: ulng.rscolattr
|
||
msgid "Attr"
|
||
msgstr "Принад"
|
||
|
||
#: ulng.rscoldate
|
||
msgctxt "ulng.rscoldate"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: ulng.rscolext
|
||
msgid "Ext"
|
||
msgstr "Разш"
|
||
|
||
#: ulng.rscolname
|
||
msgctxt "ulng.rscolname"
|
||
msgid "Name"
|
||
msgstr "Име"
|
||
|
||
#: ulng.rscolsize
|
||
msgctxt "ulng.rscolsize"
|
||
msgid "Size"
|
||
msgstr "Размер"
|
||
|
||
#: ulng.rsconfcolalign
|
||
msgid "Align"
|
||
msgstr "Подравняване"
|
||
|
||
#: ulng.rsconfcolcaption
|
||
msgid "Caption"
|
||
msgstr "Надпис"
|
||
|
||
#: ulng.rsconfcoldelete
|
||
msgctxt "ulng.rsconfcoldelete"
|
||
msgid "Delete"
|
||
msgstr "Изтриване"
|
||
|
||
#: ulng.rsconfcolfieldcont
|
||
msgid "Field contents"
|
||
msgstr "Съдържание на полето"
|
||
|
||
#: ulng.rsconfcolmove
|
||
msgctxt "ulng.rsconfcolmove"
|
||
msgid "Move"
|
||
msgstr "Преместване"
|
||
|
||
#: ulng.rsconfcolwidth
|
||
msgctxt "ulng.rsconfcolwidth"
|
||
msgid "Width"
|
||
msgstr "Ширина"
|
||
|
||
#: ulng.rsconfcustheader
|
||
msgid "Customize column"
|
||
msgstr "Нагласяване на стълбове:"
|
||
|
||
#: ulng.rsconfigurationfileassociation
|
||
msgid "Configure file association"
|
||
msgstr ""
|
||
|
||
#: ulng.rsconfirmexecution
|
||
msgid "Confirming command line and parameters"
|
||
msgstr ""
|
||
|
||
#: ulng.rscopynametemplate
|
||
msgid "Copy (%d) %s"
|
||
msgstr "Презапис (%d) %s"
|
||
|
||
#: ulng.rsdefaultimporteddctoolbarhint
|
||
msgid "Imported DC toolbar"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultimportedtctoolbarhint
|
||
msgid "Imported TC toolbar"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtext
|
||
msgid "_DroppedText"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
||
msgid "_DroppedHTMLtext"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
||
msgid "_DroppedRichtext"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
||
msgid "_DroppedSimpleText"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
||
msgid "_DroppedUnicodeUTF16text"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
||
msgid "_DroppedUnicodeUTF8text"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdiffadds
|
||
msgid " Adds: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsdiffdeletes
|
||
msgid " Deletes: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsdifffilesidentical
|
||
msgid "The two files are identical!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdiffmatches
|
||
msgid " Matches: "
|
||
msgstr " Съвпадения: "
|
||
|
||
#: ulng.rsdiffmodifies
|
||
msgid " Modifies: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsdlgbuttonabort
|
||
msgid "Ab&ort"
|
||
msgstr "&Отказ"
|
||
|
||
#: ulng.rsdlgbuttonall
|
||
msgctxt "ulng.rsdlgbuttonall"
|
||
msgid "A&ll"
|
||
msgstr "Всички"
|
||
|
||
#: ulng.rsdlgbuttonappend
|
||
msgid "A&ppend"
|
||
msgstr "&Довършване"
|
||
|
||
#: ulng.rsdlgbuttonautorenamesource
|
||
msgid "A&uto-rename source files"
|
||
msgstr "Само&преименуване на целевите файлове"
|
||
|
||
#: ulng.rsdlgbuttoncancel
|
||
msgctxt "ulng.rsdlgbuttoncancel"
|
||
msgid "&Cancel"
|
||
msgstr "&Отказ"
|
||
|
||
#: ulng.rsdlgbuttoncompare
|
||
msgid "Compare &by content"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdlgbuttoncontinue
|
||
msgid "&Continue"
|
||
msgstr "&Продължаване"
|
||
|
||
#: ulng.rsdlgbuttoncopyinto
|
||
#, fuzzy
|
||
#| msgid "Copy &Into"
|
||
msgid "&Merge"
|
||
msgstr "За&мяна"
|
||
|
||
#: ulng.rsdlgbuttoncopyintoall
|
||
#, fuzzy
|
||
#| msgid "Copy Into &All"
|
||
msgid "Mer&ge All"
|
||
msgstr "Замяна на вси&чки"
|
||
|
||
#: ulng.rsdlgbuttonexitprogram
|
||
msgid "E&xit program"
|
||
msgstr "Из&ход от приложението"
|
||
|
||
#: ulng.rsdlgbuttonignore
|
||
msgid "Ig&nore"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdlgbuttonignoreall
|
||
msgid "I&gnore All"
|
||
msgstr "Прене&брегване на всички"
|
||
|
||
#: ulng.rsdlgbuttonno
|
||
msgid "&No"
|
||
msgstr "&Не"
|
||
|
||
#: ulng.rsdlgbuttonnone
|
||
msgid "Non&e"
|
||
msgstr "&Няма"
|
||
|
||
#: ulng.rsdlgbuttonok
|
||
msgctxt "ulng.rsdlgbuttonok"
|
||
msgid "&OK"
|
||
msgstr "&Добре"
|
||
|
||
#: ulng.rsdlgbuttonother
|
||
msgid "Ot&her"
|
||
msgstr "&Други"
|
||
|
||
#: ulng.rsdlgbuttonoverwrite
|
||
msgid "&Overwrite"
|
||
msgstr "&Замяна"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteall
|
||
msgid "Overwrite &All"
|
||
msgstr "Замяна &Всички"
|
||
|
||
#: ulng.rsdlgbuttonoverwritelarger
|
||
msgid "Overwrite All &Larger"
|
||
msgstr "Замяна на всички по-&големи"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteolder
|
||
msgid "Overwrite All Ol&der"
|
||
msgstr "Замяна на всички по-&стари"
|
||
|
||
#: ulng.rsdlgbuttonoverwritesmaller
|
||
msgid "Overwrite All S&maller"
|
||
msgstr "Замяна на всички по-&малки"
|
||
|
||
#: ulng.rsdlgbuttonrename
|
||
msgctxt "ulng.rsdlgbuttonrename"
|
||
msgid "R&ename"
|
||
msgstr "Пре&именуване"
|
||
|
||
#: ulng.rsdlgbuttonresume
|
||
msgid "&Resume"
|
||
msgstr "Под&новяване"
|
||
|
||
#: ulng.rsdlgbuttonretry
|
||
msgid "Re&try"
|
||
msgstr "Нов &опит"
|
||
|
||
#: ulng.rsdlgbuttonretryadmin
|
||
msgid "As Ad&ministrator"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdlgbuttonskip
|
||
msgid "&Skip"
|
||
msgstr "&Пропускане"
|
||
|
||
#: ulng.rsdlgbuttonskipall
|
||
msgid "S&kip All"
|
||
msgstr "П&ропускане на всички"
|
||
|
||
#: ulng.rsdlgbuttonunlock
|
||
msgid "&Unlock"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdlgbuttonyes
|
||
msgid "&Yes"
|
||
msgstr "&Да"
|
||
|
||
#: ulng.rsdlgcp
|
||
msgctxt "ulng.rsdlgcp"
|
||
msgid "Copy file(s)"
|
||
msgstr "Презапис на на файл(ове)"
|
||
|
||
#: ulng.rsdlgmv
|
||
msgid "Move file(s)"
|
||
msgstr "Преместване на на файл(ове)"
|
||
|
||
#: ulng.rsdlgoppause
|
||
msgctxt "ulng.rsdlgoppause"
|
||
msgid "Pau&se"
|
||
msgstr "За&държане"
|
||
|
||
#: ulng.rsdlgopstart
|
||
msgctxt "ulng.rsdlgopstart"
|
||
msgid "&Start"
|
||
msgstr "&Начало"
|
||
|
||
#: ulng.rsdlgqueue
|
||
msgctxt "ulng.rsdlgqueue"
|
||
msgid "Queue"
|
||
msgstr "Опашка"
|
||
|
||
#: ulng.rsdlgspeed
|
||
msgid "Speed %s/s"
|
||
msgstr "Скорост %s/s"
|
||
|
||
#: ulng.rsdlgspeedtime
|
||
msgid "Speed %s/s, time remaining %s"
|
||
msgstr "Скорост %s/s, оставащо време %s"
|
||
|
||
#: ulng.rsdraganddroptextformat
|
||
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdrivenolabel
|
||
msgid "<no label>"
|
||
msgstr "<няма етикет>"
|
||
|
||
#: ulng.rsdrivenomedia
|
||
msgid "<no media>"
|
||
msgstr "<няма носител>"
|
||
|
||
#: ulng.rseditabouttext
|
||
msgid "Internal Editor of Double Commander."
|
||
msgstr "Вътрешният преглед на Double Commander."
|
||
|
||
#: ulng.rseditgotolinequery
|
||
msgid "Goto line:"
|
||
msgstr "Отиване на ред:"
|
||
|
||
#: ulng.rseditgotolinetitle
|
||
msgctxt "ulng.rseditgotolinetitle"
|
||
msgid "Goto Line"
|
||
msgstr "Отиване на ред"
|
||
|
||
#: ulng.rseditnewfile
|
||
msgid "new.txt"
|
||
msgstr "нов.txt"
|
||
|
||
#: ulng.rseditnewfilename
|
||
msgid "Filename:"
|
||
msgstr "Файлово име:"
|
||
|
||
#: ulng.rseditnewopen
|
||
msgid "Open file"
|
||
msgstr "Отваряне на файл"
|
||
|
||
#: ulng.rseditsearchback
|
||
msgid "&Backward"
|
||
msgstr "На&зад"
|
||
|
||
#: ulng.rseditsearchcaption
|
||
msgctxt "ulng.rseditsearchcaption"
|
||
msgid "Search"
|
||
msgstr "Търсене"
|
||
|
||
#: ulng.rseditsearchfrw
|
||
msgid "&Forward"
|
||
msgstr "На&пред"
|
||
|
||
#: ulng.rseditsearchreplace
|
||
msgctxt "ulng.rseditsearchreplace"
|
||
msgid "Replace"
|
||
msgstr "Замяна"
|
||
|
||
#: ulng.rseditwithexternaleditor
|
||
msgid "with external editor"
|
||
msgstr "в външен обработчик"
|
||
|
||
#: ulng.rseditwithinternaleditor
|
||
msgid "with internal editor"
|
||
msgstr "в вътрешен обработчик"
|
||
|
||
#: ulng.rsexecuteviashell
|
||
msgctxt "ulng.rsexecuteviashell"
|
||
msgid "Execute via shell"
|
||
msgstr ""
|
||
|
||
#: ulng.rsexecuteviaterminalclose
|
||
msgctxt "ulng.rsexecuteviaterminalclose"
|
||
msgid "Execute via terminal and close"
|
||
msgstr ""
|
||
|
||
#: ulng.rsexecuteviaterminalstayopen
|
||
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfavtabspanelsideselection
|
||
msgid "Left;Right;Active;Inactive;Both;None"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfavtabssavedirhistory
|
||
msgid "No;Yes"
|
||
msgstr "Не;Да"
|
||
|
||
#: ulng.rsfilenameexportedtcbarprefix
|
||
msgid "Exported_from_DC"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfileopcopymovefileexistsoptions
|
||
msgid "Ask;Overwrite;Skip"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfileopdirectoryexistsoptions
|
||
#, fuzzy
|
||
#| msgid "Ask;Overwrite;Copy into;Skip"
|
||
msgid "Ask;Merge;Skip"
|
||
msgstr "Питане;Замяна;Презапис в;Пропускане"
|
||
|
||
#: ulng.rsfileopfileexistsoptions
|
||
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
||
msgstr "Питане;Замяна;Презапис на по-старите;Пропускане"
|
||
|
||
#: ulng.rsfileopsetpropertyerroroptions
|
||
msgctxt "ulng.rsfileopsetpropertyerroroptions"
|
||
msgid "Ask;Don't set anymore;Ignore errors"
|
||
msgstr "Питане;Да не се задава повече;Пренебрегване на грешките"
|
||
|
||
#: ulng.rsfilterstatus
|
||
msgid "FILTER"
|
||
msgstr "ПРЕСЯВАНЕ"
|
||
|
||
#: ulng.rsfinddefinetemplate
|
||
msgid "Define template"
|
||
msgstr "Задаване на шаблон"
|
||
|
||
#: ulng.rsfinddepth
|
||
msgid "%s level(s)"
|
||
msgstr "%s равнище/а"
|
||
|
||
#: ulng.rsfinddepthall
|
||
msgid "all (unlimited depth)"
|
||
msgstr "всички (неограничена дълбочина)"
|
||
|
||
#: ulng.rsfinddepthcurdir
|
||
msgid "current dir only"
|
||
msgstr "само текущата папка"
|
||
|
||
#: ulng.rsfinddirnoex
|
||
msgid "Directory %s does not exist!"
|
||
msgstr "Не съществува папка %s!"
|
||
|
||
#: ulng.rsfindfound
|
||
msgid "Found: %d"
|
||
msgstr "Намерени: %d"
|
||
|
||
#: ulng.rsfindsavetemplatecaption
|
||
msgid "Save search template"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfindsavetemplatetitle
|
||
msgid "Template name:"
|
||
msgstr "Име на шаблона:"
|
||
|
||
#: ulng.rsfindscanned
|
||
msgid "Scanned: %d"
|
||
msgstr "Обходени: %d"
|
||
|
||
#: ulng.rsfindscanning
|
||
msgid "Scanning"
|
||
msgstr "Претърсване"
|
||
|
||
#: ulng.rsfindsearchfiles
|
||
msgctxt "ulng.rsfindsearchfiles"
|
||
msgid "Find files"
|
||
msgstr "Търсене на файлове"
|
||
|
||
#: ulng.rsfindtimeofscan
|
||
msgid "Time of scan: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsfindwherebeg
|
||
msgid "Begin at"
|
||
msgstr "Начало"
|
||
|
||
#: ulng.rsfreemsg
|
||
msgid "Free %s from %s bytes"
|
||
msgstr "Свободни %s от %s байта"
|
||
|
||
#: ulng.rsfreemsgshort
|
||
msgid "%s bytes free"
|
||
msgstr "%s байта свободни"
|
||
|
||
#: ulng.rsfuncatime
|
||
msgid "Access date/time"
|
||
msgstr "Дата/време на използване"
|
||
|
||
#: ulng.rsfuncattr
|
||
msgctxt "ulng.rsfuncattr"
|
||
msgid "Attributes"
|
||
msgstr "Принадлежности"
|
||
|
||
#: ulng.rsfunccomment
|
||
msgctxt "ulng.rsfunccomment"
|
||
msgid "Comment"
|
||
msgstr "Бележка"
|
||
|
||
#: ulng.rsfunccompressedsize
|
||
msgid "Compressed size"
|
||
msgstr "Уплътнен размер"
|
||
|
||
#: ulng.rsfuncctime
|
||
msgid "Creation date/time"
|
||
msgstr "Дата/време на съзадаване"
|
||
|
||
#: ulng.rsfuncext
|
||
msgid "Extension"
|
||
msgstr "Разширение"
|
||
|
||
#: ulng.rsfuncgroup
|
||
msgctxt "ulng.rsfuncgroup"
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: ulng.rsfunchtime
|
||
msgid "Change date/time"
|
||
msgstr "Промяна на дата/време"
|
||
|
||
#: ulng.rsfunclinkto
|
||
msgid "Link to"
|
||
msgstr "Връзка към"
|
||
|
||
#: ulng.rsfuncmtime
|
||
msgid "Modification date/time"
|
||
msgstr "Дата/време на промяна"
|
||
|
||
#: ulng.rsfuncname
|
||
msgctxt "ulng.rsfuncname"
|
||
msgid "Name"
|
||
msgstr "Име"
|
||
|
||
#: ulng.rsfuncnamenoext
|
||
msgid "Name without extension"
|
||
msgstr "Името без разширението"
|
||
|
||
#: ulng.rsfuncowner
|
||
msgctxt "ulng.rsfuncowner"
|
||
msgid "Owner"
|
||
msgstr "Собственик"
|
||
|
||
#: ulng.rsfuncpath
|
||
msgctxt "ulng.rsfuncpath"
|
||
msgid "Path"
|
||
msgstr "Път"
|
||
|
||
#: ulng.rsfuncsize
|
||
msgctxt "ulng.rsfuncsize"
|
||
msgid "Size"
|
||
msgstr "Размер"
|
||
|
||
#: ulng.rsfunctype
|
||
msgid "Type"
|
||
msgstr "Вид"
|
||
|
||
#: ulng.rsharderrcreate
|
||
msgid "Error creating hardlink."
|
||
msgstr "Грешка при създаване на твърда връзка."
|
||
|
||
#: ulng.rshotdirforcesortingorderchoices
|
||
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotdirwarningabortrestorebackup
|
||
msgid ""
|
||
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
||
"\n"
|
||
"Are you sure you want to proceed?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeycategorycopymovedialog
|
||
msgid "Copy/Move Dialog"
|
||
msgstr "Прозорец за презапис и местене"
|
||
|
||
#: ulng.rshotkeycategorydiffer
|
||
msgctxt "ulng.rshotkeycategorydiffer"
|
||
msgid "Differ"
|
||
msgstr "Сравнител"
|
||
|
||
#: ulng.rshotkeycategoryeditcommentdialog
|
||
msgid "Edit Comment Dialog"
|
||
msgstr "Прозорец за промяна на забележки"
|
||
|
||
#: ulng.rshotkeycategoryeditor
|
||
msgctxt "ulng.rshotkeycategoryeditor"
|
||
msgid "Editor"
|
||
msgstr "Обработчик"
|
||
|
||
#: ulng.rshotkeycategoryfindfiles
|
||
msgctxt "ulng.rshotkeycategoryfindfiles"
|
||
msgid "Find files"
|
||
msgstr "Търсене на файлове"
|
||
|
||
#: ulng.rshotkeycategorymain
|
||
msgid "Main"
|
||
msgstr "Основен"
|
||
|
||
#: ulng.rshotkeycategorysyncdirs
|
||
msgid "Synchronize Directories"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeycategoryviewer
|
||
msgctxt "ulng.rshotkeycategoryviewer"
|
||
msgid "Viewer"
|
||
msgstr "Преглед"
|
||
|
||
#: ulng.rshotkeyfilealreadyexists
|
||
msgid ""
|
||
"A setup with that name already exists.\n"
|
||
"Do you want to overwrite it?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfileconfirmdefault
|
||
msgid "Are you sure you want to restore default?"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfileconfirmerasure
|
||
msgid "Are you sure you want to erase setup \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilecopyof
|
||
msgid "Copy of %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfileinputnewname
|
||
msgid "Input your new name"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilemustkeepone
|
||
msgid "You must keep at least one shortcut file."
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilenewname
|
||
msgid "New name"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeyfilesavemodified
|
||
msgid ""
|
||
"\"%s\" setup has been modified.\n"
|
||
"Do you want to save it now?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeynoscenter
|
||
msgid "No shortcut with \"ENTER\""
|
||
msgstr ""
|
||
|
||
#: ulng.rshotkeysortorder
|
||
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsimporttoolbarproblem
|
||
msgid "Cannot find reference to default bar file"
|
||
msgstr ""
|
||
|
||
#: ulng.rslistoffindfileswindows
|
||
msgid "List of \"Find files\" windows"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmarkminus
|
||
msgid "Unselect mask"
|
||
msgstr "Признак за смяна на избора"
|
||
|
||
#: ulng.rsmarkplus
|
||
msgid "Select mask"
|
||
msgstr "Избор на маска"
|
||
|
||
#: ulng.rsmaskinput
|
||
msgid "Input mask:"
|
||
msgstr "Входна маска:"
|
||
|
||
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
||
msgid "A columns view with that name already exists."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmenuconfigurecolumnssavetochange
|
||
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmenuconfigurecustomcolumns
|
||
msgid "Configure custom columns"
|
||
msgstr "Настройка на нагласените стълбове"
|
||
|
||
#: ulng.rsmenuconfigureentercustomcolumnname
|
||
msgid "Enter new custom columns name"
|
||
msgstr "Задайте ново име за стълбовете"
|
||
|
||
#: ulng.rsmnuactions
|
||
msgctxt "ulng.rsmnuactions"
|
||
msgid "Actions"
|
||
msgstr "Действия"
|
||
|
||
#: ulng.rsmnucontentdefault
|
||
msgid "<Default>"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnucontentoctal
|
||
msgid "Octal"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnucopynetnamestoclip
|
||
msgid "Copy names with UNC path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnudisconnectnetworkdrive
|
||
msgid "Disconnect Network Drive..."
|
||
msgstr "Разкачане на мрежово устройство..."
|
||
|
||
#: ulng.rsmnuedit
|
||
msgctxt "ulng.rsmnuedit"
|
||
msgid "Edit"
|
||
msgstr "Обработка"
|
||
|
||
#: ulng.rsmnueject
|
||
msgid "Eject"
|
||
msgstr "Изваждане"
|
||
|
||
#: ulng.rsmnuextracthere
|
||
msgid "Extract here..."
|
||
msgstr "Извличане тук..."
|
||
|
||
#: ulng.rsmnumapnetworkdrive
|
||
msgid "Map Network Drive..."
|
||
msgstr "Прикачане на мрежово устройство..."
|
||
|
||
#: ulng.rsmnumount
|
||
msgid "Mount"
|
||
msgstr "Прикачане"
|
||
|
||
#: ulng.rsmnunew
|
||
msgctxt "ulng.rsmnunew"
|
||
msgid "New"
|
||
msgstr "Нов"
|
||
|
||
#: ulng.rsmnunomedia
|
||
msgid "No media available"
|
||
msgstr "Няма носители"
|
||
|
||
#: ulng.rsmnuopen
|
||
msgctxt "ulng.rsmnuopen"
|
||
msgid "Open"
|
||
msgstr "Отваряне"
|
||
|
||
#: ulng.rsmnuopenwith
|
||
msgctxt "ulng.rsmnuopenwith"
|
||
msgid "Open with"
|
||
msgstr "Отваряне с"
|
||
|
||
#: ulng.rsmnuopenwithother
|
||
msgctxt "ulng.rsmnuopenwithother"
|
||
msgid "Other..."
|
||
msgstr "Друго..."
|
||
|
||
#: ulng.rsmnupackhere
|
||
msgid "Pack here..."
|
||
msgstr "Сбиване на файлове тук..."
|
||
|
||
#: ulng.rsmnusortby
|
||
msgid "Sort by"
|
||
msgstr "Подреждане по"
|
||
|
||
#: ulng.rsmnuumount
|
||
msgid "Unmount"
|
||
msgstr "Разкачане"
|
||
|
||
#: ulng.rsmnuview
|
||
msgctxt "ulng.rsmnuview"
|
||
msgid "View"
|
||
msgstr "Преглед"
|
||
|
||
#: ulng.rsmsgaccount
|
||
msgid "Account:"
|
||
msgstr "Сметка:"
|
||
|
||
#: ulng.rsmsgalldcintcmds
|
||
msgid "All Double Commander internal commands"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgapplicationname
|
||
msgid "Description: %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgarchivercustomparams
|
||
msgid "Additional parameters for archiver command-line:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgaskquoteornot
|
||
msgid "Do you want to enclose between quotes?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgbadcrc32
|
||
msgid ""
|
||
"Bad CRC32 for resulting file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Do you want to keep the resulting corrupted file anyway?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgcannotcopymoveitself
|
||
msgid "You can not copy/move a file \"%s\" to itself!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgcannotdeletedirectory
|
||
msgid "Cannot delete directory %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgcannotoverwritedirectory
|
||
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgchdirfailed
|
||
msgid "Change current directory to \"%s\" failed!"
|
||
msgstr "Смяната на папката на [%s] бе неуспешно!"
|
||
|
||
#: ulng.rsmsgcloseallinactivetabs
|
||
msgid "Remove all inactive tabs?"
|
||
msgstr "Премахване на бездейните подпрозорци?"
|
||
|
||
#: ulng.rsmsgcloselockedtab
|
||
msgid "This tab (%s) is locked! Close anyway?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgcofirmuserparam
|
||
msgid "Confirmation of parameter"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgconfirmquit
|
||
msgid "Are you sure you want to quit?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgcopybackward
|
||
msgid "The file %s has changed. Do you want to copy it backward?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgcouldnotcopybackward
|
||
msgid "Could not copy backward - do you want to keep the changed file?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgcpfldr
|
||
msgid "Copy %d selected files/directories?"
|
||
msgstr "Презапис на %d избраните папки/файлове?"
|
||
|
||
#: ulng.rsmsgcpsel
|
||
msgid "Copy selected \"%s\"?"
|
||
msgstr "Да бъде ли презаписан избраният файл „%s“?"
|
||
|
||
#: ulng.rsmsgcreateanewfiletype
|
||
msgid "< Create a new file type \"%s files\" >"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgdctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a DC Toolbar file"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgdefaultcustomactionname
|
||
msgid "Custom action"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgdeletepartiallycopied
|
||
msgid "Delete the partially copied file ?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgdelfldr
|
||
msgid "Delete %d selected files/directories?"
|
||
msgstr "Да бъдат ли изтрити %d-те избрани папки/файла?"
|
||
|
||
#: ulng.rsmsgdelfldrt
|
||
msgid "Delete %d selected files/directories into trash can?"
|
||
msgstr "Да бъдат ли изтрити %d-те избрани папки/файла?"
|
||
|
||
#: ulng.rsmsgdelsel
|
||
msgid "Delete selected \"%s\"?"
|
||
msgstr "Да бъде ли изтрит избраният „%s‟?"
|
||
|
||
#: ulng.rsmsgdelselt
|
||
msgid "Delete selected \"%s\" into trash can?"
|
||
msgstr "Да бъде ли изтрит избраният „%s‟ в кошчето?"
|
||
|
||
#: ulng.rsmsgdeltotrashforce
|
||
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgdisknotavail
|
||
msgid "Disk is not available"
|
||
msgstr "Дискът не е на разположение"
|
||
|
||
#: ulng.rsmsgentercustomaction
|
||
msgid "Enter custom action name:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgenterfileext
|
||
msgid "Enter file extension:"
|
||
msgstr "Въведете разширение:"
|
||
|
||
#: ulng.rsmsgentername
|
||
msgid "Enter name:"
|
||
msgstr "Въведете име:"
|
||
|
||
#: ulng.rsmsgenternewfiletypename
|
||
msgid "Enter name of new file type to create for extension \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrbadarchive
|
||
msgid "CRC error in archive data"
|
||
msgstr "Грешка CRC в данните на архива"
|
||
|
||
#: ulng.rsmsgerrbaddata
|
||
msgid "Data is bad"
|
||
msgstr "Данните са лоши"
|
||
|
||
#: ulng.rsmsgerrcannotconnect
|
||
msgid "Can not connect to server: \"%s\""
|
||
msgstr "Неуспешно свързване към сървър: „%s‟"
|
||
|
||
#: ulng.rsmsgerrcannotcopyfile
|
||
msgid "Cannot copy file %s to %s"
|
||
msgstr "Неуспешен презапис на файл „%s‟ в „%s‟"
|
||
|
||
#: ulng.rsmsgerrcreatefiledirectoryexists
|
||
msgid "There already exists a directory named \"%s\"."
|
||
msgstr "Вече съществува папка с име „%s‟."
|
||
|
||
#: ulng.rsmsgerrdatenotsupported
|
||
msgid "Date %s is not supported"
|
||
msgstr "Не се поддържа дата %s"
|
||
|
||
#: ulng.rsmsgerrdirexists
|
||
msgid "Directory %s exists!"
|
||
msgstr "Папка %s съществува!"
|
||
|
||
#: ulng.rsmsgerreaborted
|
||
msgid "Function aborted by user"
|
||
msgstr "Действието е прекъснато от потребителя"
|
||
|
||
#: ulng.rsmsgerreclose
|
||
msgid "Error closing file"
|
||
msgstr "Грешка при затваряне на файла"
|
||
|
||
#: ulng.rsmsgerrecreate
|
||
msgid "Cannot create file"
|
||
msgstr "Създаването на файла е невъзможно"
|
||
|
||
#: ulng.rsmsgerrendarchive
|
||
msgid "No more files in archive"
|
||
msgstr "Файловете в архива свършиха"
|
||
|
||
#: ulng.rsmsgerreopen
|
||
msgid "Cannot open existing file"
|
||
msgstr "Отварянето на съществуващия файл е невъзможно"
|
||
|
||
#: ulng.rsmsgerreread
|
||
msgid "Error reading from file"
|
||
msgstr "Грешка при четене на файл"
|
||
|
||
#: ulng.rsmsgerrewrite
|
||
msgid "Error writing to file"
|
||
msgstr "Грешка при запис във файла"
|
||
|
||
#: ulng.rsmsgerrforcedir
|
||
msgid "Can not create directory %s!"
|
||
msgstr "Създаването на папка %s е невъзможно!"
|
||
|
||
#: ulng.rsmsgerrinvalidlink
|
||
msgid "Invalid link"
|
||
msgstr "Неправилна връзка"
|
||
|
||
#: ulng.rsmsgerrnofiles
|
||
msgid "No files found"
|
||
msgstr "Не са намерени файлове"
|
||
|
||
#: ulng.rsmsgerrnomemory
|
||
msgid "Not enough memory"
|
||
msgstr "Недостатъчно памет"
|
||
|
||
#: ulng.rsmsgerrnotsupported
|
||
msgid "Function not supported!"
|
||
msgstr "Действието не се поддържа!"
|
||
|
||
#: ulng.rsmsgerrorincontextmenucommand
|
||
msgid "Error in context menu command"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrorloadingconfiguration
|
||
msgid "Error when loading configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrregexpsyntax
|
||
msgid "Syntax error in regular expression!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrrename
|
||
msgid "Cannot rename file %s to %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrsaveassociation
|
||
msgid "Can not save association!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrsavefile
|
||
msgid "Cannot save file"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrsetattribute
|
||
msgid "Can not set attributes for \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrsetdatetime
|
||
msgid "Can not set date/time for \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrsetownership
|
||
msgid "Can not set owner/group for \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrsetpermissions
|
||
msgid "Can not set permissions for \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgerrsmallbuf
|
||
msgid "Buffer too small"
|
||
msgstr "Буферът е много малък"
|
||
|
||
#: ulng.rsmsgerrtoomanyfiles
|
||
msgid "Too many files to pack"
|
||
msgstr "Твърде много файлове за сбиване"
|
||
|
||
#: ulng.rsmsgerrunknownformat
|
||
msgid "Archive format unknown"
|
||
msgstr "Форматът на архива е непознат"
|
||
|
||
#: ulng.rsmsgexecutablepath
|
||
msgid "Executable: %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsdraghereentry
|
||
msgid "Drag here other entries"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsentername
|
||
msgid "Enter a name for this new Favorite Tabs entry:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsenternametitle
|
||
msgid "Saving a new Favorite Tabs entry"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
||
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsextramode
|
||
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
||
msgid "Number of file(s) imported successfully: %d on %d"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
||
msgid "Legacy tabs imported"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsimporttitle
|
||
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
||
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabssimplemode
|
||
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabssubmenuname
|
||
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
||
msgid "This will load the Favorite Tabs: \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfavortietabssaveoverexisting
|
||
msgid "Save current tabs over existing Favorite Tabs entry"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfilechangedsave
|
||
msgid "File %s changed, save?"
|
||
msgstr "Файлът %s е променен. Да бъде ли съхранен?"
|
||
|
||
#: ulng.rsmsgfileexistsfileinfo
|
||
msgid "%s bytes, %s"
|
||
msgstr "%s байта, %s"
|
||
|
||
#: ulng.rsmsgfileexistsoverwrite
|
||
msgid "Overwrite:"
|
||
msgstr "Замяна на:"
|
||
|
||
#: ulng.rsmsgfileexistsrwrt
|
||
msgid "File %s exists, overwrite?"
|
||
msgstr "Съществува файл %s. Да бъде ли заменен?"
|
||
|
||
#: ulng.rsmsgfileexistswithfile
|
||
msgid "With file:"
|
||
msgstr "С файла"
|
||
|
||
#: ulng.rsmsgfilenotfound
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Файлът \"%s\" не е открит."
|
||
|
||
#: ulng.rsmsgfileoperationsactive
|
||
msgid "File operations active"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfileoperationsactivelong
|
||
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfilepathovermaxpath
|
||
msgid ""
|
||
"The target name length (%d) is more than %d characters!\n"
|
||
"%s\n"
|
||
"Most programs will not be able to access a file/directory with such a long name!\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfilereadonly
|
||
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfilereloadwarning
|
||
msgid "Are you sure you want to reload the current file and lose the changes?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfilesizetoobig
|
||
msgid "The file size of \"%s\" is too big for destination file system!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgfolderexistsrwrt
|
||
#, fuzzy
|
||
#| msgid "Folder %s exists, overwrite?"
|
||
msgid "Folder %s exists, merge?"
|
||
msgstr "Вече съществува %s, замяна?"
|
||
|
||
#: ulng.rsmsgfollowsymlink
|
||
msgid "Follow symlink \"%s\"?"
|
||
msgstr "Следване на мека връзка \"%s\"?"
|
||
|
||
#: ulng.rsmsgfortextformattoimport
|
||
msgid "Select the text format to import"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectories
|
||
msgid "Add %d selected dirs"
|
||
msgstr "Добавяне на %dизбрани папки"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectory
|
||
msgid "Add selected dir: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdiraddthisdirectory
|
||
msgid "Add current dir: "
|
||
msgstr "Добавяне на текущата папка: "
|
||
|
||
#: ulng.rsmsghotdircommandname
|
||
msgid "Do command"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdircommandsample
|
||
msgid "cm_somthing"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirconfighotlist
|
||
msgctxt "ulng.rsmsghotdirconfighotlist"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Настройка на любимите папки"
|
||
|
||
#: ulng.rsmsghotdirdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
||
msgstr "Убеден ли сте, че искате да изтриете всички попълнения от списъка на любимите папки? Възстановяването на списъка е невъзможно! "
|
||
|
||
#: ulng.rsmsghotdirdemocommand
|
||
msgid "This will execute the following command:"
|
||
msgstr "Ще се изпълни следната заповед"
|
||
|
||
#: ulng.rsmsghotdirdemoname
|
||
msgid "This is hot dir named "
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirdemopath
|
||
msgid "This will change active frame to the following path:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirdemotarget
|
||
msgid "And inactive frame would change to the following path:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirerrorbackuping
|
||
msgid "Error backuping entries..."
|
||
msgstr "Грешка при запасяването..."
|
||
|
||
#: ulng.rsmsghotdirerrorexporting
|
||
msgid "Error exporting entries..."
|
||
msgstr "Грешка при изнасянето..."
|
||
|
||
#: ulng.rsmsghotdirexportall
|
||
msgid "Export all!"
|
||
msgstr "Изнасяне на всички"
|
||
|
||
#: ulng.rsmsghotdirexporthotlist
|
||
msgid "Export Directory Hotlist - Select the entries you want to export"
|
||
msgstr "Изнасяне на списъка с любимите папки- изберете кои да се изнесат"
|
||
|
||
#: ulng.rsmsghotdirexportsel
|
||
msgid "Export selected"
|
||
msgstr "Изнасяне на избраните"
|
||
|
||
#: ulng.rsmsghotdirimportall
|
||
msgctxt "ulng.rsmsghotdirimportall"
|
||
msgid "Import all!"
|
||
msgstr "Внасяне на всички"
|
||
|
||
#: ulng.rsmsghotdirimporthotlist
|
||
msgid "Import Directory Hotlist - Select the entries you want to import"
|
||
msgstr "Внасяне на списъка с любимите папки- изберете кои да се внесат"
|
||
|
||
#: ulng.rsmsghotdirimportsel
|
||
msgctxt "ulng.rsmsghotdirimportsel"
|
||
msgid "Import selected"
|
||
msgstr "Внасяне на избраните"
|
||
|
||
#: ulng.rsmsghotdirjustpath
|
||
#, fuzzy
|
||
#| msgid "Path"
|
||
msgctxt "ulng.rsmsghotdirjustpath"
|
||
msgid "&Path:"
|
||
msgstr "Път"
|
||
|
||
#: ulng.rsmsghotdirlocatehotlistfile
|
||
msgid "Locate \".hotlist\" file to import"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirname
|
||
msgid "Hotdir name"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirnbnewentries
|
||
msgid "Number of new entries: %d"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirnothingtoexport
|
||
msgid "Nothing selected to export!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirpath
|
||
msgid "Hotdir path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirreaddselecteddirectory
|
||
msgid "Re-Add selected dir: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirreaddthisdirectory
|
||
msgid "Re-Add current dir: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirrestorewhat
|
||
msgid "Enter location and filename of Directory Hotlist to restore"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirsimplecommand
|
||
msgctxt "ulng.rsmsghotdirsimplecommand"
|
||
msgid "Command:"
|
||
msgstr "Заповед:"
|
||
|
||
#: ulng.rsmsghotdirsimpleendofmenu
|
||
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
||
msgid "(end of sub menu)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirsimplemenu
|
||
msgctxt "ulng.rsmsghotdirsimplemenu"
|
||
msgid "Menu &name:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirsimplename
|
||
#, fuzzy
|
||
#| msgid "Name:"
|
||
msgctxt "ulng.rsmsghotdirsimplename"
|
||
msgid "&Name:"
|
||
msgstr "Име"
|
||
|
||
#: ulng.rsmsghotdirsimpleseparator
|
||
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
||
msgid "(separator)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirsubmenuname
|
||
msgctxt "ulng.rsmsghotdirsubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirtarget
|
||
msgid "Hotdir target"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirtiporderpath
|
||
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirtipordertarget
|
||
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirtipspecialdirbut
|
||
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirtotalbackuped
|
||
msgid ""
|
||
"Total entries saved: %d\n"
|
||
"\n"
|
||
"Backup filename: %s\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirtotalexported
|
||
msgid "Total entries exported: "
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirwhattodelete
|
||
msgid ""
|
||
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
||
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirwheretosave
|
||
msgid "Enter location and filename where to save a Directory Hotlist file"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgincorrectfilelength
|
||
msgid "Incorrect resulting filelength for file : \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsginsertnextdisk
|
||
msgid ""
|
||
"Please insert next disk or something similar.\n"
|
||
"\n"
|
||
"It is to allow writing this file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Number of bytes still to write: %d\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsginvalidcommandline
|
||
msgid "Error in command line"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsginvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Неправилно файлово име"
|
||
|
||
#: ulng.rsmsginvalidformatofconfigurationfile
|
||
msgid "Invalid format of configuration file"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsginvalidhexnumber
|
||
msgid "Invalid hexadecimal number: \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsginvalidpath
|
||
msgid "Invalid path"
|
||
msgstr "Неправилен път"
|
||
|
||
#: ulng.rsmsginvalidpathlong
|
||
msgid "Path %s contains forbidden characters."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsginvalidplugin
|
||
msgid "This is not a valid plugin!"
|
||
msgstr "Това не е поддържана приставка!"
|
||
|
||
#: ulng.rsmsginvalidpluginarchitecture
|
||
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsginvalidquoting
|
||
msgid "Invalid quoting"
|
||
msgstr "Неправилно цитиране"
|
||
|
||
#: ulng.rsmsginvalidselection
|
||
msgid "Invalid selection."
|
||
msgstr "Неправилно избиране"
|
||
|
||
#: ulng.rsmsgloadingfilelist
|
||
msgid "Loading file list..."
|
||
msgstr "Зареждане на списък с файлове..."
|
||
|
||
#: ulng.rsmsglocatetcconfiguation
|
||
msgid "Locate TC configuration file (wincmd.ini)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsglocatetcexecutable
|
||
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsglogcopy
|
||
msgid "Copy file %s"
|
||
msgstr "Презапис на файл %s"
|
||
|
||
#: ulng.rsmsglogdelete
|
||
msgid "Delete file %s"
|
||
msgstr "Изтриване на файл %s"
|
||
|
||
#: ulng.rsmsglogerror
|
||
msgid "Error: "
|
||
msgstr "Грешка:"
|
||
|
||
#: ulng.rsmsglogextcmdlaunch
|
||
msgid "Launch external"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsglogextcmdresult
|
||
msgid "Result external"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsglogextract
|
||
msgid "Extract file %s"
|
||
msgstr "Извличане на файл %s"
|
||
|
||
#: ulng.rsmsgloginfo
|
||
msgid "Info: "
|
||
msgstr "Сведения:"
|
||
|
||
#: ulng.rsmsgloglink
|
||
msgid "Create link %s"
|
||
msgstr "Създаване на връзка %s"
|
||
|
||
#: ulng.rsmsglogmkdir
|
||
msgid "Create directory %s"
|
||
msgstr "Създаване на папка %s"
|
||
|
||
#: ulng.rsmsglogmove
|
||
msgid "Move file %s"
|
||
msgstr "Преместване на файл %s"
|
||
|
||
#: ulng.rsmsglogpack
|
||
msgid "Pack to file %s"
|
||
msgstr "Сбиване във файл %s"
|
||
|
||
#: ulng.rsmsglogrmdir
|
||
msgid "Remove directory %s"
|
||
msgstr "Изтриване на папка %s"
|
||
|
||
#: ulng.rsmsglogsuccess
|
||
msgid "Done: "
|
||
msgstr "Готово:"
|
||
|
||
#: ulng.rsmsglogsymlink
|
||
msgid "Create symlink %s"
|
||
msgstr "Създаване на мека връзка %s"
|
||
|
||
#: ulng.rsmsglogtest
|
||
msgid "Test file integrity %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsglogwipe
|
||
msgid "Wipe file %s"
|
||
msgstr "Унищожаване на файл „%s‟"
|
||
|
||
#: ulng.rsmsglogwipedir
|
||
msgid "Wipe directory %s"
|
||
msgstr "Унищожаване на папка „%s‟"
|
||
|
||
#: ulng.rsmsgmasterpassword
|
||
msgid "Master Password"
|
||
msgstr "Главна парола"
|
||
|
||
#: ulng.rsmsgmasterpasswordenter
|
||
msgid "Please enter the master password:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgnewfile
|
||
msgid "New file"
|
||
msgstr "Нов файл"
|
||
|
||
#: ulng.rsmsgnextvolunpack
|
||
msgid "Next volume will be unpacked"
|
||
msgstr "Ще бъде разгънат следвашия том"
|
||
|
||
#: ulng.rsmsgnofiles
|
||
msgid "No files"
|
||
msgstr "Няма файлове"
|
||
|
||
#: ulng.rsmsgnofilesselected
|
||
msgid "No files selected."
|
||
msgstr "Няма избрани файлове."
|
||
|
||
#: ulng.rsmsgnofreespacecont
|
||
msgid "No enough free space on target drive, Continue?"
|
||
msgstr "Недостатъчно място на целевата папка. Да продължа ли?"
|
||
|
||
#: ulng.rsmsgnofreespaceretry
|
||
msgid "No enough free space on target drive, Retry?"
|
||
msgstr "Недостатъчно място на целевата папка. Да опитам ли пак?"
|
||
|
||
#: ulng.rsmsgnotdelete
|
||
msgid "Can not delete file %s"
|
||
msgstr "Невъзможно е изтриването на %s"
|
||
|
||
#: ulng.rsmsgnotimplemented
|
||
msgid "Not implemented."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgobjectnotexists
|
||
msgid "Object does not exist!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgopeninanotherprogram
|
||
msgid "The action cannot be completed because the file is open in another program:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgpanelpreview
|
||
msgctxt "ulng.rsmsgpanelpreview"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgpassword
|
||
msgid "Password:"
|
||
msgstr "Парола:"
|
||
|
||
#: ulng.rsmsgpassworddiff
|
||
msgid "Passwords are different!"
|
||
msgstr "Паролите не съвпадат!"
|
||
|
||
#: ulng.rsmsgpasswordenter
|
||
msgid "Please enter the password:"
|
||
msgstr "Въведете парола:"
|
||
|
||
#: ulng.rsmsgpasswordfirewall
|
||
msgid "Password (Firewall):"
|
||
msgstr "Парола (защитна стена):"
|
||
|
||
#: ulng.rsmsgpasswordverify
|
||
msgid "Please re-enter the password for verification:"
|
||
msgstr "Повторете паролата, за да я потвърдите:"
|
||
|
||
#: ulng.rsmsgpopuphotdelete
|
||
msgid "&Delete %s"
|
||
msgstr "&Изтриване на %s"
|
||
|
||
#: ulng.rsmsgpresetalreadyexists
|
||
msgid "Preset \"%s\" already exists. Overwrite?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgproblemexecutingcommand
|
||
msgid "Problem executing command (%s)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgprocessid
|
||
msgid "PID: %d"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgpromptaskingfilename
|
||
msgid "Filename for dropped text:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgprovidethisfile
|
||
msgid "Please, make this file available. Retry?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgrenamefavtabs
|
||
msgid "Enter new friendly name for this Favorite Tabs"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgrenamefavtabsmenu
|
||
msgid "Enter new name for this menu"
|
||
msgstr "Задайте ново име за този изборник"
|
||
|
||
#: ulng.rsmsgrenfldr
|
||
msgid "Rename/move %d selected files/directories?"
|
||
msgstr "Преименуване/местене на %d избраните папки/файлове?"
|
||
|
||
#: ulng.rsmsgrensel
|
||
msgid "Rename/move selected \"%s\"?"
|
||
msgstr "Преименуване/местене на избрания \"%s\"?"
|
||
|
||
#: ulng.rsmsgreplacethistext
|
||
msgid "Do you want to replace this text?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgrestartforapplychanges
|
||
msgid "Please, restart Double Commander in order to apply changes"
|
||
msgstr "Презапуснете Double Commander, за да влязат промените в сила"
|
||
|
||
#: ulng.rsmsgsekectfiletype
|
||
msgid "Select to which file type to add extension \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgselectedinfo
|
||
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
||
msgstr "Избрани: %s от %s, файлове: %d от %d, папки: %d от %d"
|
||
|
||
#: ulng.rsmsgselectexecutablefile
|
||
msgid "Select executable file for"
|
||
msgstr "Избиране на изпълним файл за"
|
||
|
||
#: ulng.rsmsgselectonlychecksumfiles
|
||
msgid "Please select only checksum files!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgsellocnextvol
|
||
msgid "Please select location of next volume"
|
||
msgstr "Посочете местоположението на следващия том"
|
||
|
||
#: ulng.rsmsgsetvolumelabel
|
||
msgid "Set volume label"
|
||
msgstr "Слагане име на тома"
|
||
|
||
#: ulng.rsmsgspecialdir
|
||
msgid "Special Dirs"
|
||
msgstr "Особени папки"
|
||
|
||
#: ulng.rsmsgspecialdiraddacti
|
||
msgid "Add path from active frame"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdiraddnonacti
|
||
msgid "Add path from inactive frame"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirbrowssel
|
||
msgid "Browse and use selected path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirenvvar
|
||
msgid "Use environment variable..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirgotodc
|
||
msgid "Go to Double Commander special path..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirgotoenvvar
|
||
msgid "Go to environment variable..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirgotoother
|
||
msgid "Go to other Windows special folder..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirgototc
|
||
msgid "Go to Windows special folder (TC)..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirmakereltohotdir
|
||
msgid "Make relative to hotdir path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirmkabso
|
||
msgid "Make path absolute"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirmkdcrel
|
||
msgid "Make relative to Double Commander special path..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirmkenvrel
|
||
msgid "Make relative to environment variable..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirmktctel
|
||
msgid "Make relative to Windows special folder (TC)..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirmkwnrel
|
||
msgid "Make relative to other Windows special folder..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirusedc
|
||
msgid "Use Double Commander special path..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirusehotdir
|
||
msgid "Use hotdir path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdiruseother
|
||
msgid "Use other Windows special folder..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgspecialdirusetc
|
||
msgid "Use Windows special folder (TC)..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtabforopeninginnewtab
|
||
msgid "This tab (%s) is locked! Open directory in another tab?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtabrenamecaption
|
||
msgid "Rename tab"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtabrenameprompt
|
||
msgid "New tab name:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtargetdir
|
||
msgid "Target path:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtcconfignotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration file:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtcexecutablenotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration executable:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtcisrunning
|
||
msgid ""
|
||
"Error! TC is still running but it should be closed for this operation.\n"
|
||
"Close it and press OK or press CANCEL to abort.\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtctoolbarnotfound
|
||
msgid ""
|
||
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a TC Toolbar file"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgterminateprocess
|
||
msgid "WARNING: Terminating a process can cause undesired results including loss of data and system instability. The process will not be given the chance to save its state or data before it is terminated. Are you sure you want to terminate the process?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgthisisnowinclipboard
|
||
msgid "\"%s\" is now in the clipboard"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtitleextnotinfiletype
|
||
msgid "Extension of selected file is not in any recognized file types"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
||
msgid "Locate \".toolbar\" file to import"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
||
msgid "Locate \".BAR\" file to import"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtoolbarrestorewhat
|
||
msgid "Enter location and filename of Toolbar to restore"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtoolbarsaved
|
||
msgid ""
|
||
"Saved!\n"
|
||
"Toolbar filename: %s\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgtoomanyfilesselected
|
||
msgid "Too many files selected."
|
||
msgstr "Избрани са прекалено много файлове"
|
||
|
||
#: ulng.rsmsgundeterminednumberoffile
|
||
msgid "Undetermined"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
||
msgid "ERROR: Unexpected Tree View Menu usage!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgurl
|
||
msgid "URL:"
|
||
msgstr "URL:"
|
||
|
||
#: ulng.rsmsguserdidnotsetextension
|
||
msgid "<NO EXT>"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsguserdidnotsetname
|
||
msgid "<NO NAME>"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgusername
|
||
msgid "User name:"
|
||
msgstr "Потребителско име:"
|
||
|
||
#: ulng.rsmsgusernamefirewall
|
||
msgid "User name (Firewall):"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgverify
|
||
msgid "VERIFICATION:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgverifychecksum
|
||
msgid "Do you want to verify selected checksums?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgverifywrong
|
||
msgid "The target file is corrupted, checksum mismatch!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgvolumelabel
|
||
msgid "Volume label:"
|
||
msgstr "Етикет на тома:"
|
||
|
||
#: ulng.rsmsgvolumesizeenter
|
||
msgid "Please enter the volume size:"
|
||
msgstr "Въведете размер на тома:"
|
||
|
||
#: ulng.rsmsgwipefldr
|
||
msgid "Wipe %d selected files/directories?"
|
||
msgstr "Унищожаване на %d избрани файла/папки?"
|
||
|
||
#: ulng.rsmsgwipesel
|
||
msgid "Wipe selected \"%s\"?"
|
||
msgstr "Унищожаване на избрания „%s‟?"
|
||
|
||
#: ulng.rsmsgwithactionwith
|
||
msgid "with"
|
||
msgstr "с"
|
||
|
||
#: ulng.rsmsgwrongpasswordtryagain
|
||
msgid ""
|
||
"Wrong password!\n"
|
||
"Please try again!\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmulrenautorename
|
||
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmulrenfilenamestylelist
|
||
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
||
msgstr "Без промяна; ВИСША; низша; Първият знак главен; Първият Знак На Всяка Дума Главен;"
|
||
|
||
#: ulng.rsmulrenwarningduplicate
|
||
msgid "Warning, duplicate names!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmulrenwronglinesnumber
|
||
msgid "File contains wrong number of lines: %d, should be %d!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsnewsearchclearfilteroptions
|
||
msgid "Keep;Clear;Prompt"
|
||
msgstr ""
|
||
|
||
#: ulng.rsnoequivalentinternalcommand
|
||
msgid "No internal equivalent command"
|
||
msgstr ""
|
||
|
||
#: ulng.rsnofindfileswindowyet
|
||
msgid "Sorry, no \"Find files\" window yet..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsnootherfindfileswindowtoclose
|
||
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
||
msgstr ""
|
||
|
||
#: ulng.rsopenwithdevelopment
|
||
msgid "Development"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopenwitheducation
|
||
msgid "Education"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopenwithgames
|
||
msgid "Games"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopenwithgraphics
|
||
#, fuzzy
|
||
msgctxt "ulng.rsopenwithgraphics"
|
||
msgid "Graphics"
|
||
msgstr "Графики"
|
||
|
||
#: ulng.rsopenwithmultimedia
|
||
msgid "Multimedia"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopenwithnetwork
|
||
#, fuzzy
|
||
msgctxt "ulng.rsopenwithnetwork"
|
||
msgid "Network"
|
||
msgstr "Мрежа"
|
||
|
||
#: ulng.rsopenwithoffice
|
||
msgid "Office"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopenwithother
|
||
#, fuzzy
|
||
msgctxt "ulng.rsopenwithother"
|
||
msgid "Other"
|
||
msgstr "Друго:"
|
||
|
||
#: ulng.rsopenwithscience
|
||
msgid "Science"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopenwithsettings
|
||
msgid "Settings"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopenwithsystem
|
||
#, fuzzy
|
||
msgctxt "ulng.rsopenwithsystem"
|
||
msgid "System"
|
||
msgstr "Системен"
|
||
|
||
#: ulng.rsopenwithutility
|
||
msgid "Accessories"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperaborted
|
||
msgid "Aborted"
|
||
msgstr "Прекъснато"
|
||
|
||
#: ulng.rsopercalculatingchecksum
|
||
msgid "Calculating checksum"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopercalculatingchecksumin
|
||
msgid "Calculating checksum in \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsopercalculatingchecksumof
|
||
msgid "Calculating checksum of \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsopercalculatingstatictics
|
||
msgctxt "ulng.rsopercalculatingstatictics"
|
||
msgid "Calculating"
|
||
msgstr "Изчисляване"
|
||
|
||
#: ulng.rsopercalculatingstatisticsin
|
||
msgid "Calculating \"%s\""
|
||
msgstr "Изчисляване „%s‟"
|
||
|
||
#: ulng.rsopercombining
|
||
msgid "Joining"
|
||
msgstr "Сглобяване"
|
||
|
||
#: ulng.rsopercombiningfromto
|
||
msgid "Joining files in \"%s\" to \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsopercopying
|
||
msgid "Copying"
|
||
msgstr "Презаписване"
|
||
|
||
#: ulng.rsopercopyingfromto
|
||
msgid "Copying from \"%s\" to \"%s\""
|
||
msgstr "Презапис от „%s‟ в „%s‟"
|
||
|
||
#: ulng.rsopercopyingsomethingto
|
||
msgid "Copying \"%s\" to \"%s\""
|
||
msgstr "Презапис на „%s‟ в „%s‟"
|
||
|
||
#: ulng.rsopercreatingdirectory
|
||
msgid "Creating directory"
|
||
msgstr "Създаване на папка"
|
||
|
||
#: ulng.rsopercreatingsomedirectory
|
||
msgid "Creating directory \"%s\""
|
||
msgstr "Създаване на папка „%s‟"
|
||
|
||
#: ulng.rsoperdeleting
|
||
msgctxt "ulng.rsoperdeleting"
|
||
msgid "Deleting"
|
||
msgstr "Изтриване"
|
||
|
||
#: ulng.rsoperdeletingin
|
||
msgid "Deleting in \"%s\""
|
||
msgstr "Изтриване в „%s‟"
|
||
|
||
#: ulng.rsoperdeletingsomething
|
||
msgid "Deleting \"%s\""
|
||
msgstr "Изтриване на „%s‟"
|
||
|
||
#: ulng.rsoperexecuting
|
||
msgid "Executing"
|
||
msgstr "Изпълняване"
|
||
|
||
#: ulng.rsoperexecutingsomething
|
||
msgid "Executing \"%s\""
|
||
msgstr "Изпълняване на „%s‟"
|
||
|
||
#: ulng.rsoperextracting
|
||
msgid "Extracting"
|
||
msgstr "Извличане"
|
||
|
||
#: ulng.rsoperextractingfromto
|
||
msgid "Extracting from \"%s\" to \"%s\""
|
||
msgstr "Извличане от „%s‟ в „%s‟"
|
||
|
||
#: ulng.rsoperfinished
|
||
msgid "Finished"
|
||
msgstr "Приключено"
|
||
|
||
#: ulng.rsoperlisting
|
||
msgid "Listing"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperlistingin
|
||
msgid "Listing \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsopermoving
|
||
msgid "Moving"
|
||
msgstr "Преместване"
|
||
|
||
#: ulng.rsopermovingfromto
|
||
msgid "Moving from \"%s\" to \"%s\""
|
||
msgstr "Преместване от „%s‟ в „%s‟"
|
||
|
||
#: ulng.rsopermovingsomethingto
|
||
msgid "Moving \"%s\" to \"%s\""
|
||
msgstr "Преместване на „%s‟ в „%s‟"
|
||
|
||
#: ulng.rsopernotstarted
|
||
msgid "Not started"
|
||
msgstr "Незапочнато"
|
||
|
||
#: ulng.rsoperpacking
|
||
msgid "Packing"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperpackingfromto
|
||
msgid "Packing from \"%s\" to \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperpackingsomethingto
|
||
msgid "Packing \"%s\" to \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperpaused
|
||
msgid "Paused"
|
||
msgstr "Задържано"
|
||
|
||
#: ulng.rsoperpausing
|
||
msgid "Pausing"
|
||
msgstr "Задържане"
|
||
|
||
#: ulng.rsoperrunning
|
||
msgid "Running"
|
||
msgstr "Работещо"
|
||
|
||
#: ulng.rsopersettingproperty
|
||
msgid "Setting property"
|
||
msgstr "Задаване на свойство"
|
||
|
||
#: ulng.rsopersettingpropertyin
|
||
msgid "Setting property in \"%s\""
|
||
msgstr "Задаване на свойство в „%s‟"
|
||
|
||
#: ulng.rsopersettingpropertyof
|
||
msgid "Setting property of \"%s\""
|
||
msgstr "Задаване на свойство на „%s‟"
|
||
|
||
#: ulng.rsopersplitting
|
||
msgid "Splitting"
|
||
msgstr "Нацепване"
|
||
|
||
#: ulng.rsopersplittingfromto
|
||
msgid "Splitting \"%s\" to \"%s\""
|
||
msgstr "Нацепване на „%s‟ в „%s‟"
|
||
|
||
#: ulng.rsoperstarting
|
||
msgid "Starting"
|
||
msgstr "Започване"
|
||
|
||
#: ulng.rsoperstopped
|
||
msgid "Stopped"
|
||
msgstr "Спряно"
|
||
|
||
#: ulng.rsoperstopping
|
||
msgid "Stopping"
|
||
msgstr "Спиране"
|
||
|
||
#: ulng.rsopertesting
|
||
msgid "Testing"
|
||
msgstr "Проверка"
|
||
|
||
#: ulng.rsopertestingin
|
||
msgid "Testing in \"%s\""
|
||
msgstr "Проверка в „%s‟"
|
||
|
||
#: ulng.rsopertestingsomething
|
||
msgid "Testing \"%s\""
|
||
msgstr "Проверка на „%s‟"
|
||
|
||
#: ulng.rsoperverifyingchecksum
|
||
msgid "Verifying checksum"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperverifyingchecksumin
|
||
msgid "Verifying checksum in \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperverifyingchecksumof
|
||
msgid "Verifying checksum of \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rsoperwaitingforconnection
|
||
msgid "Waiting for access to file source"
|
||
msgstr "Изчакване на достъп до изходния файл"
|
||
|
||
#: ulng.rsoperwaitingforfeedback
|
||
msgid "Waiting for user response"
|
||
msgstr "Чакане на отговор от потребителя"
|
||
|
||
#: ulng.rsoperwiping
|
||
msgid "Wiping"
|
||
msgstr "Унищожаване"
|
||
|
||
#: ulng.rsoperwipingin
|
||
msgid "Wiping in \"%s\""
|
||
msgstr "Унищожаване в „%s‟"
|
||
|
||
#: ulng.rsoperwipingsomething
|
||
msgid "Wiping \"%s\""
|
||
msgstr "Унищожаване на „%s‟"
|
||
|
||
#: ulng.rsoperworking
|
||
msgid "Working"
|
||
msgstr "Работи"
|
||
|
||
#: ulng.rsoptaddfrommainpanel
|
||
#, fuzzy
|
||
#| msgid "Add at beginning;Add at the end;Smart add"
|
||
msgid "Add at &beginning;Add at the end;Smart add"
|
||
msgstr "Добавяне в началото;Добавяне в края;Умно добавяне"
|
||
|
||
#: ulng.rsoptaddingtooltipfiletype
|
||
msgid "Adding new tooltip file type"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiveconfiguresavetochange
|
||
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiveradditonalcmd
|
||
msgid "Mode dependent, additional command"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiveraddonlynotempty
|
||
msgid "Add if it is non-empty"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverarchivel
|
||
msgid "Archive File (long name)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverarchiver
|
||
msgid "Select archiver executable"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverarchives
|
||
msgid "Archive file (short name)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverchangeencoding
|
||
msgid "Change Archiver Listing Encoding"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverconfirmdelete
|
||
msgctxt "ulng.rsoptarchiverconfirmdelete"
|
||
msgid "Are you sure you want to delete: \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverdefaultexportfilename
|
||
msgid "Exported Archiver Configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchivererrorlevel
|
||
msgid "errorlevel"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverexportcaption
|
||
msgid "Export archiver configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverexportdone
|
||
msgctxt "ulng.rsoptarchiverexportdone"
|
||
msgid "Exportation of %d elements to file \"%s\" completed."
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverexportprompt
|
||
msgctxt "ulng.rsoptarchiverexportprompt"
|
||
msgid "Select the one(s) you want to export"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverfilelistl
|
||
msgid "Filelist (long names)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverfilelists
|
||
msgid "Filelist (short names)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverimportcaption
|
||
msgid "Import archiver configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverimportdone
|
||
msgctxt "ulng.rsoptarchiverimportdone"
|
||
msgid "Importation of %d elements from file \"%s\" completed."
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverimportfile
|
||
msgid "Select the file to import archiver configuration(s)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverimportprompt
|
||
msgctxt "ulng.rsoptarchiverimportprompt"
|
||
msgid "Select the one(s) you want to import"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverjustname
|
||
msgid "Use name only, without path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverjustpath
|
||
msgid "Use path only, without name"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverprograml
|
||
msgid "Archive Program (long name)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverprograms
|
||
msgid "Archive Program (short name)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverquoteall
|
||
msgid "Quote all names"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverquotewithspace
|
||
msgid "Quote names with spaces"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiversinglefprocess
|
||
msgid "Single filename to process"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchivertargetsubdir
|
||
msgid "Target subdirecory"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiveruseansi
|
||
msgid "Use ANSI encoding"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiveruseutf8
|
||
msgid "Use UTF8 encoding"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchiverwheretosave
|
||
msgid "Enter location and filename where to save archiver configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptarchivetypename
|
||
msgid "Archive type name:"
|
||
msgstr "Име на вида архив:"
|
||
|
||
#: ulng.rsoptassocpluginwith
|
||
msgid "Associate plugin \"%s\" with:"
|
||
msgstr "Обвързване на приставка \"%s\" с:"
|
||
|
||
#: ulng.rsoptautosizecolumn
|
||
msgid "First;Last;"
|
||
msgstr "Първи;Последен"
|
||
|
||
#: ulng.rsoptconfigsortorder
|
||
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptconfigtreestate
|
||
msgid "Full expand;Full collapse"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptdifferframeposition
|
||
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
||
msgstr "Дейното крило- отляво, бездейното- отдясно (наследствено); Лявото крило- отляво, дясното- отдясно"
|
||
|
||
#: ulng.rsoptenterext
|
||
msgid "Enter extension"
|
||
msgstr "Въведете разширение"
|
||
|
||
#: ulng.rsoptfavoritetabswheretoaddinlist
|
||
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptfileoperationsprogresskind
|
||
msgid "separate window;minimized separate window;operations panel"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptfilesizeformat
|
||
msgid "float;B;K;M;G"
|
||
msgstr "плаващ;Б;К;М;Г"
|
||
|
||
#: ulng.rsopthotkeysadddeleteshortcutlong
|
||
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysaddhotkey
|
||
msgid "Add hotkey for %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysaddshortcutbutton
|
||
msgid "Add shortcut"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeyscannotsetshortcut
|
||
msgid "Cannot set shortcut"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeyschangeshortcut
|
||
msgid "Change shortcut"
|
||
msgstr "Промяна на съчетанието"
|
||
|
||
#: ulng.rsopthotkeyscommand
|
||
msgctxt "ulng.rsopthotkeyscommand"
|
||
msgid "Command"
|
||
msgstr "Заповед"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
||
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
||
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysdescription
|
||
msgctxt "ulng.rsopthotkeysdescription"
|
||
msgid "Description"
|
||
msgstr "Описание"
|
||
|
||
#: ulng.rsopthotkeysedithotkey
|
||
msgid "Edit hotkey for %s"
|
||
msgstr "Про&мяна на клавишно съчетание за %s"
|
||
|
||
#: ulng.rsopthotkeysfixparameter
|
||
msgid "Fix parameter"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeyshotkey
|
||
msgctxt "ulng.rsopthotkeyshotkey"
|
||
msgid "Hotkey"
|
||
msgstr "Клавишно съчетание"
|
||
|
||
#: ulng.rsopthotkeyshotkeys
|
||
msgctxt "ulng.rsopthotkeyshotkeys"
|
||
msgid "Hotkeys"
|
||
msgstr "Клавишни съчетания"
|
||
|
||
#: ulng.rsopthotkeysnohotkey
|
||
msgid "<none>"
|
||
msgstr "<няма>"
|
||
|
||
#: ulng.rsopthotkeysparameters
|
||
msgctxt "ulng.rsopthotkeysparameters"
|
||
msgid "Parameters"
|
||
msgstr "Ключове"
|
||
|
||
#: ulng.rsopthotkeyssetdeleteshortcut
|
||
msgid "Set shortcut to delete file"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
||
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
||
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysshortcutused
|
||
msgid "Shortcut in use"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext1
|
||
msgid "Shortcut %s is already used."
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext2
|
||
msgid "Change it to %s?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysusedby
|
||
msgid "used for %s in %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopthotkeysusedwithdifferentparams
|
||
msgid "used for this command but with different parameters"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptionseditorarchivers
|
||
msgctxt "ulng.rsoptionseditorarchivers"
|
||
msgid "Archivers"
|
||
msgstr "Архиватори"
|
||
|
||
#: ulng.rsoptionseditorautorefresh
|
||
msgctxt "ulng.rsoptionseditorautorefresh"
|
||
msgid "Auto refresh"
|
||
msgstr "Самоопресняване"
|
||
|
||
#: ulng.rsoptionseditorbehavior
|
||
msgctxt "ulng.rsoptionseditorbehavior"
|
||
msgid "Behaviors"
|
||
msgstr "Поведения"
|
||
|
||
#: ulng.rsoptionseditorbriefview
|
||
msgctxt "ulng.rsoptionseditorbriefview"
|
||
msgid "Brief"
|
||
msgstr "Съкратен"
|
||
|
||
#: ulng.rsoptionseditorcolors
|
||
msgctxt "ulng.rsoptionseditorcolors"
|
||
msgid "Colors"
|
||
msgstr "Цветове"
|
||
|
||
#: ulng.rsoptionseditorcolumnsview
|
||
msgctxt "ulng.rsoptionseditorcolumnsview"
|
||
msgid "Columns"
|
||
msgstr "Стълбове"
|
||
|
||
#: ulng.rsoptionseditorconfiguration
|
||
msgctxt "ulng.rsoptionseditorconfiguration"
|
||
msgid "Configuration"
|
||
msgstr "Настройка"
|
||
|
||
#: ulng.rsoptionseditorcustomcolumns
|
||
msgid "Custom columns"
|
||
msgstr "Нагласени стълбове"
|
||
|
||
#: ulng.rsoptionseditordirectoryhotlist
|
||
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Бързодостъпни папки"
|
||
|
||
#: ulng.rsoptionseditordraganddrop
|
||
msgid "Drag & drop"
|
||
msgstr "Завлачване"
|
||
|
||
#: ulng.rsoptionseditordriveslistbutton
|
||
msgid "Drives list button"
|
||
msgstr "Копче със списък на устройствата"
|
||
|
||
#: ulng.rsoptionseditorfavoritetabs
|
||
msgid "Favorite Tabs"
|
||
msgstr "Предпочитани подпрозорци"
|
||
|
||
#: ulng.rsoptionseditorfileassicextra
|
||
msgid "File associations extra"
|
||
msgstr "Допълнителни възможности на файловите обвързвания"
|
||
|
||
#: ulng.rsoptionseditorfileassoc
|
||
msgctxt "ulng.rsoptionseditorfileassoc"
|
||
msgid "File associations"
|
||
msgstr "Файлови обвързвания"
|
||
|
||
#: ulng.rsoptionseditorfilenewfiletypes
|
||
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
||
msgid "New"
|
||
msgstr "Нов размер"
|
||
|
||
#: ulng.rsoptionseditorfileoperations
|
||
msgctxt "ulng.rsoptionseditorfileoperations"
|
||
msgid "File operations"
|
||
msgstr "Действия с файлове"
|
||
|
||
#: ulng.rsoptionseditorfilepanels
|
||
msgctxt "ulng.rsoptionseditorfilepanels"
|
||
msgid "File panels"
|
||
msgstr "Файлови крила"
|
||
|
||
#: ulng.rsoptionseditorfilesearch
|
||
#, fuzzy
|
||
msgctxt "ulng.rsoptionseditorfilesearch"
|
||
msgid "File search"
|
||
msgstr "Файлово търсене"
|
||
|
||
#: ulng.rsoptionseditorfilesviews
|
||
msgid "Files views"
|
||
msgstr "Файлов изглед"
|
||
|
||
#: ulng.rsoptionseditorfiletypes
|
||
msgctxt "ulng.rsoptionseditorfiletypes"
|
||
msgid "File types"
|
||
msgstr "Видове файлове"
|
||
|
||
#: ulng.rsoptionseditorfoldertabs
|
||
msgctxt "ulng.rsoptionseditorfoldertabs"
|
||
msgid "Folder tabs"
|
||
msgstr "Папкови подпрозорци"
|
||
|
||
#: ulng.rsoptionseditorfoldertabsextra
|
||
msgid "Folder tabs extra"
|
||
msgstr "Допълнителни настройки на подпрозорците"
|
||
|
||
#: ulng.rsoptionseditorfonts
|
||
msgctxt "ulng.rsoptionseditorfonts"
|
||
msgid "Fonts"
|
||
msgstr "Шрифтове"
|
||
|
||
#: ulng.rsoptionseditorhighlighters
|
||
msgid "Highlighters"
|
||
msgstr "Оцветяване"
|
||
|
||
#: ulng.rsoptionseditorhotkeys
|
||
msgctxt "ulng.rsoptionseditorhotkeys"
|
||
msgid "Hot keys"
|
||
msgstr "Клавишни съчетания"
|
||
|
||
#: ulng.rsoptionseditoricons
|
||
msgctxt "ulng.rsoptionseditoricons"
|
||
msgid "Icons"
|
||
msgstr "Значета"
|
||
|
||
#: ulng.rsoptionseditorignorelist
|
||
msgctxt "ulng.rsoptionseditorignorelist"
|
||
msgid "Ignore list"
|
||
msgstr "Пренебрегвания"
|
||
|
||
#: ulng.rsoptionseditorkeyboard
|
||
msgid "Keys"
|
||
msgstr "Клавиши"
|
||
|
||
#: ulng.rsoptionseditorlanguage
|
||
msgctxt "ulng.rsoptionseditorlanguage"
|
||
msgid "Language"
|
||
msgstr "Език"
|
||
|
||
#: ulng.rsoptionseditorlayout
|
||
msgctxt "ulng.rsoptionseditorlayout"
|
||
msgid "Layout"
|
||
msgstr "Подредба"
|
||
|
||
#: ulng.rsoptionseditorlog
|
||
msgctxt "ulng.rsoptionseditorlog"
|
||
msgid "Log"
|
||
msgstr "Дневник"
|
||
|
||
#: ulng.rsoptionseditormiscellaneous
|
||
msgctxt "ulng.rsoptionseditormiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Разни"
|
||
|
||
#: ulng.rsoptionseditormouse
|
||
msgid "Mouse"
|
||
msgstr "Мишка"
|
||
|
||
#: ulng.rsoptionseditoroptionschanged
|
||
msgid ""
|
||
"Options have changed in \"%s\"\n"
|
||
"\n"
|
||
"Do you want to save modifications?\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptionseditorplugins
|
||
msgctxt "ulng.rsoptionseditorplugins"
|
||
msgid "Plugins"
|
||
msgstr "Приставки"
|
||
|
||
#: ulng.rsoptionseditorquicksearch
|
||
msgctxt "ulng.rsoptionseditorquicksearch"
|
||
msgid "Quick search/filter"
|
||
msgstr "Бързо търсене/пресяване"
|
||
|
||
#: ulng.rsoptionseditorterminal
|
||
msgctxt "ulng.rsoptionseditorterminal"
|
||
msgid "Terminal"
|
||
msgstr "Терминал"
|
||
|
||
#: ulng.rsoptionseditortoolbar
|
||
msgid "Toolbar"
|
||
msgstr "Лента с пособия"
|
||
|
||
#: ulng.rsoptionseditortools
|
||
msgctxt "ulng.rsoptionseditortools"
|
||
msgid "Tools"
|
||
msgstr "Пособия"
|
||
|
||
#: ulng.rsoptionseditortooltips
|
||
msgctxt "ulng.rsoptionseditortooltips"
|
||
msgid "Tooltips"
|
||
msgstr "Подсказки"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenu
|
||
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
||
msgid "Tree View Menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptionseditortreeviewmenucolors
|
||
msgid "Tree View Menu Colors"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptletters
|
||
msgid "None;Command Line;Quick Search;Quick Filter"
|
||
msgstr "Няма;Ред за управление;Бързо търсене;Бързо пресяване"
|
||
|
||
#: ulng.rsoptmouseselectionbutton
|
||
msgid "Left button;Right button;"
|
||
msgstr "Ляво цъкало;Дясно цъкало;"
|
||
|
||
#: ulng.rsoptnewfilesposition
|
||
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptpluginalreadyassigned
|
||
msgid "Plugin %s is already assigned for the following extensions:"
|
||
msgstr "Приставката %s вече свързана със следното разширение:"
|
||
|
||
#: ulng.rsoptplugindisable
|
||
msgid "D&isable"
|
||
msgstr "Забраняване"
|
||
|
||
#: ulng.rsoptpluginenable
|
||
msgctxt "ulng.rsoptpluginenable"
|
||
msgid "E&nable"
|
||
msgstr "&Разрешаване"
|
||
|
||
#: ulng.rsoptpluginsactive
|
||
msgctxt "ulng.rsoptpluginsactive"
|
||
msgid "Active"
|
||
msgstr "Деен"
|
||
|
||
#: ulng.rsoptpluginsdescription
|
||
msgctxt "ulng.rsoptpluginsdescription"
|
||
msgid "Description"
|
||
msgstr "Описание"
|
||
|
||
#: ulng.rsoptpluginsfilename
|
||
msgctxt "ulng.rsoptpluginsfilename"
|
||
msgid "File name"
|
||
msgstr "Файлово име"
|
||
|
||
#: ulng.rsoptpluginshowbyextension
|
||
msgid "By extension"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptpluginshowbyplugin
|
||
msgid "By Plugin"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptpluginsname
|
||
msgctxt "ulng.rsoptpluginsname"
|
||
msgid "Name"
|
||
msgstr "Име"
|
||
|
||
#: ulng.rsoptpluginsortonlywhenbyextension
|
||
msgid "Sorting WCX plugins is only possible when showing plugins by extension!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptpluginsregisteredfor
|
||
msgctxt "ulng.rsoptpluginsregisteredfor"
|
||
msgid "Registered for"
|
||
msgstr "Записано на"
|
||
|
||
#: ulng.rsoptrenamingtooltipfiletype
|
||
msgid "Renaming tooltip file type"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptsearchcase
|
||
msgid "&Sensitive;&Insensitive"
|
||
msgstr "&с отчитане на глАВноСТта;&без отчитане на глАВноСТта;"
|
||
|
||
#: ulng.rsoptsearchitems
|
||
msgid "&Files;Di&rectories;Files a&nd Directories"
|
||
msgstr "&Файлове;&Папки;Файлове &и папки"
|
||
|
||
#: ulng.rsoptsearchopt
|
||
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptsortcasesens
|
||
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
||
msgstr "Без отчитане на глАВноСТта;Според местните настройки (аАбБвВ);първо главните, после редовните(АБВабв)"
|
||
|
||
#: ulng.rsoptsortfoldermode
|
||
msgid "sort by name and show first;sort like files and show first;sort like files"
|
||
msgstr "по име и показване най-отгоре;като файлове и показване най-отгоре;като файлове"
|
||
|
||
#: ulng.rsoptsortmethod
|
||
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
||
msgstr "Азбучно, с отчитане на ударенията;Естествено: азбучно и числено"
|
||
|
||
#: ulng.rsopttabsposition
|
||
msgid "Top;Bottom;"
|
||
msgstr "Отгоре;Отдолу"
|
||
|
||
#: ulng.rsopttoolbarbuttontype
|
||
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
||
msgstr "Раз&делител;&Вътрешна заповед;Въ&ншна заповед;&Изборник"
|
||
|
||
#: ulng.rsopttooltipconfiguresavetochange
|
||
msgid "To change file type tooltip configuration, either APPLY or DELETE current editing one"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletype
|
||
msgid "Tooltip file type name:"
|
||
msgstr "&Име на раздела:"
|
||
|
||
#: ulng.rsopttooltipfiletypealreadyexists
|
||
msgid "\"%s\" already exists!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeconfirmdelete
|
||
msgctxt "ulng.rsopttooltipfiletypeconfirmdelete"
|
||
msgid "Are you sure you want to delete: \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypedefaultexportfilename
|
||
msgid "Exported tooltip file type configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeexportcaption
|
||
msgid "Export tooltip file type configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeexportdone
|
||
msgctxt "ulng.rsopttooltipfiletypeexportdone"
|
||
msgid "Exportation of %d elements to file \"%s\" completed."
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeexportprompt
|
||
msgctxt "ulng.rsopttooltipfiletypeexportprompt"
|
||
msgid "Select the one(s) you want to export"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeimportcaption
|
||
msgid "Import tooltip file type configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeimportdone
|
||
msgctxt "ulng.rsopttooltipfiletypeimportdone"
|
||
msgid "Importation of %d elements from file \"%s\" completed."
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeimportfile
|
||
msgid "Select the file to import tooltip file type configuration(s)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeimportprompt
|
||
msgctxt "ulng.rsopttooltipfiletypeimportprompt"
|
||
msgid "Select the one(s) you want to import"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypewheretosave
|
||
msgid "Enter location and filename where to save tooltip file type configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipsfiletypename
|
||
msgid "Tooltip file type name"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttypeofduplicatedrename
|
||
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
||
msgstr ""
|
||
|
||
#: ulng.rsoptupdatedfilesposition
|
||
msgid "don't change position;use the same setting as for new files;to sorted position"
|
||
msgstr "без пренареждане;според настройките за новите файлове;подреждане"
|
||
|
||
#: ulng.rspluginfilenamestylelist
|
||
msgid "With complete absolute path;Path relative to %COMMANDER_PATH%;Relative to the following"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchcontainscasesenstive
|
||
msgid "contains(case)"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchcontainsnotcase
|
||
msgid "contains"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchequalcasesensitive
|
||
msgid "=(case)"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchequalnotcase
|
||
msgctxt "ulng.rspluginsearchequalnotcase"
|
||
msgid "="
|
||
msgstr "="
|
||
|
||
#: ulng.rspluginsearchfieldnotfound
|
||
msgid "Field \"%s\" not found!"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchnotcontainscasesenstive
|
||
msgid "!contains(case)"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchnotcontainsnotcase
|
||
msgid "!contains"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchnotequacasesensitive
|
||
msgid "!=(case)"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchnotequalnotcase
|
||
msgctxt "ulng.rspluginsearchnotequalnotcase"
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: ulng.rspluginsearchpluginnotfound
|
||
msgid "Plugin \"%s\" not found!"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchunitnotfound
|
||
msgid "Unit \"%s\" not found!"
|
||
msgstr ""
|
||
|
||
#: ulng.rspropscontains
|
||
msgid "Files: %d, folders: %d"
|
||
msgstr "Файлове: %d, папки: %d"
|
||
|
||
#: ulng.rspropserrchmod
|
||
msgid "Can not change access rights for \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rspropserrchown
|
||
msgid "Can not change owner for \"%s\""
|
||
msgstr ""
|
||
|
||
#: ulng.rspropsfile
|
||
msgctxt "ulng.rspropsfile"
|
||
msgid "File"
|
||
msgstr "Файл"
|
||
|
||
#: ulng.rspropsfolder
|
||
msgctxt "ulng.rspropsfolder"
|
||
msgid "Directory"
|
||
msgstr "Папка"
|
||
|
||
#: ulng.rspropsnmdpipe
|
||
msgid "Named pipe"
|
||
msgstr "Наименована тръба"
|
||
|
||
#: ulng.rspropssocket
|
||
msgid "Socket"
|
||
msgstr "Гнездо"
|
||
|
||
#: ulng.rspropsspblkdev
|
||
msgid "Special block device"
|
||
msgstr "Нарочно блоково устройство"
|
||
|
||
#: ulng.rspropsspchrdev
|
||
msgid "Special character device"
|
||
msgstr "Нарочно знаково устройство"
|
||
|
||
#: ulng.rspropssymlink
|
||
msgid "Symbolic link"
|
||
msgstr "Мека връзка"
|
||
|
||
#: ulng.rspropsunknowntype
|
||
msgid "Unknown type"
|
||
msgstr "Неизвестен вид"
|
||
|
||
#: ulng.rssearchresult
|
||
msgid "Search result"
|
||
msgstr "Намерени"
|
||
|
||
#: ulng.rssearchstatus
|
||
msgid "SEARCH"
|
||
msgstr ""
|
||
|
||
#: ulng.rssearchtemplateunnamed
|
||
msgid "<unnamed template>"
|
||
msgstr ""
|
||
|
||
#: ulng.rssearchwithdsxplugininprogress
|
||
msgid ""
|
||
"A file search using DSX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rssearchwithwdxplugininprogress
|
||
msgid ""
|
||
"A file search using WDX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
|
||
#: ulng.rsselectdir
|
||
msgid "Select a directory"
|
||
msgstr "Избор на папка"
|
||
|
||
#: ulng.rsselectyoufindfileswindow
|
||
msgid "Select your window"
|
||
msgstr ""
|
||
|
||
#: ulng.rsshowhelpfor
|
||
msgid "&Show help for %s"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordall
|
||
msgctxt "ulng.rssimplewordall"
|
||
msgid "All"
|
||
msgstr "Всички"
|
||
|
||
#: ulng.rssimplewordcategory
|
||
msgctxt "ulng.rssimplewordcategory"
|
||
msgid "Category"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordcolumnsingular
|
||
msgid "Column"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordcommand
|
||
msgctxt "ulng.rssimplewordcommand"
|
||
msgid "Command"
|
||
msgstr "Заповед"
|
||
|
||
#: ulng.rssimplewordfalse
|
||
msgid "False"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordfilename
|
||
msgid "Filename"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordfiles
|
||
msgid "files"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordletter
|
||
msgid "Letter"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordparameter
|
||
msgid "Param"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordresult
|
||
msgid "Result"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordtrue
|
||
msgid "True"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordworkdir
|
||
msgid "WorkDir"
|
||
msgstr ""
|
||
|
||
#: ulng.rssizeunitbytes
|
||
msgid "Bytes"
|
||
msgstr "байта"
|
||
|
||
#: ulng.rssizeunitgbytes
|
||
msgctxt "ulng.rssizeunitgbytes"
|
||
msgid "Gigabytes"
|
||
msgstr "гигабайта"
|
||
|
||
#: ulng.rssizeunitkbytes
|
||
msgctxt "ulng.rssizeunitkbytes"
|
||
msgid "Kilobytes"
|
||
msgstr "килобайта"
|
||
|
||
#: ulng.rssizeunitmbytes
|
||
msgctxt "ulng.rssizeunitmbytes"
|
||
msgid "Megabytes"
|
||
msgstr "мегабайта"
|
||
|
||
#: ulng.rssizeunittbytes
|
||
msgid "Terabytes"
|
||
msgstr "терабайта"
|
||
|
||
#: ulng.rsspacemsg
|
||
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
||
msgstr "Файлове: %d, папки: %d, размер: %s (%s байта)"
|
||
|
||
#: ulng.rsspliterrdirectory
|
||
msgid "Unable to create target directory!"
|
||
msgstr "Създаването на целевата папка е невъзможно!"
|
||
|
||
#: ulng.rsspliterrfilesize
|
||
msgid "Incorrect file size format!"
|
||
msgstr "Неправилно изписване на файловия размер!"
|
||
|
||
#: ulng.rsspliterrsplitfile
|
||
msgid "Unable to split the file!"
|
||
msgstr "Неуспешно раздробяване на файла!"
|
||
|
||
#: ulng.rssplitmsgmanyparts
|
||
msgid "The number of parts is more than 100! Continue?"
|
||
msgstr ""
|
||
|
||
#: ulng.rssplitpredefinedsizes
|
||
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
msgstr ""
|
||
|
||
#: ulng.rssplitseldir
|
||
msgid "Select directory:"
|
||
msgstr "Изберете папка:"
|
||
|
||
#: ulng.rsstraccents
|
||
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstraccentsstripped
|
||
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewjustpreview
|
||
msgid "Just preview"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewothers
|
||
msgid "Others"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewsearchingletters
|
||
msgid "OU"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewsidenote
|
||
msgid "Side note"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched1
|
||
msgid "Flat"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched2
|
||
msgid "Limited"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched3
|
||
msgid "Simple"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched1
|
||
msgid "Fabulous"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched2
|
||
msgid "Marvelous"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched3
|
||
msgid "Tremendous"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosedirhistory
|
||
msgid "Choose your directory from Dir History"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosefavoritetabs
|
||
msgid "Choose you Favorite Tabs:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
||
msgid "Choose your command from Command Line History"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosefrommainmenu
|
||
msgid "Choose your action from Main Menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosefromtoolbar
|
||
msgid "Choose your action from Maintool bar"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchoosehotdirectory
|
||
msgid "Choose your directory from Hot Directory:"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchooseviewhistory
|
||
msgid "Choose your directory from File View History"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrtvmchooseyourfileordir
|
||
msgid "Choose your file or your directory"
|
||
msgstr ""
|
||
|
||
#: ulng.rssymerrcreate
|
||
msgid "Error creating symlink."
|
||
msgstr "Грешка при създаване на мека връзка."
|
||
|
||
#: ulng.rssyndefaulttext
|
||
msgctxt "ulng.rssyndefaulttext"
|
||
msgid "Default text"
|
||
msgstr ""
|
||
|
||
#: ulng.rssynlangplaintext
|
||
msgctxt "ulng.rssynlangplaintext"
|
||
msgid "Plain text"
|
||
msgstr ""
|
||
|
||
#: ulng.rstabsactionondoubleclickchoices
|
||
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rstimeunitday
|
||
msgctxt "ulng.rstimeunitday"
|
||
msgid "Day(s)"
|
||
msgstr "Ден/ дни"
|
||
|
||
#: ulng.rstimeunithour
|
||
msgid "Hour(s)"
|
||
msgstr "час(а)"
|
||
|
||
#: ulng.rstimeunitminute
|
||
msgid "Minute(s)"
|
||
msgstr "минута/и"
|
||
|
||
#: ulng.rstimeunitmonth
|
||
msgid "Month(s)"
|
||
msgstr "месец(а)"
|
||
|
||
#: ulng.rstimeunitsecond
|
||
msgid "Second(s)"
|
||
msgstr "секунда/и"
|
||
|
||
#: ulng.rstimeunitweek
|
||
msgid "Week(s)"
|
||
msgstr "седмица/и"
|
||
|
||
#: ulng.rstimeunityear
|
||
msgid "Year(s)"
|
||
msgstr "година/и"
|
||
|
||
#: ulng.rstitlerenamefavtabs
|
||
msgid "Rename Favorite Tabs"
|
||
msgstr ""
|
||
|
||
#: ulng.rstitlerenamefavtabsmenu
|
||
msgid "Rename Favorite Tabs sub-menu"
|
||
msgstr ""
|
||
|
||
#: ulng.rstooldiffer
|
||
msgctxt "ulng.rstooldiffer"
|
||
msgid "Differ"
|
||
msgstr "Сравнител"
|
||
|
||
#: ulng.rstooleditor
|
||
msgctxt "ulng.rstooleditor"
|
||
msgid "Editor"
|
||
msgstr "Обработчик"
|
||
|
||
#: ulng.rstoolerroropeningdiffer
|
||
msgid "Error opening differ"
|
||
msgstr ""
|
||
|
||
#: ulng.rstoolerroropeningeditor
|
||
msgid "Error opening editor"
|
||
msgstr ""
|
||
|
||
#: ulng.rstoolerroropeningterminal
|
||
msgid "Error opening terminal"
|
||
msgstr ""
|
||
|
||
#: ulng.rstoolerroropeningviewer
|
||
msgid "Error opening viewer"
|
||
msgstr ""
|
||
|
||
#: ulng.rstoolterminal
|
||
msgctxt "ulng.rstoolterminal"
|
||
msgid "Terminal"
|
||
msgstr "Терминал"
|
||
|
||
#: ulng.rstooltiphidetimeoutlist
|
||
msgid "System default;1 sec;2 sec;3 sec;5 sec;10 sec;30 sec;1 min;Never hide"
|
||
msgstr ""
|
||
|
||
#: ulng.rstooltipmodelist
|
||
msgid "Combine DC and system tooltip, DC first (legacy);Combine DC and system tooltip, system first;Show DC tooltip when possible and system when not;Show DC tooltip only;Show system tooltip only"
|
||
msgstr ""
|
||
|
||
#: ulng.rstoolviewer
|
||
msgctxt "ulng.rstoolviewer"
|
||
msgid "Viewer"
|
||
msgstr "Преглед"
|
||
|
||
#: ulng.rsunhandledexceptionmessage
|
||
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarbothpanelactivetoinactive
|
||
msgid "Both panels, from active to inactive"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarbothpanellefttoright
|
||
msgid "Both panels, from left to right"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarcurrentpath
|
||
msgid "Path of panel"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarencloseelement
|
||
msgid "Enclose each name in brackets or what you want"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarfilenamenoext
|
||
msgid "Just filename, no extension"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarfullpath
|
||
msgid "Complete filename (path+filename)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarhelpwith
|
||
msgid "Help with \"%\" variables"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarinputparam
|
||
msgid "Will request request user to enter a parameter with a default suggested value"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarleftpanel
|
||
msgid "Left panel"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistfilename
|
||
msgid "Temporary filename of list of filenames"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistfullfilename
|
||
msgid "Temporary filename of list of complete filenames (path+filename)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistinutf16
|
||
msgid "Filenames in list in UTF-16 with BOM"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistinutf16quoted
|
||
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistinutf8
|
||
msgid "Filenames in list in UTF-8"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistinutf8quoted
|
||
msgid "Filenames in list in UTF-8, inside double quotes"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarlistrelativefilename
|
||
msgid "Temporary filename of list of filenames with relative path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvaronlyextension
|
||
msgid "Only file extension"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvaronlyfilename
|
||
msgid "Only filename"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarotherexamples
|
||
msgid "Other example of what's possible"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarpath
|
||
msgid "Path, without ending delimiter"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarpercentchangetopound
|
||
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarpercentsign
|
||
msgid "Return the percent sign"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarpoundchangetopercent
|
||
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarprependelement
|
||
msgid "Prepend each name with \"-a \" or what you want"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarpromptuserforparam
|
||
msgid "%[Prompt user for param;Default value proposed]"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarrelativepathandfilename
|
||
msgid "Filename with relative path"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarrightpanel
|
||
msgid "Right panel"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarsecondelementrightpanel
|
||
msgid "Full path of second selected file in right panel"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarshowcommandprior
|
||
msgid "Show command prior execute"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarsimplemessage
|
||
msgid "%[Simple message]"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarsimpleshowmessage
|
||
msgid "Will show a simple message"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarsourcepanel
|
||
msgid "Active panel (source)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvartargetpanel
|
||
msgid "Inactive panel (target)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarwillbequoted
|
||
msgid "Filenames will be quoted from here (default)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarwilldointerminal
|
||
msgid "Command will be done in terminal, remaining opened at the end"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarwillhaveendingdelimiter
|
||
msgid "Paths will have ending delimiter"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarwillnotbequoted
|
||
msgid "Filenames will not be quoted from here"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarwillnotdointerminal
|
||
msgid "Command will be done in terminal, closed at the end"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvarwillnothaveendingdelimiter
|
||
msgid "Paths will not have ending delimiter (default)"
|
||
msgstr ""
|
||
|
||
#: ulng.rsvfsnetwork
|
||
msgctxt "ulng.rsvfsnetwork"
|
||
msgid "Network"
|
||
msgstr "Мрежа"
|
||
|
||
#: ulng.rsviewabouttext
|
||
msgid "Internal Viewer of Double Commander."
|
||
msgstr "Вътрешен преглед на Double Commander"
|
||
|
||
#: ulng.rsviewbadquality
|
||
msgid "Bad Quality"
|
||
msgstr "Ниско качество"
|
||
|
||
#: ulng.rsviewencoding
|
||
msgctxt "ulng.rsviewencoding"
|
||
msgid "Encoding"
|
||
msgstr "Знаков набор"
|
||
|
||
#: ulng.rsviewimagetype
|
||
msgid "Image Type"
|
||
msgstr "Вид на изображението"
|
||
|
||
#: ulng.rsviewnewsize
|
||
msgctxt "ulng.rsviewnewsize"
|
||
msgid "New Size"
|
||
msgstr "Нов размер"
|
||
|
||
#: ulng.rsviewnotfound
|
||
msgid "%s not found!"
|
||
msgstr "%s не е открит!"
|
||
|
||
#: ulng.rsviewpainttoolslist
|
||
msgid "Pen;Rect;Ellipse"
|
||
msgstr ""
|
||
|
||
#: ulng.rsviewwithexternalviewer
|
||
msgid "with external viewer"
|
||
msgstr "с външен преглед"
|
||
|
||
#: ulng.rsviewwithinternalviewer
|
||
msgid "with internal viewer"
|
||
msgstr "с вътрешен преглед"
|
||
|
||
#: ulng.rsxreplacements
|
||
msgid "Number of replacement: %d"
|
||
msgstr ""
|
||
|
||
#: ulng.rszeroreplacement
|
||
msgid "No replacement took place."
|
||
msgstr ""
|
||
|