doublecmd/language/doublecmd.hu.po
2018-11-21 17:07:49 +00:00

12971 lines
336 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.8.0 alpha r7226\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2016-11-20 02:01+0000\n"
"Last-Translator: Nyilas MISY <dr.dabzse@gmail.com>\n"
"Language-Team: unDoRito -- HTC-iP <dr.dabzse@gmail.com>\n"
"Language: hu\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Generator: Poedit 1.8.8\n"
"X-Native-Language: Magyar\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Összehasonlítás.... %d%% (ESC a kilépéshez)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Jobb: %d fájl törlése"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Fájl található : %d (azonos : %d, különböző : %d, csak balról : %d, csak jobbról : %d )"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Balról jobbra : %d fájl másolása, teljes méret : %d bájt"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Jobbról balra : %d fájl másolása, teljes méret : %d bájt"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Sablon kiválasztása..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Szabad &terület ellenőrzése"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "&Attribútumok másolása"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "&Tulajdonos másolása"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "&Jogosultságok másolása"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "&Dátum/Idő másolása"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Helyes lin&kek"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
msgid "Drop readonly fla&g"
msgstr "Írásvédelmi attribútum elhagyása"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Üres &mappák kizárása"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Linkek követése"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "Hely &tartalékolása"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Mit tegyen, ha nem bírja beállítani a fájl idejét, attribútumait, stb."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Fájl-sablon használata"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Ha a &mappa létezik"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When &file exists"
msgstr "Ha a &fájl létezik"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Ha &nem bírja beállítani a tulajdonságokat"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<nincs sablon>"
#: tfrmabout.btnclose.caption
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Bezárás"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Másolás a vágólapra"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "Névjegy"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Kiadás"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Honlap :"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revízió"
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "verzió :"
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Visszaállít"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Attribútumok kiválasztása"
#: tfrmattributesedit.cbarchive.caption
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
msgid "&Archive"
msgstr "&Archívum"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Tö&mörített"
#: tfrmattributesedit.cbdirectory.caption
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
msgid "&Directory"
msgstr "&Könyvtár"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "&Titkosított"
#: tfrmattributesedit.cbhidden.caption
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
msgid "&Hidden"
msgstr "&Rejtett"
#: tfrmattributesedit.cbreadonly.caption
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
msgid "Read o&nly"
msgstr "Csak &olvasható"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "&Ritka"
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Ragadós"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Szimbolikus hivatkozás"
#: tfrmattributesedit.cbsystem.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "&Rendszer"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Ideiglenes"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "NTFS attribútumok"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Általános attribútumok"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitek :"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Csoport"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Egyéb"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Tulajdonos"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Végrehajtás"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Olvasás"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "&Szövegként :"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Írás"
#: tfrmbenchmark.caption
msgid "Benchmark"
msgstr ""
#: tfrmbenchmark.lblbenchmarksize.caption
msgid "Benchmark data size: %d MB"
msgstr ""
#: tfrmbenchmark.stgresult.columns[0].title.caption
msgid "Hash"
msgstr ""
#: tfrmbenchmark.stgresult.columns[1].title.caption
msgid "Time (ms)"
msgstr ""
#: tfrmbenchmark.stgresult.columns[2].title.caption
msgid "Speed (MB/s)"
msgstr ""
#: tfrmchecksumcalc.caption
msgctxt "TFRMCHECKSUMCALC.CAPTION"
msgid "Calculate checksum..."
msgstr "Ellenőrző összeg számítása..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr ""
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "&Külön MD5/SHA1 készítése fájlonként"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "&Ellenőrzőösszeg(ek) mentése ide:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Bezárás"
#: tfrmchecksumverify.caption
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Ellenőrző összeg vizsgálata..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "Hozzáadás"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Mégsem"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "&Csatlakozás"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "&Törlés"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Szerkesztés"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Csatlakozás kezelő"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Csatlakozás ide :"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "&Sorbaállít"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "&Beállítások"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "&Ezen beállítások az alapértelmezettek"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Fájl(ok) másolása"
#: tfrmcopydlg.mnunewqueue.caption
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Új sorbaállítás"
#: tfrmcopydlg.mnuqueue1.caption
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Sorbaállítás 1"
#: tfrmcopydlg.mnuqueue2.caption
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Sorbaállítás 2"
#: tfrmcopydlg.mnuqueue3.caption
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Sorbaállítás 3"
#: tfrmcopydlg.mnuqueue4.caption
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Sorbaállítás 4"
#: tfrmcopydlg.mnuqueue5.caption
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Sorbaállítás 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Leírás mentése"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Fájl/Könyvtár megjegyzés"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "&Megjegyzés szerkesztése :"
#: tfrmdescredit.lblencoding.caption
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "&Kódolás :"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "Névjegy"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Automatikus összehasonlítás"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Bináris mód"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Mégsem"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Mégsem"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Jobbra másolás"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Jobbra másolás"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Balra másolás"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Balra másolás"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Másolás"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Kivágás"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Törlés"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Beillesztés"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Ismét"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "&Mind kiválasztása"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Visszavonás"
#: tfrmdiffer.actexit.caption
msgctxt "TFRMDIFFER.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Kilépés"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION"
msgid "First Difference"
msgstr "Első különbség"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Első különbség"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Karakterkészlet figyelmen kívül hagyása"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Üres helyek figyelmen kívül hagyása"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Folyamatos görgetés"
#: tfrmdiffer.actlastdifference.caption
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION"
msgid "Last Difference"
msgstr "Utolsó különbség"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Utolsó különbség"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Sor különbségek"
#: tfrmdiffer.actnextdifference.caption
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION"
msgid "Next Difference"
msgstr "Következő különbség"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Következő különbség"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Bal oldali megnyitása..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Jobb oldali megnyitása..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Háttér befestése"
#: tfrmdiffer.actprevdifference.caption
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION"
msgid "Previous Difference"
msgstr "Előző különbség"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Előző különbség"
#: tfrmdiffer.actreload.caption
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
msgid "&Reload"
msgstr "Új&ratölt"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Újratölt"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Mentés"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Mentés"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Mentés másként..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Mentés másként..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Bal oldali mentése"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Bal oldali mentése"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Bal oldali mentése másként..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Bal oldali mentése másként..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Jobb oldali mentése"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Jobb oldali mentése"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Jobb oldali mentése másként..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Jobb oldali mentése másként..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Összehasonlítás"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Összehasonlítás"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Kódolás"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Kódolás"
#: tfrmdiffer.caption
msgctxt "TFRMDIFFER.CAPTION"
msgid "Compare files"
msgstr "Fájlok összehasonlítása"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Bal"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "&Jobb"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Műveletek"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "Sz&erkesztés"
#: tfrmdiffer.mnuencoding.caption
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "&Kódolás"
#: tfrmdiffer.mnufile.caption
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "&Fájl"
#: tfrmdiffer.mnuoptions.caption
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
msgid "&Options"
msgstr "&Beállítások"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Új gyorsbillentyű hozzáadása a sorozathoz"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Utolsó gyorsbillentyű eltávolítása a sorozatból"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION"
msgid "Only for these controls"
msgstr "Csak ezekhez a vezérlésekhez"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Paraméterek (mind külön sorban) :"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Gyorsbillentyűk :"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "Névjegy"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "Névjegy"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Konfiguráció"
#: tfrmeditor.actconfhigh.hint
msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT"
msgid "Configuration"
msgstr "Beállítás"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Másolás"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Másolás"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Kivágás"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Kivágás"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Törlés"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Törlés"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Keresés"
#: tfrmeditor.acteditfind.hint
msgctxt "TFRMEDITOR.ACTEDITFIND.HINT"
msgid "Find"
msgstr "Keresés"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Következő keresése"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Következő keresése"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Előző keresése"
#: tfrmeditor.acteditgotoline.caption
msgctxt "tfrmeditor.acteditgotoline.caption"
msgid "Goto Line..."
msgstr "Sorra ugrás..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Beillesztés"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Beillesztés"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Ismét"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Ismét"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Helyettesítés"
#: tfrmeditor.acteditrplc.hint
msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT"
msgid "Replace"
msgstr "Csere"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Összes kiválasztás&a"
#: tfrmeditor.acteditselectall.hint
msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT"
msgid "Select All"
msgstr "Összes kijelölése"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Visszavonás"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Visszavonás"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Bezárás"
#: tfrmeditor.actfileclose.hint
msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT"
msgid "Close"
msgstr "Bezárás"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Kilépés"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Kilépés"
#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "Ú&j"
#: tfrmeditor.actfilenew.hint
msgctxt "TFRMEDITOR.ACTFILENEW.HINT"
msgid "New"
msgstr "Új"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Megnyitás"
#: tfrmeditor.actfileopen.hint
msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT"
msgid "Open"
msgstr "Megnyitás"
#: tfrmeditor.actfilereload.caption
#, fuzzy
msgctxt "tfrmeditor.actfilereload.caption"
msgid "Reload"
msgstr "Újratölt"
#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "Menté&s"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Mentés"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Men&tés másként..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Mentés másként"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Ö&sszes mentése"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Összes mentése"
#: tfrmeditor.caption
msgctxt "TFRMEDITOR.CAPTION"
msgid "Editor"
msgstr "Szerkesztő"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "&Súgó"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "S&zerkesztés"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Kó&dolás"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Megnyitás mint"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Mentés mint"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Fájl"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Szintaxis kiemelés"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Sor vége"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Kilépés"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
msgid "C&ase sensitivity"
msgstr "Karakterér&zékeny"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
msgid "S&earch from caret"
msgstr "Keresés a hiány&jeltől"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "&Reguláris kifejezések"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
msgid "Selected &text only"
msgstr "Csak a kiválasztott szöve&g"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
msgid "&Whole words only"
msgstr "Csak a &teljes szavak"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
msgid "Option"
msgstr "Opciók"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
msgid "&Replace with:"
msgstr "&Helyettesítés ezzel :"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
msgid "&Search for:"
msgstr "&Keresés :"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
msgid "Direction"
msgstr "Irány"
#: tfrmextractdlg.caption
msgctxt "TFRMEXTRACTDLG.CAPTION"
msgid "Unpack files"
msgstr "Fájlok kibontása"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "Ú&tvonalak kibontása ha a fájlnév tartalmazza"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Minden archívum kibontása külön &alkönyvtárakba (archívnév)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "Létező fájlok &felülírása"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Fájl kicsomagolása ide :"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "&Kibontandó fájlok :"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "Jelszó a titkosított fájl(ok)hoz :"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Bezárás"
#: tfrmfileexecuteyourself.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
msgid "Wait..."
msgstr "Várjon..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Fájl neve :"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "Innen :"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Kattintson a Bezárás gombra, ha az ideiglenes fájl törölhető!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&A panelbe"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Mind megtekintése"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Jelenlegi művelet :"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Innen :"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Eddig :"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Bezárás"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "&Tulajdonságok beállítása"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "&Minden kiválasztott fájlra"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "&Ezen fájl kihagyása"
#: tfrmfileproperties.caption
msgctxt "TFRMFILEPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Tulajdonságok"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Ragadós"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Tulajdonos"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitek :"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Csoport"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Egyéb"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Tulajdonos"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Szöveges megfelelő :"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Tartalmaz :"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Végrehajtás"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Fájl néve"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Fájl neve"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Útvonal :"
#: tfrmfileproperties.lblgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
msgid "&Group"
msgstr "&Csoport"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Utolsó hozzáférés :"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Utolsó módosítás :"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Legutóbbi állapotváltozás :"
#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Oktális :"
#: tfrmfileproperties.lblownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
msgid "O&wner"
msgstr "&Tulajdonos"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Olvasás"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Méret :"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Szimbolikus hivatkozás :"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Típus :"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Írás"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Név"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Érték"
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attribútumok"
#: tfrmfileproperties.tsplugins.caption
#, fuzzy
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Beépülők"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Tulajdonságok"
#: tfrmfileunlock.btnclose.caption
#, fuzzy
msgctxt "tfrmfileunlock.btnclose.caption"
msgid "Close"
msgstr "Bezárás"
#: tfrmfileunlock.btnterminate.caption
msgid "Terminate"
msgstr ""
#: tfrmfileunlock.btnunlock.caption
msgctxt "tfrmfileunlock.btnunlock.caption"
msgid "Unlock"
msgstr ""
#: tfrmfileunlock.btnunlockall.caption
msgid "Unlock All"
msgstr ""
#: tfrmfileunlock.caption
msgctxt "tfrmfileunlock.caption"
msgid "Unlock"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[0].title.caption
msgid "File Handle"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[1].title.caption
msgid "Process ID"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[2].title.caption
msgid "Executable Path"
msgstr ""
#: tfrmfinddlg.actcancel.caption
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "&Mégsem"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "&Bezárás"
#: tfrmfinddlg.actclose.caption
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "Bezárás"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Szerkesztés"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "&Ablakba"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Ugrás fájlhoz"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Adat keresése"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Utolsó keresés"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "Ú&j keresés"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr ""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr ""
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr ""
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr ""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr ""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Indítás"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Nézőke"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Hozzáadás"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Súgó"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "Menté&s"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Törlés"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "Be&töltés"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "M&entés"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Me&ntés ezzel \"Indítás a mappába\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Ha el van mentve \"Indítás a mappában\", akkor vissza lesz állítva a sablon betöltésekor. Használja akkor, ha szeretné rögzíteni a keresést egy adott mappában"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Sablon használata"
#: tfrmfinddlg.caption
msgctxt "TFRMFINDDLG.CAPTION"
msgid "Find files"
msgstr "Fájlok keresése"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Kisbetű/Nagybetű érzékeny"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "&Dátumtól :"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Dá&tumig :"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "&Fájlmérettől :"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Fá&jlméretig :"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "&Archívumban keres"
#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "&Keresés fájlban"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION"
msgid "Follow s&ymlinks"
msgstr "&Szimbolikus hivatkozás követése"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "A szöveget &NEM tartalmazó fájlok keresése"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Nem régebbi mint :"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Megnyitott fülek"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Keresés fájlnév &részletre"
#: tfrmfinddlg.cbregexp.caption
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "&Reguláris kifejezések"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "Szöveg &helyettesítése"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Kiválasztott mappák és &fájlok"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "R&eguláris kifejezés"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "&Időtől :"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "I&dőig :"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "Kereső &beépülő használata :"
#: tfrmfinddlg.chkhex.caption
msgid "Hexadecimal"
msgstr ""
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Írja be a mappák nevét amelyeket kizár a keresésből, \";\" az elválasztó"
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Írja be a fájlok nevét amelyeket kizár a keresésből, \";\" az elválasztó"
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Írja be a fájlok nevét, \";\" az elválasztó"
#: tfrmfinddlg.gbdirectories.caption
msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION"
msgid "Directories"
msgstr "Mappák"
#: tfrmfinddlg.gbfiles.caption
msgctxt "TFRMFINDDLG.GBFILES.CAPTION"
msgid "Files"
msgstr "Fájlok"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Adat keresése"
#: tfrmfinddlg.lblattributes.caption
msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION"
msgid "Attri&butes"
msgstr "Attri&bútumok"
#: tfrmfinddlg.lblencoding.caption
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
msgid "Encodin&g:"
msgstr "&Kódolás :"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "&Almappák kizárása"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Fájlok kizárása"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "&Fájl maszk"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "&Indítás a mappában"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "&Alkönyvtárak keresése :"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Előző keresések :"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Megnyitás új fülön"
#: tfrmfinddlg.mioptions.caption
#, fuzzy
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Opciók"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Eltávolít a listáról"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Minden megtalált elem megjelenítése"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Szerkesztőben mutat"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Megjelenítés a nézőkében"
#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Nézőke"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Haladó"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Betölt/Ment"
#: tfrmfinddlg.tsplugins.caption
msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Beépülők"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Eredmények"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Alap"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Keresés"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Keresés"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "K&arakterérzékeny"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Hardlink készítése"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Létező cél (erre fog mutatni a hivatkozás)"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "&Hivatkozás neve"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr "Mind importálása!"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr "Kiválasztott importálása"
#: tfrmhotdirexportimport.caption
msgctxt "tfrmhotdirexportimport.caption"
msgid "Select the entries your want to import"
msgstr "Válassza ki az elemeket amiket importálni szeretne"
#: tfrmhotdirexportimport.lbhint.caption
msgctxt "tfrmhotdirexportimport.lbhint.caption"
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr ""
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr ""
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgctxt "TFRMLINKER.CAPTION"
msgid "Linker"
msgstr "Linker"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Mentés másként..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Tétel"
#: tfrmlinker.lblfilename.caption
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "&Fájl neve"
#: tfrmlinker.spbtndown.caption
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "&Le"
#: tfrmlinker.spbtndown.hint
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
msgid "Down"
msgstr "Le"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "&Eltávolítás"
#: tfrmlinker.spbtnrem.hint
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "Törlés"
#: tfrmlinker.spbtnup.caption
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "&Fel"
#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Fel"
#: tfrmmain.actabout.caption
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
msgid "&About"
msgstr "&Névjegy"
#: tfrmmain.actactivatetabbyindex.caption
msgid "Activate Tab By Index"
msgstr ""
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Fájlnév hozzáadása a parancssorhoz"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Útvonal és fájlnév hozzáadása a parancssorhoz"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Útvonal másolása parancssorba"
#: tfrmmain.actbenchmark.caption
msgid "&Benchmark"
msgstr ""
#: tfrmmain.actbriefview.caption
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr "Rövid nézet"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Rövid nézet"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Elfoglalt &terület számítása..."
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Könyvtár cseréje"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Főkönyvtárba váltás"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Szülő könyvtárra cserél"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Gyökér könyvtárra cserél"
#: tfrmmain.actchecksumcalc.caption
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "Ellenőrző összeg számítása..."
#: tfrmmain.actchecksumverify.caption
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "Ellenőrző összeg &vizsgálata..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Naplófájl űrítése"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Naplóablak űrítése"
#: tfrmmain.actclosealltabs.caption
msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION"
msgid "Close &All Tabs"
msgstr "Ö&sszes fül bezárása"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Kettőzött fülek bezárása"
#: tfrmmain.actclosetab.caption
msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION"
msgid "&Close Tab"
msgstr "&Fül bezárása"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Következő parancssor"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Parancssor beállítása a következő parancsra az előzményekből"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Előző parancssor"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Parancssor beállítása a előző parancsra az előzményekből"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Teljes"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Oszlopnézet"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Összehasonlítás &tartalom alapján"
#: tfrmmain.actcomparedirectories.caption
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
msgid "Compare Directories"
msgstr "Mappák összehasonlítása"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Mappák összehasonlítása"
#: tfrmmain.actconfigarchivers.caption
msgid "Configuration of Archivers"
msgstr ""
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Kedvenc könyvtárak beállítása"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Kedvenc fülek beállítása"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr ""
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigplugins.caption
msgid "Configuration of Plugins"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Beállítások mentése"
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Eszköztár..."
#: tfrmmain.actconfigtooltips.caption
msgid "Configuration of tooltips"
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Fa nézet menü beállítása"
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Fa nézet menü színeinek beállítása"
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Helyi menü megjelenítése"
#: tfrmmain.actcopy.caption
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Másolás"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr ""
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Minden látható oszlop más&olása"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Fájlnév másolása &teljes elérési úttal"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Fájlnév másolása a &vágólapra"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Megerősítés nélküli másolás"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr ""
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr ""
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Másolás ugyanarra a panelre"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Másolás"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Elfoglalt &terület megjelenítése"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "&Kivágás"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr ""
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Törlés"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "Könyvtár előzmények"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Kedvenc &könyvtárak"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr ""
#: tfrmmain.actedit.caption
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Szerkeszt"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Megjegyzés s&zerkesztése..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Új fájl szerkesztése"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Útvonalmező szerkesztése a fájl felett"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Panelek &cseréje"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Kilépés"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "Fájlok &kibontása..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Fájl&társítások beállítása"
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "&Fájlegyesítés..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "&Fájl tulajdonságainak megjelenítése"
#: tfrmmain.actfilespliter.caption
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
msgid "Spl&it File..."
msgstr "Fájl szele&telése"
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "&Lapos nézet"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Parancssorra fókuszálás"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actfocustreeview.caption
msgid "Focus on tree view"
msgstr ""
#: tfrmmain.actfocustreeview.hint
msgid "Switch between current file list and tree view (if enabled)"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Kurzor helyezése az első fájlra"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Kurzor helyezése az utolsó fájlra"
#: tfrmmain.acthardlink.caption
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
msgid "Create &Hard Link..."
msgstr "&Hivatkozás létrehozása..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Tartalomjegyzék"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "&Vízszintes elrendezés"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "Billentyűzet"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Rövid nézet a bal panelben"
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Oszlopos nézet a bal panelben"
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Bal &= Jobb"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "&Lapos nézet a bal panelben"
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Baloldali meghajtólista megnyitása"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Ki&jelölés megfordítása a bal panelben"
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Bal panel rendezése &attribútum szerint"
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Bal panel rendezése &dátum szerint"
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "Bal panel rendezése &kiterjesztés szerint"
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "Bal panel rendezése &név szerint"
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Bal panel rendezése &méret szerint"
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Miniatűrök mutatása a bal panelben"
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr ""
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Kiválasztás betöltése a &vágólapról"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "Kiválasztás betöltése &fájlból"
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "Fülek betöltése fájlból"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "Új könyvtár"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Minden &azonos kiterjesztésű kijelölése"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "Kijelölés meg&fordítása"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "&Minden kiválasztása"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "&Csoportos kijelölés megszüntetése"
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "Csoport &kijelölése"
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "Összes kijelölés me&gszüntetése"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Kis méret"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Csoportos át&nevezés"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Hálózati &csatlakozás..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "Hálózati &szétkapcsolás"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Hálózati &gyors csatlakozás..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "Új &fül"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Váltás a &következő fülre"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Megnyitás"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Archív megnyitásának kísérlete"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Sávfájl megnyitása"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "&Mappa megnyitása új fülön"
#: tfrmmain.actopendrivebyindex.caption
msgid "Open Drive by Index"
msgstr ""
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
msgid "Open &VFS List"
msgstr "&VFS lista megnyitása"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "&Műveletek nézőke"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Beállítások..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "Fájlok &tömörítése..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Elválasztó pozíciójának beállítás"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "&Beillesztés"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Váltás az &előző fülre"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Gyors szűrő"
#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Gyorskeresés"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "&Gyorsnézőke panel"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Frissítés"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Áthely/Átnev."
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Fájlok mozgatása/átnevezése megerősítő kérdés nélkül"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Átnevezés"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "Fül át&nevezése"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "Kijelölt &visszaállítása"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "For&dított sorrend"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Rövid nézet a jobb panelben"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Oszlopos nézet a jobb panelben"
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Jobb &= Bal"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "&Sima nézet a jobb panelben"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Jobboldali meghajtólista megnyitása"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "Ki&jelölés megfordítása a jobb panelben"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Jobb panel rendezése &attribútum szerint"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Jobb panel rendezése &dátum szerint"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Jobb panel rendezése &kiterjesztés szerint"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Jobb panel rendezése &név szerint"
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Jobb panel rendezése &méret szerint"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Miniatűrök mutatása a jobb panelben"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "&Terminál futtatása"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr ""
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Kiválasztott men&tése"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Kiválasztott m&entése fájlba..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "Fülek mentése fájlba"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Keresés..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr ""
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Minden fül feloldása"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Minden fül zárolása"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr ""
#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "&Attribútumok cseréje..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Zárolva ezzel : ú&j füleken megnyitott könyvtárak"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Rendes"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Zárolt"
#: tfrmmain.actsettaboptionpathresets.caption
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
msgid "Locked with &Directory Changes Allowed"
msgstr "Zárolva ezzel : könyvár &változások engedélyezése"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Megnyitás"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Megnyitás a rendszertársítottal"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Gyorsgomb menü megjelenítése"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Parancssori előzmények megjelenítése"
#: tfrmmain.actshowmainmenu.caption
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Menü"
#: tfrmmain.actshowsysfiles.caption
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "Rejtett/Rendszer fájlok &megjelenítése"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Rendezés &attribútumok szerint"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Rendezés &dátum szerint"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Rendezés &kiterjesztés szerint"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Rendezés &név szerint"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Rendezés &méret szerint"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Meghajtólista megnyitása"
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Kihagyási lista engedélyezése/kikapcsolása, hogy nem mutatja fájlneveket"
#: tfrmmain.actsymlink.caption
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "&Szimbolikus hivatkozás készítése.."
#: tfrmmain.actsyncdirs.caption
msgid "Syn&chronize dirs..."
msgstr "Könyvtárak szinkronizálása...."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Cél &= Forrás"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "A&rchívum(ok) tesztelése"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Miniatűrök"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Bélyegkép-nézet"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr ""
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Kurzor alatti mappa küldése a bal ablakba"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Kurzor alatti mappa küldése a jobb ablakba"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "&Fa nézet panel"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr ""
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Összes azonos kiterjesztésű kijelölésének megszüntetése"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Nézőke"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Aktív nézet előzményeinek megtekintése"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Következő előzményre ugrik"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Előző előzményre ugrik"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Naplófájl megtekintése"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Látogassa meg a Double Commander honlapját"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Eltöröl"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr ""
#: tfrmmain.btnf10.caption
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Kilépés"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Könyvtár"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Törlés"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminál"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Kedvenc könyvtárak"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "A jelenlegi jobb oldali könyvtár megtekintése a bal ablakban"
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
msgid "Go to home directory"
msgstr "Ugrás a saját mappába"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
msgid "Go to root directory"
msgstr "Ugrás a gyökérkönyvtárba"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
msgid "Go to parent directory"
msgstr "Ugrás a szülőkönyvtárba"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Kedvenc könyvtárak"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "A jelenlegi bal oldali könyvtár megtekintése a jobb ablakban"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Útvonal"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Mégsem"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Másolás..."
#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Hivatkozás készítése..."
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Ürítés"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Másolás"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Elrejtés"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Összes kijelölése"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Áthelyezés..."
#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Szimbolikus hivatkozás készítése..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Fül beállítások"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Kilépés"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Visszaállítás"
#: tfrmmain.mnualloperpause.caption
msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Indítás"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Mégsem"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Parancsok"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "&Beállítások"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Kedvencek"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "Fájlok"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "&Súgó"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Megjelölés"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Hálózat"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Nézet"
#: tfrmmain.mnutaboptions.caption
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "&Fül beállítások"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Fülek"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Másolás"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Kivágás"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Törlés"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Szerkesztés"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Beillesztés"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmmaincommandsdlg.caption
msgctxt "tfrmmaincommandsdlg.caption"
msgid "Select your internal command"
msgstr ""
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Régebbi elrendezés"
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr "Régebbi elrendezés"
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Alapértelmezetten minden kategória kiválasztása"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Kiválasztás:"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "&Kategóriák:"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "Parancs &neve:"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Szűrő:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Tipp:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Gyorsbillentyű:"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr "cm_name"
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "Kategória"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Súgó"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Tipp"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Gyorsbillentyű"
#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Hozzáadás"
#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "&Súgó"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Meghatároz..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Karakterérzékeny"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Maszk bevitele :"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "&vagy válasszon előre meghatározott kiválasztási típust :"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Új könyvtár létrehozása"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "Adja meg az új könyvtár nevét :"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "TFRMMODVIEW.CAPTION"
msgid "New Size"
msgstr "Új méret"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Magasság :"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgctxt "tfrmmodview.lblpath2.caption"
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgctxt "tfrmmodview.lblpath3.caption"
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "JPG-be való sűrítés minősége"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Szélesség :"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Magasság"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Szélesség"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr "456456465465465"
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Bezárás"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Törlés"
#: tfrmmultirename.btnedit.caption
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "&Szerkesztés"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "Betö&ltés"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "Átnevezés (&R)"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Mind visszaállítása"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "Menté&s"
#: tfrmmultirename.caption
msgctxt "TFRMMULTIRENAME.CAPTION"
msgid "MultiRename"
msgstr "Csoportos Átnevező"
#: tfrmmultirename.cblog.caption
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "E&ngedélyez"
#: tfrmmultirename.cbregexp.caption
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "&Reguláris kifejezések"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "&Helyettesítések használata"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Kiterjesztés"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Számláló"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Keresés && Csere"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Eredmény naplózása"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Maszk"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Előre beállított"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "&Kiterjesztés"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "&Keresés..."
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "&Intervallum"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "Fájl &neve"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "&Csere..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "&Kezdőszám"
#: tfrmmultirename.lbwidth.caption
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "&Szélesség"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Számláló"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Nap"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Nap (2 számjegy)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] A hét neve (röviden, pl : \"hét\")"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] A hét neve (hosszan, pl : \"hétfő\")"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Kiterjesztés"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Kiterjesztés"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Óra"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Óra (2 számjegy)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Perc"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Perc (2 számjegy)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Hónap"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Hónap (2 számjegy)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Hónap neve (röviden, pl : \"jan\")"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Hónap neve (hosszan, pl : \"január\")"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Név"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Név"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:x] Név"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Idő..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Kiterjesztés..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Név..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Beépülő"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Másodperc"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Másodperc (2 számjegy)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Év (2 számjegy)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Év (4 számjegy)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Nevek szerkesztése..."
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Nevek betöltése fájlból..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "---"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION"
msgid "Old File Name"
msgstr "Fájl régi neve"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION"
msgid "New File Name"
msgstr "Fájl új neve"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION"
msgid "File Path"
msgstr "Fájl útvonala"
#: tfrmmultirenamewait.caption
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Alkalmazás kiválasztása"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Egyéni parancs"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Társítások mentése"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Kiválasztott alkalmazások az alapértelmezettek"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Fájltípus legyen megnyitva : %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Összetett fájl nevek"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Összetett URI-k"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Egyszerű fájlnév"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "Egyszerű URI"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
msgid "&Apply"
msgstr "&Alkalmaz"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmoptions.caption
msgctxt "TFRMOPTIONS.CAPTION"
msgid "Options"
msgstr "Opciók"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Kérem, válasszon egyet az aloldalak közül, ez az oldal nem tartalmaz beállításokat"
#: tfrmoptionsarchivers.btnarchiveradd.caption
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
msgid "A&dd"
msgstr "&Hozzáadás"
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverapply.caption
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
msgid "A&pply"
msgstr "&Alkalmaz"
#: tfrmoptionsarchivers.btnarchivercopy.caption
msgctxt "tfrmoptionsarchivers.btnarchivercopy.caption"
msgid "Cop&y"
msgstr "Másolás"
#: tfrmoptionsarchivers.btnarchiverdelete.caption
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
msgid "Delete"
msgstr "&Törlés"
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverother.caption
msgctxt "tfrmoptionsarchivers.btnarchiverother.caption"
msgid "Oth&er..."
msgstr "Egyéb..."
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverrename.caption
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
msgid "&Rename"
msgstr "Át&nevezés"
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiverids.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
msgid "Options:"
msgstr "Opciók:"
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
msgid "Format parsing mode:"
msgstr "Formátum értelmezési mód :"
#: tfrmoptionsarchivers.chkarchiverenabled.caption
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
msgid "E&nabled"
msgstr "E&ngedélyezve"
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
msgid "De&bug mode"
msgstr "&Hibakereső mód"
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
msgid "S&how console output"
msgstr "Konzol kimenet megjelenítése"
#: tfrmoptionsarchivers.chkfilenameonlylist.caption
msgid "Use archive name without extension as list"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
msgid "Uni&x file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
msgid "&Unix path delimiter \"/\""
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
msgid "Windows &file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
msgid "Windows path deli&miter \"\\\""
msgstr ""
#: tfrmoptionsarchivers.lblarchiveradd.caption
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
msgid "Add&ing:"
msgstr "Hozzá&adás"
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
msgid "Arc&hiver:"
msgstr "Tö&mötírő :"
#: tfrmoptionsarchivers.lblarchiverdelete.caption
msgid "De&lete:"
msgstr "Törlés :"
#: tfrmoptionsarchivers.lblarchiverdescription.caption
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
msgid "De&scription:"
msgstr "Leírá&s :"
#: tfrmoptionsarchivers.lblarchiverextension.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
msgid "E&xtension:"
msgstr "&Kiterjesztés :"
#: tfrmoptionsarchivers.lblarchiverextract.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
msgid "Ex&tract:"
msgstr "Ki&bont :"
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
msgid "Extract &without path:"
msgstr "Útvonal nélküli kibontás"
#: tfrmoptionsarchivers.lblarchiveridposition.caption
msgid "ID Po&sition:"
msgstr "ID pozíció :"
#: tfrmoptionsarchivers.lblarchiverids.caption
msgid "&ID:"
msgstr "ID : "
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
msgid "ID See&k Range:"
msgstr "ID keresési taromány :"
#: tfrmoptionsarchivers.lblarchiverlist.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
msgid "&List:"
msgstr "&Lista :"
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
msgid "Archi&vers:"
msgstr "Archívumok:"
#: tfrmoptionsarchivers.lblarchiverlistend.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
msgid "Listing &finish (optional):"
msgstr "Listázás &befejezve (választható) :"
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
msgid "Listing for&mat:"
msgstr "Listázási for&mátum :"
#: tfrmoptionsarchivers.lblarchiverliststart.caption
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
msgid "Listin&g start (optional):"
msgstr "Listázás &kezdése (választható) :"
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
msgid "Password &query string:"
msgstr "Jelszó kérdező sztring :"
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
msgid "Create self extractin&g archive:"
msgstr "Önkioldó archívum létrehozása :"
#: tfrmoptionsarchivers.lblarchivertest.caption
msgid "Tes&t:"
msgstr "Próba :"
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
msgid "Auto Configure"
msgstr "A&utomatikus beállítás"
#: tfrmoptionsarchivers.miarchiverdisableall.caption
msgid "Disable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
msgid "Discard modifications"
msgstr ""
#: tfrmoptionsarchivers.miarchiverenableall.caption
msgid "Enable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverexport.caption
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
msgid "Export..."
msgstr "Exportálás..."
#: tfrmoptionsarchivers.miarchiverimport.caption
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
msgid "Import..."
msgstr "Importálás..."
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
msgid "Sort archivers"
msgstr ""
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
msgid "Additional"
msgstr "További"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
msgid "General"
msgstr "Általános"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
msgid "When &size, date or attributes change"
msgstr "Méret, dátum vagy attribútum változása esetén is"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "A következő útvonalakhoz és az alma&ppáikhoz :"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
msgid "When &files are created, deleted or renamed"
msgstr "Frissítés fájlok létrehozása, törlése és átnevezése esetén"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
msgid "When application is in the &background"
msgstr "Amikor az alkalmazás a &háttérben fut"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
msgid "Disable auto-refresh"
msgstr "Auto-frissítés kikapcsolása"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
msgid "Refresh file list"
msgstr "Fájl lista frissítése"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
msgid "Al&ways show tray icon"
msgstr "Mindig mutatja a tálca ikont"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "&Nem csatlakoztatott eszközök automatikus elrejtése"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
msgid "Mo&ve icon to system tray when minimized"
msgstr "&Ikon tálcára minimalizálása"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
msgid "A&llow only one copy of DC at a time"
msgstr "cs&ak 1 DC futhat"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Ide beírhat egy vagy több meghajtót vagy csatolási pontot, elkülönítve ezzel : \";\""
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Meghajtó &feketelista"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Oszlopméret"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Fájl kiterjesztésének megjelenítése"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "i&gazított (füllel)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "közvetlen a &fájlnév után"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Automatikus"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Rögzített oszlop számozással"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Rögzített oszlop hosszúsággal"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBCUTTEXTTOCOLWIDTH.CAPTION"
msgid "Cut &text to column width"
msgstr "Szöveg &vágása az oszlop szélességéhez"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDHORZLINE.CAPTION"
msgid "&Horizontal lines"
msgstr "&Vízszintes vonalak"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDVERTLINE.CAPTION"
msgid "&Vertical lines"
msgstr "&Függőleges vonalak"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CHKAUTOFILLCOLUMNS.CAPTION"
msgid "A&uto fill columns"
msgstr "Automatikus oszlop kitöltés"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Rácsok megjelenítése"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Automatikus oszlopméret"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.LBLAUTOSIZECOLUMN.CAPTION"
msgid "Auto si&ze column:"
msgstr "Automatikus os&zlopméret :"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "&Alkalmaz"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "S&zerkesztés"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBCMDLINEHISTORY.CAPTION"
msgid "Co&mmand line history"
msgstr "Parancssori előz&mények"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
msgid "&Directory history"
msgstr "&Könyvtár előzmények"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBFILEMASKHISTORY.CAPTION"
msgid "&File mask history"
msgstr "&Fájlmaszk előzmények"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSAVECONFIGURATION.CAPTION"
msgid "Sa&ve configuration"
msgstr "B&eállítások mentése"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSEARCHREPLACEHISTORY.CAPTION"
msgid "Searc&h/Replace history"
msgstr "Keresés/Csere előzmé&nyek"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Mappák"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgctxt "TFRMOPTIONSCONFIGURATION.GBLOCCONFIGFILES.CAPTION"
msgid "Location of configuration files"
msgstr "Konfigurációs állományok helye"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.GBSAVEONEXIT.CAPTION"
msgid "Save on exit"
msgstr "Mentés kilépéskor"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr ""
#: tfrmoptionsconfiguration.gpconfigurationtreestate.caption
msgid "Tree state when entering in configuration page"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgctxt "TFRMOPTIONSCONFIGURATION.LBLCMDLINECONFIGDIR.CAPTION"
msgid "Set on command line"
msgstr "Állítsa be a parancssorra"
#: tfrmoptionsconfiguration.lblhighlighters.caption
msgid "Highlighters:"
msgstr ""
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgctxt "TFRMOPTIONSCONFIGURATION.RBPROGRAMDIR.CAPTION"
msgid "P&rogram directory (portable version)"
msgstr "P&rogram könyvtár (hordozható változat)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgctxt "TFRMOPTIONSCONFIGURATION.RBUSERHOMEDIR.CAPTION"
msgid "&User home directory"
msgstr "Felhasználó &saját könyvtára"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Mind"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr "Módosítás mentése az összes oszlophoz"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "&Törlés"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Alapértelmezett beállításokhoz ugrik"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Új"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "Következő"
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "Előző"
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Átnevezés"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr "Visszaállítás"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Mentés mint"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "Mentés"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Átszínezés engedélyezése"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr ""
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "Általános"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Kurzor szegélye"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Keret színének használata"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Inaktív kiválasztási szín használata"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Fordított kijelölés használata"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Egyedi betűtípus és szín használata"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "Háttér 1 :"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Háttér 2 :"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCONFIGCOLUMNS.CAPTION"
msgid "Con&figure columns view:"
msgstr "&Oszlopnézet beállítása:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Jelenlegi oszlop neve]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "Kurzorszín :"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Kurzor szöveg :"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Betűtípus :"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Méret :"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "Szöveg színe :"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Inaktív kurzor színe :"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Inaktív jelölő színe :"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "Jelölő színe :"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Oszlop beállítása:"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Oszlop hozzáadása"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Elválasztó hozzáadása"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Teljes összezárás"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Kiválasztott elem törlése"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Hozzáad..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Biztonsági mentés..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Törlés..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Exportálás..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "Súgó"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Importálás..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Beszúrás..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "Egyéb..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
msgid "Some functions to select appropriate target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Rendezés..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Fa állandó kitárása"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Név, a-z"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
msgid "Name, a-z"
msgstr "Név, a-z"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "További opciók"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
msgid "Name:"
msgstr "Név :"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
msgid "Path:"
msgstr "Útvonal :"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
msgid "&Target:"
msgstr "Célpont:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to &configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr ""
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Keresés és csere..."
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "minden, A-től Z-ig!"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr "Kapott menü tesztelése"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr ""
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Megerő&sítő ablak megjelenítése \"ejtés\" után"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr ""
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr ""
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "&Fájlrendszer megjelenítése"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Szabad t&erület megjelenítése"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Címke megje&lenítése"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Meghajtólista"
#: tfrmoptionseditor.chkautoindent.caption
msgid "Auto Indent"
msgstr ""
#: tfrmoptionseditor.chkautoindent.hint
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
msgstr ""
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Sorvége utáni görgetés"
#: tfrmoptionseditor.chkscrollpastendline.hint
msgid "Allows caret to go into empty space beyond end-of-line position"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Speciális karaktekek megjelenítése"
#: tfrmoptionseditor.chkshowspecialchars.hint
msgid "Shows special characters for spaces and tabulations"
msgstr ""
#: tfrmoptionseditor.chksmarttabs.caption
msgid "Smart Tabs"
msgstr ""
#: tfrmoptionseditor.chksmarttabs.hint
msgid "When using <Tab> key, caret will go to the next non-space character of the previous line"
msgstr ""
#: tfrmoptionseditor.chktabindent.caption
msgid "Tab indents blocks"
msgstr ""
#: tfrmoptionseditor.chktabindent.hint
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.caption
msgid "Use spaces instead tab characters"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.hint
msgid "Converts tab characters to a specified number of space characters (when entering)"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.caption
msgid "Delete trailing spaces"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.hint
msgid "Auto delete trailing spaces, this applies only to edited lines"
msgstr ""
#: tfrmoptionseditor.edtabwidth.hint
msgctxt "tfrmoptionseditor.edtabwidth.hint"
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Belső szerkesztő beállításai"
#: tfrmoptionseditor.lbltabwidth.caption
msgid "Tab width:"
msgstr ""
#: tfrmoptionseditor.lbltabwidth.hint
msgctxt "tfrmoptionseditor.lbltabwidth.hint"
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Hát&tér"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "Hát&tér"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Visszaállítás"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
msgid "Save"
msgstr "Mentés"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Elem attribútumai"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Előté&r"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "Előté&r"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "S&zöveg-megjelölés"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "&Globalis vázlat használata (és módosítása)"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "He&lyi vázlat használata"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Félkövér"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "&Fordított"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Ki"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "&Be"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Dőlt"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "&Fordított"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Ki"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "&Be"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "Á&thúzott"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "&Fordított"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Ki"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "&Be"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "&Aláhúzott"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "&Fordított"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "&Ki"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "&Be"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr "Hozzáad..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr "Törlés..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Importálás/Exportálás"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr "Beszúrás..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Átnevezés"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr "Rendezés..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Semmi"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr "Fa állandó kitárása"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Nem"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Bal"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Jobb"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr "További opciók"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Létező fülek megtartása:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Mappaelőzmények mentése"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr "elválasztó"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Elválasztó hozzáadása"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr "al-menü"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr "Al-menü hozzáadása"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr "Teljes összezárás"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Kivágás"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr "mind törlése!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr "al-menü minden elemmel"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr "csak al-menü, de az elemek megtartása"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr "kiválasztott elem"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr "Kiválasztott elem törlése"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr ""
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Elválasztó beszúrása"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Al-menü hozzáadása"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Beillesztés"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Átnevezés"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr "minden, A-től Z-ig!"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr "Kapott menü tesztelése"
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Hozzáadás"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "Add"
msgstr "&Hozzáadás"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "Hozzáa&dás"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "C&lone"
msgstr "Klónozás"
#: tfrmoptionsfileassoc.btncommands.hint
msgctxt "tfrmoptionsfileassoc.btncommands.hint"
msgid "Select your internal command"
msgstr ""
#: tfrmoptionsfileassoc.btndownact.caption
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "Do&wn"
msgstr "&Le"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edi&t"
msgstr "Szerkesztés"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Beszúrás"
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "&Insert"
msgstr "Beszúrás"
#: tfrmoptionsfileassoc.btnparametershelper.hint
msgctxt "tfrmoptionsfileassoc.btnparametershelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsfileassoc.btnrelativecommand.hint
msgctxt "tfrmoptionsfileassoc.btnrelativecommand.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsfileassoc.btnremoveact.caption
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
msgid "Remo&ve"
msgstr "&Eltávolítás"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
msgid "Re&move"
msgstr "&Eltávolítás"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "&Eltávolítás"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "Át&nevezés"
#: tfrmoptionsfileassoc.btnstartpathpathhelper.hint
msgctxt "tfrmoptionsfileassoc.btnstartpathpathhelper.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsfileassoc.btnstartpathvarhelper.hint
msgctxt "tfrmoptionsfileassoc.btnstartpathvarhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "&Fel"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr ""
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted (manually entering)."
msgstr ""
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description"
msgstr "Művelet leírása:"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Műveletek"
#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
msgid "Extensions"
msgstr "Kiterjesztések"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Fájltípusok"
#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
msgid "Icon"
msgstr "Ikon"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lblaction.caption
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
msgid "Action &name:"
msgstr "Művelet neve:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "Command:"
msgstr "&Parancs :"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Para&méterek:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Ki&induló útvonal :"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Egyéni ezzel..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Egyéni"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Szerkesztés"
#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
msgid "Open in Editor"
msgstr "Megnyitás szerkesztőben"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Módosítás ezzel..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
msgid "Get output from command"
msgstr "Parancs kimenetének kérése"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Megnyitás belső szerkesztőben"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Megnyitás belső nézőkében"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Megnyitás"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Megnyitás ezzel..."
#: tfrmoptionsfileassoc.mishell.caption
msgctxt "tfrmoptionsfileassoc.mishell.caption"
msgid "Run in terminal"
msgstr "Futtatás terminálban"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Nézőke"
#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
msgid "Open in Viewer"
msgstr "Megnyitás nézőkében"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Nézet ezzel..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Kattintson ide az ikon cseréléséhez!"
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "Futtatás rendszerhélyban"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Kibővített kontext menü"
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Fájltársítási beállítások"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "Futtatás terminálban és bezárás"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "Futtatás terminálban és nyitva tartás"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Elemek kibővített opciói:"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr "Megerősítő ablak megjelenítése:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Művelet &másolása"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Művelet &törlése"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDELETETOTRASH.CAPTION"
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "&F8/Del gomb a Kukába helyez (Shifttel együtt töröl)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "&Törlés a kukába művelet"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
msgid "D&rop readonly flag"
msgstr "Írásvédelmi attribútum elhagyása"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "&Mozgatás művelet"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBPROCESSCOMMENTS.CAPTION"
msgid "&Process comments with files/folders"
msgstr "Fájl/Könyvtár megjegyzések &feldolgozása"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBRENAMESELONLYNAME.CAPTION"
msgid "Select &file name without extension when renaming"
msgstr "Csak a &fájlnév kiválasztása átnevezés előtt (a kiterjesztést nem)"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSHOWCOPYTABSELECTPANEL.CAPTION"
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Fül kiválasztási panel megjelenítése a másol/áthelyez párbeszédablakban"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSKIPFILEOPERROR.CAPTION"
msgid "S&kip file operations errors and write them to log window"
msgstr "Fájlműveleti hibá&k átugrása és írja naplóablakba"
#: tfrmoptionsfileoperations.cbverifychecksumconfirmation.caption
msgid "Verify checksum operation"
msgstr ""
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Műveletek futtatása"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Felhasználói felület"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "&Pufferméret fájlműveletekhez (kB) :"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Mű&ködő műveletek megjelenítése"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr ""
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLWIPEPASSNUMBER.CAPTION"
msgid "&Number of wipe passes:"
msgstr "&Hányszoros legyen a végleges törlés??"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Visszaállítás DC alapértelmezettre"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Átszínezés engedélyezése"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEFRAMECURSOR.CAPTION"
msgid "Use &Frame Cursor"
msgstr "Kurz&orkeret használata"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "&Gradiens (lejtő) mutató használata"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Inaktív kiválasztási színt használja"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEINVERTEDSELECTION.CAPTION"
msgid "U&se Inverted Selection"
msgstr "Fordított kijelölé&s használata"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Kurzor szegélye"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
msgid "Drive Free Space Indicator"
msgstr "Meghajtón a szabad terület mutató"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR.CAPTION"
msgid "Bac&kground:"
msgstr "Hát&tér 1 :"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
msgid "Backg&round 2:"
msgstr "Hátté&r 2 :"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
msgid "C&ursor Color:"
msgstr "K&urzor színe :"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
msgid "Cursor Te&xt:"
msgstr "Kurzor s&zöveg :"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Inaktív kurzor színe :"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Inaktív jelölő színe :"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEPANELBRIGHTNESS.CAPTION"
msgid "&Brightness level of inactive panel"
msgstr "I&naktív panel fényereje"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Mutató háttér szí&ne :"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Mutató &előtér szí&ne :"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
msgid "&Mark Color:"
msgstr "&Jelölő színe :"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
msgid "T&ext Color:"
msgstr "Szövegszín :"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "Kere&sés fájlnév részletre"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr "Szöveg keresése a fájlokban"
#: tfrmoptionsfilesearch.gbfilesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Fájlkeresés"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr "Alapértelmezett keresési sablon:"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Memória térképezés has&ználata fájlokban történő kereséskor"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "Memóriafolyam haszná&lata fájlokban történő kereséskor"
#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "&Hozzáadás"
#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "&Súgó"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "&Ne töltse be addig a fájl listát amíg a fül aktív"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBDIRBRACKETS.CAPTION"
msgid "S&how square brackets around directories"
msgstr "Szö&gletes zárójel a könyvtárnevek körül"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Ú&j és frissített fájlok kiemelése"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr ""
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
msgid "Load &file list in separate thread"
msgstr "Fájl lista betöltése másik szálon"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
msgid "Load icons af&ter file list"
msgstr "Ikonok be&töltése a fájl lista után"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
msgid "Show s&ystem and hidden files"
msgstr "R&ejtett/Rendszer fájlok megjelenítése"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSPACEMOVESDOWN.CAPTION"
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Szó&közzel történő kijelöléskor automatikus léptetés (mint <INSERT> estén)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formatálás"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgctxt "TFRMOPTIONSFILESVIEWS.GBSORTING.CAPTION"
msgid "Sorting"
msgstr "Rendezés"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Karakterérzék&eny :"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Hibás formátum"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgctxt "TFRMOPTIONSFILESVIEWS.LBLDATETIMEFORMAT.CAPTION"
msgid "&Date and time format:"
msgstr "&Dátum és idő formátum :"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Fá&jlméret formátum :"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "Új fájl&ok beszúrása :"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Mappák &rendezése :"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgctxt "TFRMOPTIONSFILESVIEWS.LBLSORTMETHOD.CAPTION"
msgid "&Sort method:"
msgstr "Rendezé&si módszer :"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "Frissített fájlok &mozgatása :"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "Hozzáa&dás"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "&Alkalmaz"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "&Törlés"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Sablon..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.GBFILETYPESCOLORS.CAPTION"
msgid "File types colors (sort by drag&&drop)"
msgstr "Fájltípus színek (húzás és ejtés által rendez)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYATTR.CAPTION"
msgid "Category a&ttributes:"
msgstr "A&ttribútum kategória :"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYCOLOR.CAPTION"
msgid "Category co&lor:"
msgstr "Kat&egória színe :"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
msgid "Category &mask:"
msgstr "Kategória &maszk :"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
msgid "Category &name:"
msgstr "Kategória neve :"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "&Konzol betűtípusa"
#: tfrmoptionsfonts.lbleditorfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
msgid "&Editor font"
msgstr "Sz&erkesztő betűtípusa"
#: tfrmoptionsfonts.lbllogfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
msgid "&Log font"
msgstr "Nap&lófájl betűtípusa"
#: tfrmoptionsfonts.lblmainfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
msgid "Main &font"
msgstr "&Fő betűtípus"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Útvonal betűtípusa"
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Keresési eredmények betűtípusa"
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
msgid "Viewer&Book Font"
msgstr "Megjelenítő könyv &betűtípusa"
#: tfrmoptionsfonts.lblviewerfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
msgid "&Viewer font"
msgstr "Né&zőke betűtípusa"
#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Gyorsbillentyű &hozzáadása"
#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Másolás"
#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Törlés"
#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "Gyorsbillentyű tö&rlése"
#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "Gyorsbillentyű &módosítása"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Átnevezés"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
msgid "&Filter"
msgstr "&Szűrő"
#: tfrmoptionshotkeys.lblcategories.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION"
msgid "C&ategories:"
msgstr "K&ategóriák :"
#: tfrmoptionshotkeys.lblcommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION"
msgid "Co&mmands:"
msgstr "&Parancsok :"
#: tfrmoptionshotkeys.lblscfiles.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
msgid "&Shortcut files:"
msgstr "Fájl rövidíté&sek :"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Parancs"
#: tfrmoptionshotkeys.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "&Az alábbi útvonalakhoz és alkönyvtáraikhoz :"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Műveleti ikonok megjelenítése a &menükben"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
msgid "Show o&verlay icons, e.g. for links"
msgstr "&Beborító ikonok megjelenítése, pl : linkek"
#: tfrmoptionsicons.chkshowhiddendimmed.caption
msgid "&Dimmed hidden files (slower)"
msgstr ""
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Speciális ikonok kikapcsolása"
#: tfrmoptionsicons.gbiconssize.caption
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
msgid " Icon size "
msgstr " Ikon mérete "
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
msgid " Show icons to the left of the filename "
msgstr " Ikonok megjelenítése a fájlnév bal oldalán "
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
msgid "A&ll"
msgstr "&Mind"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
msgid "All associated + &EXE/LNK (slow)"
msgstr "Minden társított + &EXE/LNK (lassú)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
msgid "&No icons"
msgstr "&Nincs ikon"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
msgid "Only &standard icons"
msgstr "&Csak átlagos ikonok"
#: tfrmoptionsignorelist.btnaddsel.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
msgid "A&dd selected names"
msgstr "Kiválasztott nevek hozzáa&dása"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
msgid "Add selected names with &full path"
msgstr "&Kiválasztott nevek hozzáadása teljes elérési útvonallal"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Mellőzi (nem mutatja) a következp fájlokat és mappákat :"
#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
msgid "&Save in:"
msgstr "&Mentés ide :"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "&Bal, Jobb nyilak váltogatják a mappákat (Lynx-féle mozgás)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Írás"
#: tfrmoptionskeyboard.lblalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
msgid "Alt+L&etters:"
msgstr "Al&t+Betű :"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
msgid "Ctrl+Alt+Le&tters:"
msgstr "&Ctrl+Alt+Betű :"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
msgid "&Letters:"
msgstr "&Betűk :"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
msgid "&Flat buttons"
msgstr "Lapos gombok"
#: tfrmoptionslayout.cbflatinterface.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
msgid "Flat i&nterface"
msgstr "Lapos felület"
#: tfrmoptionslayout.cbflattoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
msgid "Flat b&uttons"
msgstr "Lapos gombok"
#: tfrmoptionslayout.cbfreespaceind.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
msgid "Show fr&ee space indicator on drive label"
msgstr "Szabad terület mutató megjelenítése a meghajtó címkéjében"
#: tfrmoptionslayout.cblogwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
msgid "Show lo&g window"
msgstr "Naplóablak me&gjelenítése"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
msgid "Show panel of operation in background"
msgstr "Műveleti panel megjelenítése a háttérben"
#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
msgid "Show common progress in menu bar"
msgstr "Megosztott műveletek megjelenítése a menüsávban"
#: tfrmoptionslayout.cbshowcmdline.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
msgid "Show command l&ine"
msgstr "Parancs&sor megjelenítése"
#: tfrmoptionslayout.cbshowcurdir.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
msgid "Show current director&y"
msgstr "Aktuális &könyvtár megjelenítése"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
msgid "Show &drive buttons"
msgstr "&Meghajtógombok megjelenítése"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
msgid "Show free s&pace label"
msgstr "Szabad terület címke megjelenítése"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Meghajtó lista gombok megjelenítése"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
msgid "Show function &key buttons"
msgstr "&Funkcióbillentyűk megjelenítése"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
msgid "Show &main menu"
msgstr "Fő&menü megjelenítése"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
msgid "Show tool&bar"
msgstr "&Eszköztár megjelenítése"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Rövid szabad terü&leti címke megjelenítése"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
msgid "Show &status bar"
msgstr "Állapot&sor megjelenítése"
#: tfrmoptionslayout.cbshowtabheader.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
msgid "S&how tabstop header"
msgstr "&Oszlopok neveinek megjelenítése"
#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
msgid "Sho&w folder tabs"
msgstr "&Mappa fülek megjelenítése"
#: tfrmoptionslayout.cbtermwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
msgid "Show te&rminal window"
msgstr "Te&rminálablak megjelenítése"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Két meghajtó gombsor megjelenítése (rögzített szélességben, az ablakok felett)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
msgid " Screen layout "
msgstr " Képernyő felosztása "
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Naplófájl tartalmának megtekintése"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Dátum hozzáadása a naplófájl nevéhez"
#: tfrmoptionslog.cblogarcop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
msgid "&Pack/Unpack"
msgstr "&Csomagolás/Kibontás"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr ""
#: tfrmoptionslog.cblogcpmvln.caption
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
msgid "Cop&y/Move/Create link/symlink"
msgstr "Szimbolikus hivatkozás/másolás/mozgatás/készítés"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "&Törlés"
#: tfrmoptionslog.cblogdirop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
msgid "Crea&te/Delete directories"
msgstr "Könyvtár létrehozás/törlés"
#: tfrmoptionslog.cblogerrors.caption
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
msgid "Log &errors"
msgstr "Hibák &naplózása"
#: tfrmoptionslog.cblogfile.caption
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
msgid "C&reate a log file:"
msgstr "Naplófájl &létrehozása :"
#: tfrmoptionslog.cbloginfo.caption
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
msgid "Log &information messages"
msgstr "&Információs üzenetek naplózása"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Indítás/leállítás"
#: tfrmoptionslog.cblogsuccess.caption
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
msgid "Log &successful operations"
msgstr "&Sikeres műveletek naplózása"
#: tfrmoptionslog.cblogvfs.caption
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
msgid "&File system plugins"
msgstr "&Fájlrendszer beépülők"
#: tfrmoptionslog.gblogfile.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
msgid "File operation log file"
msgstr "Fájlműveletek naplófájlja"
#: tfrmoptionslog.gblogfileop.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILEOP.CAPTION"
msgid "Log operations"
msgstr "Naplózási műveletek"
#: tfrmoptionslog.gblogfilestatus.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILESTATUS.CAPTION"
msgid "Operation status"
msgstr "Művelet állapota"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Nem létező fájlok bélyegképeinek eltávolítása"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr "Naplófájl tartalmának megtekintése"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
msgid "Create new with the encoding:"
msgstr "Új létrehozása ezzel a kódolással:"
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "&Mindig ugorjon a gyökérkönyvtárba a meghajtó váltásakor"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Fig&yelmeztető üzenetek megjelenítése (csak \"OK\" gomb)"
#: tfrmoptionsmisc.chkthumbsave.caption
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
msgid "&Save thumbnails in cache"
msgstr "Miniatűrök gyor&sítótárazása"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
msgid "Thumbnails"
msgstr "Miniatűrök"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr "Fájlmegjegyzések (descript.ion)"
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr ""
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
msgid "Default encoding:"
msgstr "Alapértelmezett kódolás"
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Beállítási fájl:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "TC végrehajtó:"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr ""
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "pixel"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Bélyegkép mérete : "
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "Egérrel való kivála&sztás"
#: tfrmoptionsmouse.chkcursornofollow.caption
msgid "The text cursor no longer follows the mouse cursor"
msgstr ""
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
msgid "By clic&king on icon"
msgstr ""
#: tfrmoptionsmouse.gbopenwith.caption
msgctxt "tfrmoptionsmouse.gbopenwith.caption"
msgid "Open with"
msgstr "Megnyitás ezzel ..."
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Görgetés"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Kiválasztás"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Mód :"
#: tfrmoptionsmouse.rbdoubleclick.caption
msgid "Double click"
msgstr ""
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "Sorró&l sorra"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Sorról sorra k&urzormozgással"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Oldalról oldalra"
#: tfrmoptionsmouse.rbsingleclickboth.caption
msgid "Single click (opens files and folders)"
msgstr ""
#: tfrmoptionsmouse.rbsingleclickfolders.caption
msgid "Single click (opens folders, double click for files)"
msgstr ""
#: tfrmoptionspluginsbase.btnaddplugin.caption
msgctxt "tfrmoptionspluginsbase.btnaddplugin.caption"
msgid "A&dd"
msgstr "Hozzáadás"
#: tfrmoptionspluginsbase.btnconfigplugin.caption
msgctxt "tfrmoptionspluginsbase.btnconfigplugin.caption"
msgid "Con&figure"
msgstr "B&eállítás"
#: tfrmoptionspluginsbase.btnenableplugin.caption
msgctxt "tfrmoptionspluginsbase.btnenableplugin.caption"
msgid "E&nable"
msgstr "E&ngedélyezés"
#: tfrmoptionspluginsbase.btnremoveplugin.caption
msgctxt "tfrmoptionspluginsbase.btnremoveplugin.caption"
msgid "&Remove"
msgstr "&Eltávolítás"
#: tfrmoptionspluginsbase.btntweakplugin.caption
msgctxt "tfrmoptionspluginsbase.btntweakplugin.caption"
msgid "&Tweak"
msgstr "F&inomhangolás"
#: tfrmoptionspluginsbase.lblplugindescription.caption
msgctxt "tfrmoptionspluginsbase.lblplugindescription.caption"
msgid "Description"
msgstr "Leírás"
#: tfrmoptionspluginsbase.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Aktív"
#: tfrmoptionspluginsbase.stgplugins.columns[1].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Beépülő"
#: tfrmoptionspluginsbase.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Regisztrálva"
#: tfrmoptionspluginsbase.stgplugins.columns[3].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Fájl neve"
#: tfrmoptionspluginsdsx.lblplugindescription.caption
msgctxt "tfrmoptionspluginsdsx.lblplugindescription.caption"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "A kereső beépülők le&hetővé tesznek más keresési algoritmusokat vagy külső eszközöket (mint pl : \"lokális\", stb)"
#: tfrmoptionspluginsgroup.btnpathtoberelativetoall.caption
msgid "Apply current settings to all current configured plugins"
msgstr ""
#: tfrmoptionspluginsgroup.ckbautotweak.caption
msgid "When adding a new plugin, automatically go in tweak window"
msgstr ""
#: tfrmoptionspluginsgroup.gbconfiguration.caption
msgid "Configuration:"
msgstr ""
#: tfrmoptionspluginsgroup.lbpathtoberelativeto.caption
msgid "Path to be relative to:"
msgstr ""
#: tfrmoptionspluginsgroup.lbpluginfilenamestyle.caption
msgid "Plugin filename style when adding a new plugin:"
msgstr ""
#: tfrmoptionspluginswcx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswcx.lblplugindescription.caption"
msgid "Pack&er plugins are used to work with archives"
msgstr "A tömö&rítő beépülők az archív fájlokkal való munkához valók."
#: tfrmoptionspluginswcx.stgplugins.columns[0].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Aktív"
#: tfrmoptionspluginswcx.stgplugins.columns[1].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Beépülő"
#: tfrmoptionspluginswcx.stgplugins.columns[2].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Regisztrálva"
#: tfrmoptionspluginswcx.stgplugins.columns[3].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Fájlnév"
#: tfrmoptionspluginswdx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswdx.lblplugindescription.caption"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "A tartalmi beépülők lehetővé teszik kiegészítő fájlinformációk megjelenítését, mint pl : mp3 tag vagy kép attribútumok a fájl listában, vagy használja kereséshez és csoportos átnevezéshez"
#: tfrmoptionspluginswfx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswfx.lblplugindescription.caption"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "A fáj&lrendszer beépülők lehetővé teszik, hogy az operációs rendszer számára elérhetetlen lemezek hozzáférését, vagy külső eszközöket, mint pl : Palm/PocketPC."
#: tfrmoptionspluginswlx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswlx.lblplugindescription.caption"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "A né&zőke beépülők lehetővé teszik képek, táblázatok, adatbázisok, stb megtekintését a Nézőkében (F3, Ctrl+Q)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
msgid "&Beginning (name must start with first typed character)"
msgstr "&Kezdet (a névnek az első begépelt karakterrel kell kezdődnie)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "&Végződés (a . előtti utolsó karakterrel kell egyeznie)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Opciók"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.GBEXACTNAMEMATCH.CAPTION"
msgid "Exact name match"
msgstr "Teljes &név egyezés:"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Karakterérzékeny keresés"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Keresés ezekre a tételekre"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr ""
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "A fülre kattintva a hozzá tartozó &panel aktiválása"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
msgid "&Show tab header also when there is only one tab"
msgstr "&Fül fejléc megjelenítése akkor is ha csak egy fül van"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Kettőzött fülek bezárása, ha kilép az alkalmazásból"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
msgid "Con&firm close all tabs"
msgstr "M&inden fül bezárásának megerősítése"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Zárolt fülek bezárásának megerősítése"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
msgid "&Limit tab title length to"
msgstr "Fül címének maximá&lis hossza"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
msgid "Show locked tabs &with an asterisk *"
msgstr "&Zárolt fülek megjelenítése csillaggal *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
msgid "&Tabs on multiple lines"
msgstr "Fülek &több sorban"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "CTRL-Fel új fület nyit az előtérben"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
msgid "Open &new tabs near current tab"
msgstr "Új fül &nyitása a jelenlegi mellett"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Újrahasználja a füleket, ha lehetséges"
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
msgid "Show ta&b close button"
msgstr "Fül bezárása gombok megjelenítése"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Mindig mutatja a meghajtó betűjelét a fülön"
#: tfrmoptionstabs.gbtabs.caption
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
msgid "Folder tabs headers"
msgstr "Mappafül fejléce"
#: tfrmoptionstabs.lblchar.caption
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
msgid "characters"
msgstr "karakterek"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Művelet végrehajtása, ha duplán kattint a fülön :"
#: tfrmoptionstabs.lbltabsposition.caption
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
msgid "Ta&bs position"
msgstr "Fü&l pozíciók :"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr "Semmi"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Nem"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr "Bal"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr "Jobb"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr ""
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr ""
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr ""
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr ""
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Parancs :"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Paraméterek :"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Parancs :"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Paraméterek :"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Parancs :"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Paraméterek :"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgctxt "tfrmoptionstoolbar.btnclonebutton.caption"
msgid "C&lone button"
msgstr "Gomb k&lónozása"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "&Törlés"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION"
msgid "Edit hot&key"
msgstr "Gyorsbillentyű szerkesztése :"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION"
msgid "&Insert new button"
msgstr "Ú&j gomb beszúrása"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Kiválaszt"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Más..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION"
msgid "Remove hotke&y"
msgstr "Gyorsbillent&yű eltávolítása"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Javasol"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "L&apos gombok"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr ""
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Adja meg a parancs paramétereit, mindegyik külön sorban. Nyomja meg az F1 billentyűt a paraméterek súgójához"
#: tfrmoptionstoolbar.gbgroupbox.caption
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
msgid "Appearance"
msgstr "Megjelenés"
#: tfrmoptionstoolbar.lblbarsize.caption
msgctxt "tfrmoptionstoolbar.lblbarsize.caption"
msgid "&Bar size:"
msgstr "&Sáv mérete :"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION"
msgid "Comman&d:"
msgstr "Para&ncs :"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Para&méterek"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr "Súgó"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Gyorsbillentyű :"
#: tfrmoptionstoolbar.lbliconfile.caption
msgctxt "tfrmoptionstoolbar.lbliconfile.caption"
msgid "Ico&n:"
msgstr "Iko&n :"
#: tfrmoptionstoolbar.lbliconsize.caption
msgctxt "tfrmoptionstoolbar.lbliconsize.caption"
msgid "Icon si&ze:"
msgstr "Ikon mé&rete :"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "Pa&rancs :"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "&Paraméterek :"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Ki&induló útvonal :"
#: tfrmoptionstoolbar.lbltooltip.caption
msgctxt "tfrmoptionstoolbar.lbltooltip.caption"
msgid "&Tooltip:"
msgstr "Buborék& :"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr ""
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "külső parancsnak"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "belső parancsnak"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "az elválasztónak"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "az al-eszköztárnak"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr "Biztonsági mentés..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr "Exportálás..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Jelenlegi eszköztár..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "Eszkötár fájlba (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "TC .BAR fájlba (létező megtartása)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "TC .BAR fájlba (létező törlése)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Felső eszköztár..."
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Eszköztár biztonsági másolata"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "Eszkötár fájlba (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "TC .BAR fájlba (létező megtartása)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "TC .BAR fájlba (létező törlése)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "csak a jelenlegi kiválasztás után"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr "mint első elemet"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr "mint utolsó elemet"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr "Importálás..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Eszköztár visszamásolása"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "jelenlegi eszköztárhoz ad"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "eszköztár fájlból (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "jelenlegi eszköztárhoz ad"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "egyszerű TC .BAR fájlból"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "jelenlegi eszköztárhoz ad"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "TC \"wincmd.ini\"-ből"
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "jelenlegi eszköztárhoz ad"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "csak a jelenlegi kiválasztás után"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr "mint első elemet"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr "mint utolsó elemet"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr "Keresés és csere..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "csak a jelenlegi kiválasztás után"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "mint első elemet"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "mint utolsó elemet"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "az alábbiak mindegyikében..."
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "minden parancsban..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "minden ikon nevében..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "minden paraméterben..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "minden kezdő útvonaban..."
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr "csak a jelenlegi kiválasztás után"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr "mint első elemet"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr "mint utolsó elemet"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Gomb típusa"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSKEEPTERMINALOPEN.CAPTION"
msgid "&Keep terminal window open after executing program"
msgstr "Terminálabla&k nyitva tartása a program futtatása után"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSRUNINTERMINAL.CAPTION"
msgid "&Execute in terminal"
msgstr "T&erminálban futtat"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSUSEEXTERNALPROGRAM.CAPTION"
msgid "&Use external program"
msgstr "Kü&lső program használata"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPARAMETERS.CAPTION"
msgid "A&dditional parameters"
msgstr "T&ovábbi paraméterek"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPATH.CAPTION"
msgid "&Path to program to execute"
msgstr "Futtatandó &program útvonala"
#: tfrmoptionstooltips.btnaddtooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnaddtooltipsfiletype.caption"
msgid "A&dd"
msgstr "Hozzáa&dás"
#: tfrmoptionstooltips.btnapplytooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnapplytooltipsfiletype.caption"
msgid "A&pply"
msgstr "&Alkalmaz"
#: tfrmoptionstooltips.btncopytooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btncopytooltipsfiletype.caption"
msgid "Cop&y"
msgstr "Másolás"
#: tfrmoptionstooltips.btndeletetooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btndeletetooltipsfiletype.caption"
msgid "Delete"
msgstr "&Törlés"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Sablon..."
#: tfrmoptionstooltips.btnrenametooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnrenametooltipsfiletype.caption"
msgid "&Rename"
msgstr "Át&nevezés"
#: tfrmoptionstooltips.btntooltipother.caption
msgctxt "tfrmoptionstooltips.btntooltipother.caption"
msgid "Oth&er..."
msgstr "Egyéb..."
#: tfrmoptionstooltips.bvltooltips1.caption
msgid "Tooltip configuration for selected file type:"
msgstr ""
#: tfrmoptionstooltips.bvltooltips2.caption
msgid "General options about tooltips:"
msgstr ""
#: tfrmoptionstooltips.chkshowtooltip.caption
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
msgid "&Show tooltip for files in the file panel"
msgstr "&Fájlok buboréktippjeinek megjelenítése a fájl panelben"
#: tfrmoptionstooltips.lblfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Kategória tipp :"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "&Maszk kategória:"
#: tfrmoptionstooltips.lbltooltiphidingdelay.caption
msgid "Tooltip hiding delay:"
msgstr ""
#: tfrmoptionstooltips.lbltooltipshowingmode.caption
msgid "Tooltip showing mode:"
msgstr ""
#: tfrmoptionstooltips.lbltooltipslistbox.caption
msgid "&File types:"
msgstr ""
#: tfrmoptionstooltips.mitooltipsfiletypediscardmodification.caption
msgid "Discard Modifications"
msgstr ""
#: tfrmoptionstooltips.mitooltipsfiletypeexport.caption
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeexport.caption"
msgid "Export..."
msgstr "Exportálás..."
#: tfrmoptionstooltips.mitooltipsfiletypeimport.caption
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeimport.caption"
msgid "Import..."
msgstr "Importálás..."
#: tfrmoptionstooltips.mitooltipsfiletypesortfiletype.caption
msgid "Sort Tooltip File Types"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr "Az előzményekkel:"
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr "Felszín és szín beállítások:"
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Háttér színe:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Kurzor színe:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Találati szöveg színe:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Kurzor alatti találati szöveg színe:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Normális szöveg színe:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Kurzor alatti átlagos szöveg színe:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Fa nézet menü előnézete:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr "Másodlagos szöveg színe:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr "Kurzor alatti másodlagos szöveg színe:"
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Gyorsbillentyű színe:"
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgctxt "TFRMOPTIONSVIEWER.GBVIEWERBOOKMODE.CAPTION"
msgid "Viewer Book Mode"
msgstr "Megjelenítő könyv mód"
#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
msgid "Example"
msgstr "Példa"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgctxt "TFRMOPTIONSVIEWER.LBLBACKGROUNDCOLORVIEWERBOOK.CAPTION"
msgid "&Background color in book viewer"
msgstr "Megjelenítő könyv &háttérszíne"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgctxt "TFRMOPTIONSVIEWER.LBLFONTCOLORVIEWERBOOK.CAPTION"
msgid "&Font color in book viewer"
msgstr "Megjelenítő könyv &betűszíne"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgctxt "TFRMOPTIONSVIEWER.LBLNUMBERCOLUMNSVIEWER.CAPTION"
msgid "&Number of columns in book viewer"
msgstr "Megjele&nítő könyv oszlopszáma"
#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "&Beállítás"
#: tfrmpackdlg.caption
msgctxt "TFRMPACKDLG.CAPTION"
msgid "Pack files"
msgstr "Fájlok tömörítése"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Több a&rchívum készítése kijelölt fájlonként/mappánként egy"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Ön&kicsomagoló archívum készítése"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "T&itkosítás"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "A&rchívumba helyezés"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Többlemezes archívum"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "E&lőször TAR archívumba tegye"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Elérési &utak tárolása az archívumban (csak a rekurzív)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Fájl(ok) becsomagolása a fájlba :"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Tömörítő"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Bezárás"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Mind kicsomagolás&a és végreh&ajtás"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "Kicsomagolás és &végrehajtás"
#: tfrmpackinfodlg.caption
msgctxt "TFRMPACKINFODLG.CAPTION"
msgid "Properties of packed file"
msgstr "A tömörített fájl tulajdonságai"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Attribútumok :"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Tömörítési arány :"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Dátum :"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Módszer :"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Eredeti méret :"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Fájl :"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Tömörített méret :"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Tömörítő :"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Idő :"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Szűrőpanel bezárása"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Írja be a keresendő szöveget vagy szűrőt"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Karakterérzékeny"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "D"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Mappák"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Fájlok"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Kezdeti egyezés"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Vég egyezés"
#: tfrmquicksearch.tglfilter.caption
msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION"
msgid "Filter"
msgstr "Szűrő"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Váltás kereső és szűrő közt"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr ""
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr ""
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Beépülő"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Mező"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Operátor"
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Érték"
#: tfrmsearchplugin.headercontrol.sections[4].text
msgid "Unit"
msgstr ""
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&ÉS (minden egyezés)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&VAGY (bármelyik egyezés)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Mégsem"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "&Bezárás"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "&Súgó"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "karakterek kivála&sztása beszúráshoz :"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsetfileproperties.caption
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
msgid "Change attributes"
msgstr "Attribútumok cseréje"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Ragadós"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "Archívum"
#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Létrehozva :"
#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "Rejtett"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Utolsó hozzáférés :"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Módosított :"
#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "Csak olvasható"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "ALmappákkal együtt"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "Rendszer"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Időbélyegző tulajdonságai"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attribútumok"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attribútumok"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitek :"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Csoport"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(szürke mező változatlan értéket jelent)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Egyéb"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Tulajdonos"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Szöveges megfelelő :"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Végrehajtás"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(szürke mező változatlan értéket jelent)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Oktális :"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Olvasás"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Írás"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Kilépés"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmsplitter.caption
msgctxt "TFRMSPLITTER.CAPTION"
msgid "Splitter"
msgstr "Vágó"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "CRC32 ellenőrzőfájlt igényel"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Fájl neve"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Fájlméret"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "Célkönyv&tár"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Fájlforrá&s"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "&Darabszám"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Bájt"
#: tfrmsplitter.rbtngigab.caption
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr "&GB"
#: tfrmsplitter.rbtnkilob.caption
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr "&kB"
#: tfrmsplitter.rbtnmegab.caption
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr "&MB"
#: tfrmstartingsplash.caption
msgctxt "tfrmstartingsplash.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "tfrmstartingsplash.lblbuild.caption"
msgid "Build"
msgstr "Kiadás"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Operációs Rendszer"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Platform"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "tfrmstartingsplash.lblrevision.caption"
msgid "Revision"
msgstr "Revízió"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "tfrmstartingsplash.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "tfrmstartingsplash.lblversion.caption"
msgid "Version"
msgstr "verzió :"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Szimbolikus hivatkozás létrehozása"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Létező cél (erre fog mutatni a hivatkozás)"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "&Hivatkozás neve"
#: tfrmsyncdirsdlg.actselectclear.caption
msgid "Remove selection"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopydefault.caption
msgid "Select for copying (default direction)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
msgid "Select for copying -> (left to right)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
msgid "Reverse copy direction"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
msgid "Select for copying <- (right to left)"
msgstr ""
#: tfrmsyncdirsdlg.actselectdeleteright.caption
msgid "Select for deleting -> (right)"
msgstr ""
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
msgid "Close"
msgstr "Bezárás"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
msgid "Compare"
msgstr "Összehasonlítás"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Szinkronizálás"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Könyvtárak szinkronizálása"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "aszimmetrikus"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "tartalom szerint"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "dátum mellőzése"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "csak a kiválasztott"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Almappák"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Mutat :"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Név"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Méret"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Dátum"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Dátum"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Méret"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Név"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(a főablakban)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Összehasonlítás"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Bal megtekintése"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Jobb megtekintése"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "másolatok"
#: tfrmsyncdirsdlg.sbequal.caption
msgctxt "tfrmsyncdirsdlg.sbequal.caption"
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgctxt "tfrmsyncdirsdlg.sbnotequal.caption"
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "egyedülállók"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Nyomja meg az \"Összehasonlítás\" gombot a kezdéshez"
#: tfrmsyncdirsperformdlg.caption
msgctxt "tfrmsyncdirsperformdlg.caption"
msgid "Synchronize"
msgstr "Szinkronizálás"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Felülírások megerősítése"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Fa nézet menü"
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr "Teljes összezárás"
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr "Teljes kitárás"
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr "Fa nézet menü beállítása"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr "Fa nézet menü színeinek beállítása"
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "Új hozzáa&dása"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Mégsem"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "Mó&dosít"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "A&lapértelmezett"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmtweakplugin.btnrelativeplugin1.hint
msgctxt "tfrmtweakplugin.btnrelativeplugin1.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmtweakplugin.btnrelativeplugin2.hint
msgctxt "tfrmtweakplugin.btnrelativeplugin2.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "&Eltávolít"
#: tfrmtweakplugin.caption
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
msgid "Tweak plugin"
msgstr "Beépülő finomhangolása"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Archívum &típusának megállapítása tartalma alapján"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Tud fáj&lt törölni"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "T&itkosítás támogatása"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "M&egjelenítés normál fájlként (tömörítő ikonjának elrejtése)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Memó&riába tömörítés támogatása"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Tud létező archívu&mokat módosítani"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "&Az archívum több fájlt is tartalmazhat"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Tud új archí&vumot létrehozni"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "Támogatja a beállítások dialóg&usablakot"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Lehetővé teszi a szöve&gkeresést az archívumban"
#: tfrmtweakplugin.lbldescription.caption
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "&Leírás :"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "D&etektálandó szöveg :"
#: tfrmtweakplugin.lblextension.caption
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "&Kiterjesztés :"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Állapotjelző :"
#: tfrmtweakplugin.lblname.caption
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "&Név :"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "&Beépülő :"
#: tfrmtweakplugin.lblplugin2.caption
msgctxt "tfrmtweakplugin.lblplugin2.caption"
msgid "&Plugin:"
msgstr "&Beépülő :"
#: tfrmviewer.actabout.caption
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
msgid "About Viewer..."
msgstr "Nézőke névjegye..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "A névjegy megjelenítése"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
msgid "Copy File"
msgstr "Fájl másolása"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Fájl másolása"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Másolás a vágólapra"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr ""
#: tfrmviewer.actdeletefile.caption
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
msgid "Delete File"
msgstr "Fájl törlése"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Fájl törlése"
#: tfrmviewer.actexitviewer.caption
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "&Kilépés"
#: tfrmviewer.actfind.caption
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Keresés"
#: tfrmviewer.actfindnext.caption
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Következő keresése"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr "Előző keresése"
#: tfrmviewer.actfullscreen.caption
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Teljes képernyő"
#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr "Közép"
#: tfrmviewer.actloadnextfile.caption
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
msgid "&Next"
msgstr "&Következő"
#: tfrmviewer.actloadnextfile.hint
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT"
msgid "Load Next File"
msgstr "Következő fájl betöltése"
#: tfrmviewer.actloadprevfile.caption
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
msgid "&Previous"
msgstr "&Előző"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Előző fájl betöltése"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr ""
#: tfrmviewer.actmirrorhorz.hint
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr "Tükör"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr ""
#: tfrmviewer.actmovefile.caption
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
msgid "Move File"
msgstr "Fájl mozgatása"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Fájl mozgatása"
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Előnézet"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Újratölt"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Újratölti a jelenlegi fájlt"
#: tfrmviewer.actrotate180.caption
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
msgid "+ 180"
msgstr "+ 180"
#: tfrmviewer.actrotate180.hint
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
msgid "Rotate 180 degrees"
msgstr "Elforgat : 180"
#: tfrmviewer.actrotate270.caption
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
msgid "- 90"
msgstr "- 90"
#: tfrmviewer.actrotate270.hint
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
msgid "Rotate -90 degrees"
msgstr "Elforgat : 270"
#: tfrmviewer.actrotate90.caption
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
msgid "+ 90"
msgstr "+ 90"
#: tfrmviewer.actrotate90.hint
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
msgid "Rotate +90 degrees"
msgstr "Elforgat : 90"
#: tfrmviewer.actsave.caption
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Mentés"
#: tfrmviewer.actsaveas.caption
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
msgid "Save As..."
msgstr "Mentés másként..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Fájl mentése másként..."
#: tfrmviewer.actscreenshot.caption
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Képernyőkép"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr ""
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr ""
#: tfrmviewer.actselectall.caption
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Összes kijelölése"
#: tfrmviewer.actshowasbin.caption
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "Megjelenítés &binárisként"
#: tfrmviewer.actshowasbook.caption
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "Kö&nyvként megjelenít"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr ""
#: tfrmviewer.actshowashex.caption
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "Megjelenítés &hexában"
#: tfrmviewer.actshowastext.caption
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "Megjelenítés &szövegként"
#: tfrmviewer.actshowaswraptext.caption
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "Megjelenítés &tördelt szövegként"
#: tfrmviewer.actshowgraphics.caption
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Grafika"
#: tfrmviewer.actshowplugins.caption
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Beépülők"
#: tfrmviewer.actstretchimage.caption
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
msgid "Stretch"
msgstr "Széthúzás"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Kép széthúzása"
#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr ""
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Nagyítás"
#: tfrmviewer.actzoomin.caption
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Nagyítás"
#: tfrmviewer.actzoomout.caption
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Kicsinyítés"
#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Levágás"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Teljes képernyő"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Kiemel"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Befest"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Piros szemek"
#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Átméretez"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Visszavonás"
#: tfrmviewer.caption
msgctxt "TFRMVIEWER.CAPTION"
msgid "Viewer"
msgstr "Nézőke"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Bemutató"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Toll"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Kiemel"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Befest"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Bemutató"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Nézőke"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "Névjegy"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "S&zerkesztés"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Kó&dolás"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Fájl"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Kép"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Nyomtat..."
#: tfrmviewer.mirotate.caption
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
msgid "Rotate"
msgstr "Elforgat"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Képernyőkép"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Nézőke"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Összes kijelölése"
#: tfrmviewoperations.btnstartpause.caption
#, fuzzy
msgctxt "tfrmviewoperations.btnstartpause.caption"
msgid "&Start"
msgstr "Indítá&s"
#: tfrmviewoperations.btnstop.caption
msgid "S&top"
msgstr ""
#: tfrmviewoperations.caption
#, fuzzy
msgctxt "tfrmviewoperations.caption"
msgid "File operations"
msgstr "Fájlműveletek"
#: tfrmviewoperations.cbalwaysontop.caption
msgid "Always on top"
msgstr ""
#: tfrmviewoperations.lblusedragdrop.caption
msgid "&Use \"drag && drop\" to move operations between queues"
msgstr ""
#: tfrmviewoperations.mnucanceloperation.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
msgid "Cancel"
msgstr "Mégsem"
#: tfrmviewoperations.mnucancelqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
msgid "Cancel"
msgstr "Mégsem"
#: tfrmviewoperations.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnunewqueue.caption"
msgid "New queue"
msgstr "Új sorbaállítás"
#: tfrmviewoperations.mnuoperationshowdetached.caption
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.mnuputfirstinqueue.caption
msgid "Put first in queue"
msgstr ""
#: tfrmviewoperations.mnuputlastinqueue.caption
msgid "Put last in queue"
msgstr ""
#: tfrmviewoperations.mnuqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue.caption"
msgid "Queue"
msgstr "Sorbaállítás"
#: tfrmviewoperations.mnuqueue0.caption
msgid "Out of queue"
msgstr ""
#: tfrmviewoperations.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Sorbaállítás 1"
#: tfrmviewoperations.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Sorbaállítás 2"
#: tfrmviewoperations.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Sorbaállítás 3"
#: tfrmviewoperations.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Sorbaállítás 4"
#: tfrmviewoperations.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Sorbaállítás 5"
#: tfrmviewoperations.mnuqueueshowdetached.caption
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.tbpauseall.caption
msgid "&Pause all"
msgstr ""
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Ha a fájl létezik"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Ha a fájl létezik"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "&Dátum/Idő másolása"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Háttérben (különálló kapcsolat)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Ha a fájl létezik"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Magasság"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Szélesség"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Gyorsszűrő mellőzése"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Jelenlegi művelet megállítása"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr ""
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr ""
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Törött :"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Általános :"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Hiányzó :"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Olvasási hiba :"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Sikeres :"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Ellenőrző összeg beírása és algoritmus kiválasztása :"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Ellenőrzőösszeg ellenőrzése"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Összes :"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "A vágólap nem tartalmaz érvényes eszköztári adatot."
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr ""
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr ""
#: ulng.rscolattr
msgid "Attr"
msgstr "Attr"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Dátum"
#: ulng.rscolext
msgid "Ext"
msgstr "Kit"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Név"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Méret"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Igazítás"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Fejléc"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Töröl"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Mező tartalma"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Mozgat"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Szélesség"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Oszlop személyreszabása:"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr ""
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr ""
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Másolat (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr ""
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr ""
#: ulng.rsdiffadds
msgid " Adds: "
msgstr ""
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr ""
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr ""
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr "Egyező:"
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr "Módosított:"
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Megszü&ntet"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "M&ind"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Hozzáfűz"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "Forrásfájlok a&utomatikus átnevezése"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Mégsem"
#: ulng.rsdlgbuttoncompare
msgid "Compare &by content"
msgstr ""
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Folytat"
#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "&Belemásol"
#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "&Mind belemásolja"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "&Kilépés a programból"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr "&Mellőzés"
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Min&d mellőzése"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Nem"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "&Egyik sem"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&OK"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "Má&s"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Felülír"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Min&det felülír"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Minden &nagyobb felülírása"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Min&den régebbi felülírása"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Minden &kisebb felülírása"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Át&nevezés"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "Fol&ytat"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Újra&próbál"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Kihagy"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Minde&t kihagy"
#: ulng.rsdlgbuttonunlock
msgid "&Unlock"
msgstr ""
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Igen"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Fájl(ok) másolása"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Fájl(ok) mozgatása"
#: ulng.rsdlgoppause
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "&Szünet"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "Indítá&s"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Sorbaállítás"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Sebesség : %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Sebesség : %s/s, hátralevő idő : %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<címtelen>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<nincs hordozó>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Double Commander belső szerkesztője"
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Sorra ugrás :"
#: ulng.rseditgotolinetitle
msgctxt "ulng.rseditgotolinetitle"
msgid "Goto Line"
msgstr "Sorra ugrás"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "új.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Fájl neve :"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Fájl megnyitása"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Vissza"
#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Keresés"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "&Előre"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Csere"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "külső szerkesztővel"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "belső szerkesztővel"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Futtatás rendszerhélyban"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Futtatás terminálban és bezárás"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Futtatás terminálban és nyitva tartás"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Bal;Jobb;Aktív;Inaktív;Mindkettő;Egyik sem"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Nem;Igen"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr ""
#: ulng.rsfileopcopymovefileexistsoptions
msgid "Ask;Overwrite;Skip"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
#, fuzzy
#| msgid "Ask;Overwrite;Copy into;Skip"
msgid "Ask;Merge;Skip"
msgstr "Kérdez;Felülír;Belemásol;Kihagy"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Kérdez;Felülír;Régebbi felülírása;Kihagy"
#: ulng.rsfileopsetpropertyerroroptions
msgctxt "ulng.rsfileopsetpropertyerroroptions"
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Kérdez;Nem állít be többet;Hibák mellőzése"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "SZŰRŐ"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Sablon meghatátozása"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s szint mélységben"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "mind (végtelen mélység)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "csak az aktuális mappában"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "A könyvtár \"%s\" nem létezik!"
#: ulng.rsfindfound
msgctxt "ulng.rsfindfound"
msgid "Found: %d"
msgstr "Találat : %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Keresési sablon mentése"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Sablon neve :"
#: ulng.rsfindscanned
msgctxt "ulng.rsfindscanned"
msgid "Scanned: %d"
msgstr "Végignézve : %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Keresés"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Fájlok keresése"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr ""
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Kezdés"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "%s szabad %s bájtból"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s bájt szabad"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Utolsó hozzáférési dátum/idő"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Attribútumok"
#: ulng.rsfunccomment
msgctxt "ulng.rsfunccomment"
msgid "Comment"
msgstr "Megjegyzés"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Tömörített méret"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Létrehozási dátum/idő"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Kiterjesztés"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Csoport"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr ""
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Erre utal"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Módosítási dátum/idő"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Név"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Név, kiterjesztés nélkül"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Tulajdonos"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Útvonal"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Méret"
#: ulng.rsfunctype
msgid "Type"
msgstr "Típus"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Hiba a hardlink létrehozásakor."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr ""
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Párbeszédablak másolása/mozgatása"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Eltérésnézőke"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Megjegyzés ablakának szerkesztése"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Szerkesztő"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Fájlok keresése"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Fő"
#: ulng.rshotkeycategorysyncdirs
msgid "Synchronize Directories"
msgstr ""
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Nézőke"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr ""
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Maszk kijelölés megszüntetése"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Kijelölő maszk"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Maszk bevitele :"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr ""
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr ""
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Egyéni oszlopok beállítása"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr ""
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Műveletek"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr ""
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Szerkesztés"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Kiadás"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr ""
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr ""
#: ulng.rsmnumount
msgid "Mount"
msgstr "Csatolás"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Új"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Nincs elérhető hordozó"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Megnyitás"
#: ulng.rsmnuopenwith
msgctxt "ulng.rsmnuopenwith"
msgid "Open with"
msgstr "Megnyitás ezzel ..."
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Más..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr ""
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Rendezés"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Lecsatolás"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Nézőke"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Fiók :"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgapplicationname
msgid "Description: %s"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "További paraméterek az archiváló parancssorra :"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Nem másolhatja/helyezheti a fájlt \"%s\" saját magára!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "A mappa \"%s\" nem törölhető"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "Change current directory to \"%s\" failed!"
msgstr "Váltás ide \"%s\" meghiúsult!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Eltávolítja az összes inaktív fület?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Ez a fül (%s) zárolt! Mégis bezárja?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Biztosan ki akar lépni?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr ""
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr ""
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "%d kiválasztott fájl/könyvtár másolása?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "\"%s\" másolása?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr ""
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr ""
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr ""
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Törölje a részben átmásolt fájlt?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "%d kiválasztott fájl/könyvtár törlése?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "A kijelölt %d fájlt/mappát a Kukába helyezi?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "\"%s\" törlése?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "A kijelölt \"%s\" Kukába helyezi?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "\"%s\" nem helyezhető a Kukába! Véglegesen törli?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "A lemez nem elérhető"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr ""
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Írja be a fájl kiterjesztést :"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Írja be a nevet :"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr ""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "CRC hiba az archívumban"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Hibás adat"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Nem bír csatlakozni a szerverhez : \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Nem tudom %s fájlt ide másolni : %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Már létező könyvtárnév : \"%s\"."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "A dátum %s nem támogatott"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "A könyvtár %s létezik!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "A műveletet a felhasználó megszakította"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Hiba a fájl bezárásakor"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Nem lehet létrehozni a fájlt"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Nincs több fájl az archívumban"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Nem lehet megnyitni létező fájlt"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Hiba a fájlból olvasáskor"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Hiba a fájl írásakor"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Nem lehet létrehozni a mappát : %s !"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Érvénytelen hivatkozás"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "A fájl nem található"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Nincs elég memória"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "A művelet nem támogatott!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Hiba a helyi menü parancsban"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Hiba a beállítások betöltésekor"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Szintaktikai hiba a reguláris kifejezésben!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Nem tudom a fájlt (%s) %s névre változtatni"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Nem bírja menteni a társítást!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "A fájl nem menthető"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Nem módosíthatóak az attribútumok : \"%s\""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Nem módosítható a dátum/idő : \"%s\""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Nem módosítható a tulajdonos/csoport : \"%s\""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr ""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "A puffer túl kicsi"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Túl sok fájl a tömörítéshez"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Ismeretlen archívum"
#: ulng.rsmsgexecutablepath
msgid "Executable: %s"
msgstr ""
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr ""
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name for this new Favorite Tabs entry:"
msgstr ""
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr ""
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr ""
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Almenü neve"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr ""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "A fájl %s megváltozott, menti?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s bájt, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Felülírja :"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "A fájl %s már létezik, felülírja?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Ezzel a fájllal :"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "A fájl \"%s\" nem található."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Aktív fájl műveletek"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Néhány fájlművelet még nem lett befejezve. Double Commander bezárása adatvesztést eredményezhet!"
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "A fájl (%s) csak olvasható/rejtett/rendszer. Törli?"
#: ulng.rsmsgfilereloadwarning
msgid "Are you sure you want to reload the current file and lose the changes?"
msgstr ""
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "A fájl \"%s\" mérete túl nagy a cél fájlrendszerre!"
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "A fájl %s már létezik, felülírja?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "A szimbolikus hivatkozás \"%s\" követése?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr ""
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr ""
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Parancs végrehajtása"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_somthing"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Kedvenc könyvtárak beállítása"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr ""
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr ""
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr ""
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr ""
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr ""
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr ""
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Mind exportálása!"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr ""
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Kiválasztott exportálása"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Mind importálása!"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr ""
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Kiválasztott importálása"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Útvonal"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr ""
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr ""
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr ""
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr ""
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr ""
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr ""
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr ""
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr ""
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Parancs:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(almenü vége)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Menü neve:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Név :"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(elválasztó)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Almenü neve"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr ""
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr ""
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr ""
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr ""
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr ""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Hiba a parancssorban"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Érvénytelen fájlnév"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Érvénytelen beállítási fájl formátum"
#: ulng.rsmsginvalidhexnumber
msgid "Invalid hexadecimal number: \"%s\""
msgstr ""
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Érvénytelen útvonal"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Az útvonal (%s) tiltott karaktereket tartalmaz"
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Ez nem érvényes beépülő!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Ez a beépülő a Double Commander %s verziójához készült! %s nem fog működni a Double Commander %s verziójával!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Érvénytelen idézet"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Érvénytelen kijelölés"
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Fájl lista betöltése..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr ""
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr ""
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "%s másolása"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "%s törlése"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Hiba : "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr ""
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "%s kitömörítése"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Infó : "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "%s hivatkozás létrehozása"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "%s könyvtár létrehozása"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "%s fájl mozgatása"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Tömörítés %s fájlba"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "%s könyvtár törlése"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Kész : "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "%s szimbolikus hivatkozás létrehozása"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "%s fájl sértetlenségének ellenőrzése"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr ""
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr ""
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Mesterjelszó"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Kérem, írja be a mesterjelszavat :"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Új fájl"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "A következő darab kicsomagolása következik"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Nincsenek fájlok."
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Nincsenek kijelölt fájlok."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Nincs elég hely a célmeghajtón, folytatja?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Nincs elég hely a célmeghajtón, újrapróbálja?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Nem lehet törölni a fájlt : %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Nincs leprogramozva."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgopeninanotherprogram
msgid "The action cannot be completed because the file is open in another program:"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Jelszó :"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "A jelszavak különböznek!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Kérem, írja be a jelszavat :"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Jelszó (Tűzfal) :"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Kérem, írja be újból a jelszavat az ellenőrzéshez :"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "%s &törlése"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Preset \"%s\" már létezik. Felülírja?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr ""
#: ulng.rsmsgprocessid
msgid "PID: %d"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr ""
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr ""
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr ""
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr ""
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "%d fájl/könyvtár áthelyezése/átnevezése?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Kiválasztott \"%s\" áthelyezése/átnevezése?"
#: ulng.rsmsgreplacethistext
msgid "Do you want to replace this text?"
msgstr ""
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Kérem indítsa újra a Double Commander-t, hogy érvényesítse a változásokat"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr ""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Kiválasztva : %s/%s, fájl : %d/%d, mappa : %d/%d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr ""
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Kérem, csak ellenőrzőösszeg-fájlokat jelöljön ki!"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Válassza ki a következő kötet helyét"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Kötetcimke beállítása"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr ""
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr ""
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr ""
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr ""
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr ""
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr ""
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr ""
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr ""
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Fül átnevezése"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Fül új neve :"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Cél útvonal :"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr ""
#: ulng.rsmsgterminateprocess
msgid "WARNING: Terminating a process can cause undesired results including loss of data and system instability. The process will not be given the chance to save its state or data before it is terminated. Are you sure you want to terminate the process?"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr ""
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr ""
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr ""
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Túl sok fájl van kijelölve."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Meghatározatlan"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL : "
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "<KIT. NÉLKÜL>"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr "<NÉV NÉLKÜLI>"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Felhasználónév :"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Felhasználónév (Tűzfal) :"
#: ulng.rsmsgverify
msgid "VERIFICATION:"
msgstr ""
#: ulng.rsmsgverifychecksum
msgid "Do you want to verify selected checksums?"
msgstr ""
#: ulng.rsmsgverifywrong
msgid "The target file is corrupted, checksum mismatch!"
msgstr ""
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Kötetcimke :"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Kérem, írja be a kötet méretét :"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "A kiválasztott %d fájl/mappa törlése?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Törli a kiválasztott \"%s\"-t?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "ezzel"
#: ulng.rsmsgwrongpasswordtryagain
msgid ""
"Wrong password!\n"
"Please try again!\n"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Nincs változás;NAGYBETŰS;kisbetűs;Nagy kezdőbetűs;Minden Szó Nagy Kezdőbetűs"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsopenwithdevelopment
msgid "Development"
msgstr ""
#: ulng.rsopenwitheducation
msgid "Education"
msgstr ""
#: ulng.rsopenwithgames
msgid "Games"
msgstr ""
#: ulng.rsopenwithgraphics
#, fuzzy
msgctxt "ulng.rsopenwithgraphics"
msgid "Graphics"
msgstr "Grafika"
#: ulng.rsopenwithmultimedia
msgid "Multimedia"
msgstr ""
#: ulng.rsopenwithnetwork
#, fuzzy
msgctxt "ulng.rsopenwithnetwork"
msgid "Network"
msgstr "Hálózat"
#: ulng.rsopenwithoffice
msgid "Office"
msgstr ""
#: ulng.rsopenwithother
#, fuzzy
msgctxt "ulng.rsopenwithother"
msgid "Other"
msgstr "Egyéb"
#: ulng.rsopenwithscience
msgid "Science"
msgstr ""
#: ulng.rsopenwithsettings
msgid "Settings"
msgstr ""
#: ulng.rsopenwithsystem
#, fuzzy
msgctxt "ulng.rsopenwithsystem"
msgid "System"
msgstr "Rendszer"
#: ulng.rsopenwithutility
msgid "Accessories"
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Megszüntetett"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Ellenőrzőösszegének számítás"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Ellenőrzőösszegének számítás itt : \"%s\""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "\"%s\" ellenőrzőösszegének számítása"
#: ulng.rsopercalculatingstatictics
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "Számítás"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Számítás \"%s\""
#: ulng.rsopercombining
msgid "Joining"
msgstr "Összefűzés"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Fájlok összefűzése itt : \"%s\" ebbe \"%s\""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Másolás"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Másolás innen \"%s\" ide \"%s\""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "\"%s\" másolása ide \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Mappa készítése"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Mappa készítése : \"%s\""
#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "Törlés"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Törlés itt : \"%s\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "\"%s\" törlése"
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Végrehajtás"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "\"%s\" végrehajtása"
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Kibontás"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Kibontás innen \"%s\" ide \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Befejezve"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Listázás"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "\"%s\" listázása"
#: ulng.rsopermoving
msgid "Moving"
msgstr "Mozgatás"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Mozgatás innen \"%s\" ide \"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "\"%s\" mozgatása ide \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Nincs elindítva"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Csomagolás"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Csomagolás innen \"%s\" ide \"%s\""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "\"%s\" csomagolása ide \"%s\""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Szüneteltetve"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Szünetelés"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Futás"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Tulajdonság beállítása"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Tulajdonság beállítása itt \"%s\""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "\"%s\" tulajdonságainak beállítása"
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Vágás"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "\"%s\" vágása ide \"%s\""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Indítás"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Megállított"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Megállítás"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Próbálás"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Próbálás itt \"%s\""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "\"%s\" próbálása"
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Ellenőrzőösszeg ellenőrzése"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Ellenőrzőösszeg ellenőrzése itt \"%s\""
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "\"%s\" ellenőrzőösszeg ellenőrzése"
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Fájl forrás hozzáférhetőségére várva"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "A felhasználó válaszára vár"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Tisztítás"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Tisztítás itt \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "\"%s\" tisztítása"
#: ulng.rsoperworking
msgid "Working"
msgstr "Dolgozik"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr ""
#: ulng.rsoptaddingtooltipfiletype
msgid "Adding new tooltip file type"
msgstr ""
#: ulng.rsoptarchiveconfiguresavetochange
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsoptarchiveradditonalcmd
msgid "Mode dependent, additional command"
msgstr ""
#: ulng.rsoptarchiveraddonlynotempty
msgid "Add if it is non-empty"
msgstr ""
#: ulng.rsoptarchiverarchivel
msgid "Archive File (long name)"
msgstr ""
#: ulng.rsoptarchiverarchiver
msgid "Select archiver executable"
msgstr ""
#: ulng.rsoptarchiverarchives
msgid "Archive file (short name)"
msgstr ""
#: ulng.rsoptarchiverchangeencoding
msgid "Change Archiver Listing Encoding"
msgstr ""
#: ulng.rsoptarchiverconfirmdelete
msgctxt "ulng.rsoptarchiverconfirmdelete"
msgid "Are you sure you want to delete: \"%s\"?"
msgstr ""
#: ulng.rsoptarchiverdefaultexportfilename
msgid "Exported Archiver Configuration"
msgstr ""
#: ulng.rsoptarchivererrorlevel
msgid "errorlevel"
msgstr ""
#: ulng.rsoptarchiverexportcaption
msgid "Export archiver configuration"
msgstr ""
#: ulng.rsoptarchiverexportdone
msgctxt "ulng.rsoptarchiverexportdone"
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverexportprompt
msgctxt "ulng.rsoptarchiverexportprompt"
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsoptarchiverfilelistl
msgid "Filelist (long names)"
msgstr ""
#: ulng.rsoptarchiverfilelists
msgid "Filelist (short names)"
msgstr ""
#: ulng.rsoptarchiverimportcaption
msgid "Import archiver configuration"
msgstr ""
#: ulng.rsoptarchiverimportdone
msgctxt "ulng.rsoptarchiverimportdone"
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverimportfile
msgid "Select the file to import archiver configuration(s)"
msgstr ""
#: ulng.rsoptarchiverimportprompt
msgctxt "ulng.rsoptarchiverimportprompt"
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsoptarchiverjustname
msgid "Use name only, without path"
msgstr ""
#: ulng.rsoptarchiverjustpath
msgid "Use path only, without name"
msgstr ""
#: ulng.rsoptarchiverprograml
msgid "Archive Program (long name)"
msgstr ""
#: ulng.rsoptarchiverprograms
msgid "Archive Program (short name)"
msgstr ""
#: ulng.rsoptarchiverquoteall
msgid "Quote all names"
msgstr ""
#: ulng.rsoptarchiverquotewithspace
msgid "Quote names with spaces"
msgstr ""
#: ulng.rsoptarchiversinglefprocess
msgid "Single filename to process"
msgstr ""
#: ulng.rsoptarchivertargetsubdir
msgid "Target subdirecory"
msgstr ""
#: ulng.rsoptarchiveruseansi
msgid "Use ANSI encoding"
msgstr ""
#: ulng.rsoptarchiveruseutf8
msgid "Use UTF8 encoding"
msgstr ""
#: ulng.rsoptarchiverwheretosave
msgid "Enter location and filename where to save archiver configuration"
msgstr ""
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Archívum típusának neve :"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "A beépülő \"%s\" társítása ezzel :"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Első;Utolsó;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr ""
#: ulng.rsoptconfigtreestate
msgid "Full expand;Full collapse"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr ""
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Kiterjesztés megadása"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr ""
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "külön ablak;kicsinyített külön ablak;műveleti panel"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "lebegő;B;k;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "A gyorsbillentyű \"%s\" a cm_Delete-tel lesz bejegyezve, így azt fel lehet használni, hogy megfordítsuk ezt a beállítást."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Gyorsbillentyű hozzáadása ehhez : %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Gyorsbillentyű hozzáadása"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Gyorsbillentyű beállítása sikertelen"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Gyorsbillentyű cseréje"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Parancs"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides"
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "A cm_Delete gyorsbillentyűje \"%s\" rendelkezik paraméterrel amely felülírja ezt a beállítást. Szeretné megváltoztatni ezt a paramétert és használni a globális beállítást?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists"
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "A gyorsbillentyű \"%s\" a cm_Delete-hez paraméterváltozást igényel, hogy egyezzen \"%s\" gyorsbillentyűvel. Szeretné megváltoztatni?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Leírás"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Gyorsbillentyű szerkesztése ehhez : %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Állandó paraméter"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Gyorsbillentyű"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Gyorsbillentyűk"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<semmi>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Paraméterek"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Gyorsbillentyű beállítása törlésre"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Ahhoz, hogy a gyorsbillentyű \"%s\" működjön, a gyorsbillentyűt \"%s\" hozzá kell rendelni a cm_Delete parancshoz, de már hozzá van rendelve ehhez : \"%s\". Szeretné megváltoztatni?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "A gyorsbillentyű \"%s\" a cm_Delete-hez egy olyan szekvencia gyorsbillentyű amely a fordított Shift forrógombbal nem használható. Ez a beállítás valószínűleg nem fog működni."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "A gyorsbillentyű már foglalt"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "A gyorsbillentyű \"%s\" már foglalt"
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Cseréli erre \"%s\"?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "erre van használva \"%s\", itt : \"%s\""
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "erre a parancsra van használva, de másik paraméterrel"
#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Archívumok"
#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Automatikus frissítés"
#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Viselkedés"
#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr "Rövid nézet"
#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Színek"
#: ulng.rsoptionseditorcolumnsview
msgctxt "ulng.rsoptionseditorcolumnsview"
msgid "Columns"
msgstr "Oszlopok"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Beállítás"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Egyedi oszlopok"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Kedvenc könyvtárak"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Húzd és ejtsd"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Meghajtólista gombok"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr ""
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr ""
#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Fájltársítások"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Új"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Fájlműveletek"
#: ulng.rsoptionseditorfilepanels
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Fájl panelek"
#: ulng.rsoptionseditorfilesearch
#, fuzzy
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Fájlkeresés"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Fájlok megtekintése"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Fájltípusok"
#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Mappafülek"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr ""
#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Betűtípusok"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Kiemelők"
#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Gyorsbillentyűk"
#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Ikonok"
#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Kihagyási lista"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Gombok"
#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Nyelv"
#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr "Megjelenés"
#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Napló"
#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Egyéb"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Egér"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Beépülők"
#: ulng.rsoptionseditorquicksearch
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Gyorskeresés/szűrő"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminál"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Eszköztár"
#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Eszközök"
#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Buboréktippek"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Fa nézet menü"
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr ""
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Sehol;Parancssor;Gyorskeresés;Gyorsszűrő"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Bal gomb;Jobb gomb;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "a fájl lista tetején;mappák után (ha a mappák hamarább vannak a fájloktól);rendezési sorrendben;a fájllista alján"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "A beépülő (%s) már hozzá van rendelve a következő kiterjesztés(ek)hez :"
#: ulng.rsoptplugindisable
msgid "D&isable"
msgstr "Letiltás"
#: ulng.rsoptpluginenable
msgctxt "ulng.rsoptpluginenable"
msgid "E&nable"
msgstr "E&ngedélyezés"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Aktív"
#: ulng.rsoptpluginsdescription
msgctxt "ulng.rsoptpluginsdescription"
msgid "Description"
msgstr "Leírás"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Fájlnév"
#: ulng.rsoptpluginshowbyextension
msgid "By extension"
msgstr ""
#: ulng.rsoptpluginshowbyplugin
msgid "By Plugin"
msgstr ""
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Név"
#: ulng.rsoptpluginsortonlywhenbyextension
msgid "Sorting WCX plugins is only possible when showing plugins by extension!"
msgstr ""
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Regisztrálva"
#: ulng.rsoptrenamingtooltipfiletype
msgid "Renaming tooltip file type"
msgstr ""
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "Érzéke&ny;Érzéke&tlen"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Fájlok;&Mappák;Fájlok é&s Mappák"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "Szűrőpanel elrejtése, &ha nem fókuszált;Beállításmódosítások megtartása a következő munkamenetre"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "nem karakterérzékeny;területi beállítások szerint (aAbBcC);előbb nagybetűs, aztán kisbetűs (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "rendezés név szerint és mutatja az elsőt;rendezés, mint a fájlokat és mutatja az elsőt;rendezés, mint a fájlokat"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Betűrendes, ékezetekre figyel;Természetes elrendezés : betűrendes és számok"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Felül;Alul;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "&Elválasztó;Belső pa&rancs;Külső &parancs;&Menü"
#: ulng.rsopttooltipconfiguresavetochange
msgid "To change file type tooltip configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsopttooltipfiletype
msgid "Tooltip file type name:"
msgstr "&Név kategória:"
#: ulng.rsopttooltipfiletypealreadyexists
msgid "\"%s\" already exists!"
msgstr ""
#: ulng.rsopttooltipfiletypeconfirmdelete
msgctxt "ulng.rsopttooltipfiletypeconfirmdelete"
msgid "Are you sure you want to delete: \"%s\"?"
msgstr ""
#: ulng.rsopttooltipfiletypedefaultexportfilename
msgid "Exported tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeexportcaption
msgid "Export tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeexportdone
msgctxt "ulng.rsopttooltipfiletypeexportdone"
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsopttooltipfiletypeexportprompt
msgctxt "ulng.rsopttooltipfiletypeexportprompt"
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsopttooltipfiletypeimportcaption
msgid "Import tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeimportdone
msgctxt "ulng.rsopttooltipfiletypeimportdone"
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsopttooltipfiletypeimportfile
msgid "Select the file to import tooltip file type configuration(s)"
msgstr ""
#: ulng.rsopttooltipfiletypeimportprompt
msgctxt "ulng.rsopttooltipfiletypeimportprompt"
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsopttooltipfiletypewheretosave
msgid "Enter location and filename where to save tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipsfiletypename
msgid "Tooltip file type name"
msgstr ""
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr ""
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "ne módosítsa a helyzetet;használja az új fájl beállításait;rendezett sorrendben"
#: ulng.rspluginfilenamestylelist
msgid "With complete absolute path;Path relative to %COMMANDER_PATH%;Relative to the following"
msgstr ""
#: ulng.rspluginsearchcontainscasesenstive
msgid "contains(case)"
msgstr ""
#: ulng.rspluginsearchcontainsnotcase
msgid "contains"
msgstr ""
#: ulng.rspluginsearchequalcasesensitive
msgid "=(case)"
msgstr ""
#: ulng.rspluginsearchequalnotcase
msgctxt "ulng.rspluginsearchequalnotcase"
msgid "="
msgstr "="
#: ulng.rspluginsearchfieldnotfound
msgid "Field \"%s\" not found!"
msgstr ""
#: ulng.rspluginsearchnotcontainscasesenstive
msgid "!contains(case)"
msgstr ""
#: ulng.rspluginsearchnotcontainsnotcase
msgid "!contains"
msgstr ""
#: ulng.rspluginsearchnotequacasesensitive
msgid "!=(case)"
msgstr ""
#: ulng.rspluginsearchnotequalnotcase
msgctxt "ulng.rspluginsearchnotequalnotcase"
msgid "!="
msgstr "!="
#: ulng.rspluginsearchpluginnotfound
msgid "Plugin \"%s\" not found!"
msgstr ""
#: ulng.rspluginsearchunitnotfound
msgid "Unit \"%s\" not found!"
msgstr ""
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Fájl : %d, mappa : %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "\"%s\" jogosultsága nem állítható"
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "\"%s\" tulajdonosa nem állítható"
#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "Fájl"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Könyvtár"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Csőnév"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Foglalat"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Speciális blokk eszköz"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Speciális karakter eszköz"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Szimbolikus hivatkozás"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Ismeretlen típus"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Keresés eredménye"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "KERESÉS"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<névtelen sablon>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Válasszon ki egy könyvtárat"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "&Súgó ehhez : %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Mind"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Kategória"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Oszlop"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Parancs"
#: ulng.rssimplewordfalse
msgid "False"
msgstr ""
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Fájlnév"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "fájlok"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Paraméter"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Eredmény"
#: ulng.rssimplewordtrue
msgid "True"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "MunkaMappa"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "B"
#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr "GB"
#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr "kB"
#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr "MB"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "TB"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Fájlok:%d, Mappák:%d, Méret: %s (%s bájt)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Nem lehet létrehozni a célkönyvtárat!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Hibás fájlméret formátum!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Nem lehet darabolni a fájlt!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "A darabok száma több, mint 100! Folytassam?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Könyvtár kiválasztása :"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr "Csak előnézet"
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr "Egyebek"
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr "Lapos"
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr "Korlátozott"
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr "Egyszerű"
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Hiba a szimbolikus hivatkozás létrehozásakor."
#: ulng.rssyndefaulttext
msgctxt "ulng.rssyndefaulttext"
msgid "Default text"
msgstr "Átlagos szöveg"
#: ulng.rssynlangplaintext
msgctxt "ulng.rssynlangplaintext"
msgid "Plain text"
msgstr "Egyszerű szöveg"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr ""
#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Nap"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Óra"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Perc"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Hónap"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Másodperc"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Hét"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Év"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Kedvenc fülek átnevezése"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr ""
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Különbségvizsgáló"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Szerkesztő"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Hiba a különbségvizsgáló megnyitásakor"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Hiba a szerkesztő megnyitásakor"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Hiba a terminál megnyitásakor"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Hiba a nézőke megnyitásakor"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminál"
#: ulng.rstooltiphidetimeoutlist
msgid "System default;1 sec;2 sec;3 sec;5 sec;10 sec;30 sec;1 min;Never hide"
msgstr ""
#: ulng.rstooltipmodelist
msgid "Combine DC and system tooltip, DC first (legacy);Combine DC and system tooltip, system first;Show DC tooltip when possible and system when not;Show DC tooltip only;Show system tooltip only"
msgstr ""
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Nézőke"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Kérjük, jelezze a hibát a 'bug tracker'-en egy leírással, hogy mit csinált, és a következő fájlt : %s. Nyomja meg \"%s\" gombot a folytatáshoz, vagy \"%s\" gombot a programból való kilépéshez."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr ""
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr ""
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Panel útvonala"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr ""
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Csak a fájlnév, a kiterjesztés nem"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr ""
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr ""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr ""
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Bal panel"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr ""
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr ""
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr ""
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Csak a kiterjesztés"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Csak a fájlnév"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr ""
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr ""
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr ""
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr ""
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr ""
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr ""
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Jobb panel"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr ""
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr ""
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr ""
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr ""
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Aktív panel (forrás)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Inaktív panel (cél)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr ""
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr ""
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr ""
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr ""
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr ""
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr ""
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Hálózat"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "A Double Commander belső nézőkéje"
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Rossz minőség"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Kódolás"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Kép típusa"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Új méret"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s nem található!"
#: ulng.rsviewpainttoolslist
msgid "Pen;Rect;Ellipse"
msgstr ""
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "külső nézőkével"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "belső nézőkével"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Cserék száma: %d"
#: ulng.rszeroreplacement
#, fuzzy,badformat
#| msgid "No replacement took place.Use custom font and coloractGoToFileactIntelliFocusS&topUse \"drag && drop\" to move operations between queuesPut first in queuePut last in queueOut of queueCalculate files and foldersLinker complete(end of sub menu)(separator)Yes (%s)"
msgctxt "ulng.rsmsgfavoritetabsendofmenuulng.rsmsgfavoritetabssimpleseparator"
msgid "No replacement took place."
msgstr "Nem történt csere.Egyedi betűtípus és szín használataactGoToFileactIntelliFocusLeállí&tás\"Fogd && Ejtsd\" használata a sorbaállítási műveletek köztElsőnekUtolsónakSoron kívülFájlok és mappák számításaLinker végzett(almenü vége)(elválasztó)Igen (%s)"