doublecmd/language/doublecmd.pl.po
2018-11-21 17:07:49 +00:00

12665 lines
333 KiB
Text
Raw Blame History

This file contains ambiguous Unicode characters

This file contains Unicode characters that might be confused with other characters. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.8.0 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2016-12-09 07:50+0200\n"
"Last-Translator: Maciej Bojakowski <maciejbojakowski@gmail.com>\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Polski\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Porównywanie... %d%% (ESC, aby anulować)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Prawy: Usuń %d plik(ów)"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Znaleziono plików: %d (Identycznych: %d, Różnych: %d, Unikalnych po lewej: %d, Unikalnych po prawej: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Z lewej do prawej: Kopiowanie %d plików, całkowity rozmiar: %d bajtów"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Z prawej do lewej: Kopiowanie %d plików, całkowity rozmiar: %d bajtów"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Wybierz szablon..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Sprawdź wolne miejsce"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "K&opiuj atrybuty"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Kopiuj własność"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Kopiuj u&prawnienia"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopiuj d&atę/czas"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Popraw lin&ki"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgid "Drop readonly fla&g"
msgstr "Zdejmij flagę \"Tylko do odczytu\""
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Usuń puste katalogi"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Idź za linkami"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "Za&rezerwuj miejsce"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr "&Weryfikuj"
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Co zrobić, gdy nie można ustawić czasu pliku, atrybutów, itp."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Użyj pliku szablonu"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Gdy katalog istnieje"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgid "When &file exists"
msgstr "Gdy plik istnieje"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Gdy nie moż&na ustawić właściwości"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<brak szablonu>"
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr "&Zamknij"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Kopiuj do schowka"
#: tfrmabout.caption
msgctxt "tfrmabout.caption"
msgid "About"
msgstr "O programie"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Kompilacja"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Strona domowa:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "tfrmabout.lblrevision.caption"
msgid "Revision"
msgstr "Wydanie"
#: tfrmabout.lbltitle.caption
msgctxt "tfrmabout.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Wersja"
#: tfrmattributesedit.btncancel.caption
msgctxt "tfrmattributesedit.btncancel.caption"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmattributesedit.btnok.caption
msgctxt "tfrmattributesedit.btnok.caption"
msgid "&OK"
msgstr "&Ok"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Resetuj"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Wybierz atrybuty"
#: tfrmattributesedit.cbarchive.caption
msgid "&Archive"
msgstr "&Archiwum"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Sko&mpresowany"
#: tfrmattributesedit.cbdirectory.caption
msgid "&Directory"
msgstr "Katalog"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "Zaszyfrowany"
#: tfrmattributesedit.cbhidden.caption
msgid "&Hidden"
msgstr "Ukryty"
#: tfrmattributesedit.cbreadonly.caption
msgid "Read o&nly"
msgstr "Tylko do odczytu"
#: tfrmattributesedit.cbsgid.caption
msgctxt "tfrmattributesedit.cbsgid.caption"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "Rzadki"
#: tfrmattributesedit.cbsticky.caption
msgctxt "tfrmattributesedit.cbsticky.caption"
msgid "Sticky"
msgstr "Przyklejony"
#: tfrmattributesedit.cbsuid.caption
msgctxt "tfrmattributesedit.cbsuid.caption"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "Link symboliczny"
#: tfrmattributesedit.cbsystem.caption
msgid "S&ystem"
msgstr "S&ystemowy"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Tymczasowy"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Atrybuty NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Atrybuty ogólne"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "tfrmattributesedit.lblattrbitsstr.caption"
msgid "Bits:"
msgstr "Bity:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "tfrmattributesedit.lblattrgroupstr.caption"
msgid "Group"
msgstr "Grupa"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "tfrmattributesedit.lblattrotherstr.caption"
msgid "Other"
msgstr "Inne"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "tfrmattributesedit.lblattrownerstr.caption"
msgid "Owner"
msgstr "Właściciel"
#: tfrmattributesedit.lblexec.caption
msgctxt "tfrmattributesedit.lblexec.caption"
msgid "Execute"
msgstr "Uruchom"
#: tfrmattributesedit.lblread.caption
msgctxt "tfrmattributesedit.lblread.caption"
msgid "Read"
msgstr "Odczyt"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Jako tekst:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "tfrmattributesedit.lblwrite.caption"
msgid "Write"
msgstr "Zapis"
#: tfrmbenchmark.caption
msgid "Benchmark"
msgstr ""
#: tfrmbenchmark.lblbenchmarksize.caption
msgid "Benchmark data size: %d MB"
msgstr ""
#: tfrmbenchmark.stgresult.columns[0].title.caption
msgid "Hash"
msgstr ""
#: tfrmbenchmark.stgresult.columns[1].title.caption
msgid "Time (ms)"
msgstr ""
#: tfrmbenchmark.stgresult.columns[2].title.caption
msgid "Speed (MB/s)"
msgstr ""
#: tfrmchecksumcalc.caption
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Oblicz sumę kontrolną..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Otwórz plik sumy kontrolnej po zakończeniu pracy"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "Dla każdego pliku utwó&rz oddzielny plik sumy kontrolnej"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "Zapi&sz plik(i) sumy kontrolnej do:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zamknij"
#: tfrmchecksumverify.caption
msgctxt "tfrmchecksumverify.caption"
msgid "Verify checksum..."
msgstr "Sprawdź sumę kontrolną..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "tfrmconnectionmanager.btnadd.caption"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "P&ołącz"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "tfrmconnectionmanager.btndelete.caption"
msgid "&Delete"
msgstr "Usuń"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "tfrmconnectionmanager.btnedit.caption"
msgid "&Edit"
msgstr "&Edytuj"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Menedżer połączeń"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Połącz z:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "Dodaj do kolejki"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "O&pcje"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "Zapisz te opcje jako domyślne"
#: tfrmcopydlg.caption
msgctxt "tfrmcopydlg.caption"
msgid "Copy file(s)"
msgstr "Kopiuj plik(i)"
#: tfrmcopydlg.mnunewqueue.caption
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Nowa kolejka"
#: tfrmcopydlg.mnuqueue1.caption
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Kolejka 1"
#: tfrmcopydlg.mnuqueue2.caption
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Kolejka 2"
#: tfrmcopydlg.mnuqueue3.caption
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Kolejka 3"
#: tfrmcopydlg.mnuqueue4.caption
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Kolejka 4"
#: tfrmcopydlg.mnuqueue5.caption
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Kolejka 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Zapisz opis"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Komentarz do pliku/katalogu"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "E&dytuj komentarz dla:"
#: tfrmdescredit.lblencoding.caption
msgid "&Encoding:"
msgstr "Kodowani&e:"
#: tfrmdescredit.lblfilename.caption
msgctxt "tfrmdescredit.lblfilename.caption"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programie"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Porównaj automatycznie"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Tryb binarny"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "tfrmdiffer.actcancelcompare.caption"
msgid "Cancel"
msgstr "Anuluj"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Anuluj"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "tfrmdiffer.actcopylefttoright.caption"
msgid "Copy Block Right"
msgstr "Kopiuj blok na prawo"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Kopiuj blok na prawo"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "tfrmdiffer.actcopyrighttoleft.caption"
msgid "Copy Block Left"
msgstr "Kopiuj blok na lewo"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Kopiuj blok na lewo"
#: tfrmdiffer.acteditcopy.caption
msgctxt "tfrmdiffer.acteditcopy.caption"
msgid "Copy"
msgstr "Kopiuj"
#: tfrmdiffer.acteditcut.caption
msgctxt "tfrmdiffer.acteditcut.caption"
msgid "Cut"
msgstr "Wytnij"
#: tfrmdiffer.acteditdelete.caption
msgctxt "tfrmdiffer.acteditdelete.caption"
msgid "Delete"
msgstr "Usuń"
#: tfrmdiffer.acteditpaste.caption
msgctxt "tfrmdiffer.acteditpaste.caption"
msgid "Paste"
msgstr "Wstaw"
#: tfrmdiffer.acteditredo.caption
msgctxt "tfrmdiffer.acteditredo.caption"
msgid "Redo"
msgstr "Wykonaj ponownie"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Zaznacz &wszystko"
#: tfrmdiffer.acteditundo.caption
msgctxt "tfrmdiffer.acteditundo.caption"
msgid "Undo"
msgstr "Cofnij"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "Koniec"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Pierwsza różnica"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Pierwsza różnica"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Ignoruj wielkość liter"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Ignoruj puste"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Kontynuuj przewijanie"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Ostatnia różnica"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Ostatnia różnica"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Różnice linii"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Następna różnica"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Następna różnica"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Otwórz lewy..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Otwórz prawy..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Maluj tło"
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Poprzednia różnica"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Poprzednia różnica"
#: tfrmdiffer.actreload.caption
msgid "&Reload"
msgstr "Wczytaj ponownie"
#: tfrmdiffer.actreload.hint
msgctxt "tfrmdiffer.actreload.hint"
msgid "Reload"
msgstr "Wczytaj ponownie"
#: tfrmdiffer.actsave.caption
msgctxt "tfrmdiffer.actsave.caption"
msgid "Save"
msgstr "Zapisz"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Zapisz"
#: tfrmdiffer.actsaveas.caption
msgctxt "tfrmdiffer.actsaveas.caption"
msgid "Save as..."
msgstr "Zapisz jako..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Zapisz jako..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "tfrmdiffer.actsaveleft.caption"
msgid "Save Left"
msgstr "Zapisz lewy"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Zapisz lewy"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "tfrmdiffer.actsaveleftas.caption"
msgid "Save Left As..."
msgstr "Zapisz lewy jako..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Zapisz lewy jako..."
#: tfrmdiffer.actsaveright.caption
msgctxt "tfrmdiffer.actsaveright.caption"
msgid "Save Right"
msgstr "Zapisz prawy"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Zapisz prawy"
#: tfrmdiffer.actsaverightas.caption
msgctxt "tfrmdiffer.actsaverightas.caption"
msgid "Save Right As..."
msgstr "Zapisz prawy jako..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Zapisz prawy jako..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "tfrmdiffer.actstartcompare.caption"
msgid "Compare"
msgstr "Porównaj"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Porównaj"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "tfrmdiffer.btnleftencoding.hint"
msgid "Encoding"
msgstr "Kodowanie"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Kodowanie"
#: tfrmdiffer.caption
msgid "Compare files"
msgstr "Porównaj pliki"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "tfrmdiffer.midivider7.caption"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Lewy"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "P&rawy"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Akcje"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Edycja"
#: tfrmdiffer.mnuencoding.caption
msgctxt "tfrmdiffer.mnuencoding.caption"
msgid "En&coding"
msgstr "Kodowanie"
#: tfrmdiffer.mnufile.caption
msgctxt "tfrmdiffer.mnufile.caption"
msgid "&File"
msgstr "Plik"
#: tfrmdiffer.mnuoptions.caption
msgid "&Options"
msgstr "&Opcje"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Dodaj nowy skrót do sekwencji"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Anuluj"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Usuń ostatni skrót z sekwencji"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr "Wybierz skrót klawiaturowy z listy pozostałych dostępnych"
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr "Tylko dla tych kontrolek"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parametry (każdy w osobnym wierszu):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Skróty:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programie"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "O programie"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "Konfiguracja"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Konfiguracja"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiuj"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Kopiuj"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Wytnij"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Wytnij"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Usuń"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Usuń"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "Znajdź"
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Znajdź"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Znajdź następny"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Znajdź następny"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Znajdź poprzedni"
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr "Idź do linii..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Wstaw"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Wstaw"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Powtórz"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Powtórz szukanie"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "Zamień"
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Zamień"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Zaznacz &wszystko"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Zaznacz wszystko"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Cofnij"
#: tfrmeditor.acteditundo.hint
msgctxt "tfrmeditor.acteditundo.hint"
msgid "Undo"
msgstr "Cofnij"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "Zamknij"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Zamknij"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "Zakończ"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Zakończ"
#: tfrmeditor.actfilenew.caption
msgid "&New"
msgstr "&Nowy"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Nowy"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Otwórz"
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Otwórz"
#: tfrmeditor.actfilereload.caption
#, fuzzy
msgctxt "tfrmeditor.actfilereload.caption"
msgid "Reload"
msgstr "Wczytaj ponownie"
#: tfrmeditor.actfilesave.caption
msgctxt "tfrmeditor.actfilesave.caption"
msgid "&Save"
msgstr "Zapi&sz"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Zapisz"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Zapisz j&ako..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Zapisz jako"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Zapisz wszystko"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Zapisz wszystko"
#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr "Edytor"
#: tfrmeditor.help1.caption
msgctxt "tfrmeditor.help1.caption"
msgid "&Help"
msgstr "Pomoc"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "Edycja"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Kodowanie"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Otwórz jako"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Zapisz jako"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "Plik"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Kolorowanie składni"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Koniec linii"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.CANCELBUTTON.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgid "C&ase sensitivity"
msgstr "&Uwzględniaj wielkość liter"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgid "S&earch from caret"
msgstr "Szukaj od kursora"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgid "&Regular expressions"
msgstr "Wyrażenie &regularne"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgid "Selected &text only"
msgstr "Tylko w zaznaczonym tekście"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgid "&Whole words only"
msgstr "Tylko całe wyrazy"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgid "Option"
msgstr "Opcje"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgid "&Replace with:"
msgstr "Zamień na:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgid "&Search for:"
msgstr "Znajdź:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgid "Direction"
msgstr "Kierunek"
#: tfrmextractdlg.caption
msgid "Unpack files"
msgstr "Rozpakuj plik(i)"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "Rozpakuj z podkatalogami"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Każde archiwum rozpakuj do oddzielnego katalogu (z nazwą archiwum)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "Nadpisz istniejące pliki"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Do katalogu:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "Rozpakuj pliki zgodne z maską:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "Hasło dla zaszyfrowanych plików:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Zamknij"
#: tfrmfileexecuteyourself.caption
msgid "Wait..."
msgstr "Czekaj..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Nazwa pliku:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "tfrmfileexecuteyourself.lblfrompath.caption"
msgid "From:"
msgstr "Z:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Kliknij na Zamknij, gdy plik tymczasowy może zostać usunięty!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Anuluj"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "Idź do panelu"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "Zobacz wszystko"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Bieżąca operacja:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Z:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Do:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Zamknij"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "U&staw właściwości"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Ustaw dla wszystkich wybranych plików"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Pomiń ten plik"
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr "Właściwości"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Przyklejony"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Właściciel"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bity:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grupa"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Inne"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Właściciel"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "tfrmfileproperties.lblattrtext.caption"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
msgid "Text:"
msgstr "Tekst:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Zawartość:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Wykonywalny"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Nazwa pliku"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "tfrmfileproperties.lblfilestr.caption"
msgid "File name"
msgstr "Nazwa pliku"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Ścieżka:"
#: tfrmfileproperties.lblgroupstr.caption
msgid "&Group"
msgstr "Grupa"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Ostatnio używany:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Ostatnio zmieniony:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Ostatnia zmiana statusu:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "tfrmfileproperties.lbloctal.caption"
msgid "Octal:"
msgstr "Ósemkowo:"
#: tfrmfileproperties.lblownerstr.caption
msgid "O&wner"
msgstr "Właściciel"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Odczyt"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "tfrmfileproperties.lblsizestr.caption"
msgid "Size:"
msgstr "Rozmiar:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Link symboliczny do:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Typ:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zapis"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Nazwa"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Wartość"
#: tfrmfileproperties.tsattributes.caption
msgctxt "tfrmfileproperties.tsattributes.caption"
msgid "Attributes"
msgstr "Atrybuty"
#: tfrmfileproperties.tsplugins.caption
#, fuzzy
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Wtyczki"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Właściwości"
#: tfrmfileunlock.btnclose.caption
#, fuzzy
msgctxt "tfrmfileunlock.btnclose.caption"
msgid "Close"
msgstr "Zamknij"
#: tfrmfileunlock.btnterminate.caption
msgid "Terminate"
msgstr ""
#: tfrmfileunlock.btnunlock.caption
msgctxt "tfrmfileunlock.btnunlock.caption"
msgid "Unlock"
msgstr ""
#: tfrmfileunlock.btnunlockall.caption
msgid "Unlock All"
msgstr ""
#: tfrmfileunlock.caption
msgctxt "tfrmfileunlock.caption"
msgid "Unlock"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[0].title.caption
msgid "File Handle"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[1].title.caption
msgid "Process ID"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[2].title.caption
msgid "Executable Path"
msgstr ""
#: tfrmfinddlg.actcancel.caption
msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION"
msgid "C&ancel"
msgstr "&Anuluj"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "Anuluj wyszukiwanie i zamknij okno"
#: tfrmfinddlg.actclose.caption
msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zamknij"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "TFRMFINDDLG.ACTCONFIGFILESEARCHHOTKEYS.CAPTION"
msgid "Configuration of hot keys"
msgstr "Konfiguracja skrótów klawiszowych"
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Edycja"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr ""
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr "Anuluj wyszukiwanie, zamknij i uwolnij z pamięci"
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr "Dla wszystkich innych \"Znajdź pliki\", anuluj, zamknij i uwolnij z pamięci"
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "Idź do pliku"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION"
msgid "Find Data"
msgstr "Znajdź dane"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "Ostatnie wyszukiwanie"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Nowe wyszukiwanie"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr "Nowe wyszukiwanie (wyczyszczone filtry)"
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Idź do strony \"Zaawansowane\""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Idź do strony \"Wczytaj/Zapisz\""
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Idź do strony \"Wtyczki\""
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Idź do strony \"Wyniki\""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Idź do strony \"Standard\""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "Rozpocznij"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Widok"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Dod&aj"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "Pomoc"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "Zapisz"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "Usuń"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "Wczytaj"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "&Zapisz"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Zapisz z \"Start w katalogu\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Jeśli zapiszesz jako \"Start w katalogu\" zostanie przywrócony podczas ładowania szablonu. Użyj, jeśli chcesz naprawić wyszukiwanie do określonych katalogów"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Użyj szblonu"
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Znajdź pliki"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Rozróżniaj wielkość liter"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "Od daty:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Do daty:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "Wielkość od:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Wielkość do:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "Wyszukaj w &archiwach"
#: tfrmfinddlg.cbfindtext.caption
msgid "Find &text in file"
msgstr "Znajdź &tekst w pliku"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgid "Follow s&ymlinks"
msgstr "Śledź linki symboliczne"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgid "Find files N&OT containing the text"
msgstr "Pliki &NIE zawierające tekstu"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Nie starsze niż:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Otwarte zakładki"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Szukaj części nazwy pliku"
#: tfrmfinddlg.cbregexp.caption
msgid "&Regular expression"
msgstr "Wyrażenie regularne"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "Za&mień tekst"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Wybrane katalogi i pliki"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "Wyrażenie regularne"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "Czas od:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "Czas do:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "&Użyj wtyczki wyszukiwania:"
#: tfrmfinddlg.chkhex.caption
msgid "Hexadecimal"
msgstr ""
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Wprowadź nazwy katalogów, które powinny być wyłączone z wyszukiwania oddzielone \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Wprowadź nazwy plików, które powinny być wyłączone z wyszukiwania oddzielone \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Wpisz nazwy plików oddzielone \";\""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Katalogi"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Pliki"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Znajdź dane"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Atry&buty"
#: tfrmfinddlg.lblencoding.caption
msgid "Encodin&g:"
msgstr "Kodowanie:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "Wyklucz podkatalogi"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Wyklucz pliki"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "Maska &pliku"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Rozpocznij w &katalogu"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Przeszukuj po&dkatalogi:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Poprzednie wyszukiwanie:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr "Akcja"
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr "Dla wszystkich innych, anuluj, zamknij i zwolnij z pamięci"
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Otwórz w nowej zakładce(zakładkach)"
#: tfrmfinddlg.mioptions.caption
msgctxt "TFRMFINDDLG.MIOPTIONS.CAPTION"
msgid "Options"
msgstr "Opcje"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Usuń z listy"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr "Wynik"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Pokaż wszystkie znalezione pozycje"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Pokaż w Edytorze"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Podgląd"
#: tfrmfinddlg.miviewtab.caption
msgctxt "TFRMFINDDLG.MIVIEWTAB.CAPTION"
msgid "&View"
msgstr "Widok"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Zaawansowane"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Wczytaj/zapisz"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Wtyczki"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Wyniki"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Podstawowe"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "Szukaj"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Szukaj"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "Uwzględniaj wielość liter"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Utwórz link twardy"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "tfrmhardlink.lblexistingfile.caption"
msgid "&Destination that the link will point to"
msgstr "Obiekt docelowy, który będzie wskazywał link"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "tfrmhardlink.lbllinktocreate.caption"
msgid "&Link name"
msgstr "Nazwa &linku"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr "Importuj wszystko!"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr "Importuj wybrane"
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr "Wybierz wpisy do zaimportowania"
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Po kliknięciu podmenu, wybierz całe menu"
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Przytrzymaj klawisz CTRL i kliknij, aby zaznaczyć wiele wpisów"
#: tfrmlinker.btnsave.caption
msgctxt "tfrmlinker.btnsave.caption"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgid "Linker"
msgstr "Linkowanie"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Zapisz jako..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Obiekt"
#: tfrmlinker.lblfilename.caption
msgid "&File name"
msgstr "Nazwa pliku"
#: tfrmlinker.spbtndown.caption
msgctxt "tfrmlinker.spbtndown.caption"
msgid "Do&wn"
msgstr "W dół"
#: tfrmlinker.spbtndown.hint
msgid "Down"
msgstr "W dół"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "Usuń"
#: tfrmlinker.spbtnrem.hint
msgctxt "TFRMLINKER.SPBTNREM.HINT"
msgid "Delete"
msgstr "Usuń"
#: tfrmlinker.spbtnup.caption
msgctxt "tfrmlinker.spbtnup.caption"
msgid "&Up"
msgstr "W górę"
#: tfrmlinker.spbtnup.hint
msgid "Up"
msgstr "W górę"
#: tfrmmain.actabout.caption
msgid "&About"
msgstr "O programie"
#: tfrmmain.actactivatetabbyindex.caption
msgid "Activate Tab By Index"
msgstr ""
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Dodaj nazwę pliku do paska poleceń"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr "Nowe wystąpienie wyszukiwania..."
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Dodaj ścieżkę i nazwę pliku do paska poleceń"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Kopiuj ścieżkę do paska poleceń"
#: tfrmmain.actbenchmark.caption
msgid "&Benchmark"
msgstr ""
#: tfrmmain.actbriefview.caption
msgid "Brief view"
msgstr "Krótki"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Krótki widok"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Oblicz zajmowane &miejsce"
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Zmień katalog"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Zmień katalog na domowy"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Zmień katalog na wyższy"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Przejdź do katalogu głównego"
#: tfrmmain.actchecksumcalc.caption
msgid "Calculate Check&sum..."
msgstr "O&blicz sumy kontrolne..."
#: tfrmmain.actchecksumverify.caption
msgid "&Verify Checksum..."
msgstr "Sprawdź s&umy kontrolne..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Wyczyść plik logów"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Wyczyść okno logów"
#: tfrmmain.actclosealltabs.caption
msgid "Close &All Tabs"
msgstr "Zamknij wszystkie k&arty"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Zamknij zduplikowane zakładki"
#: tfrmmain.actclosetab.caption
msgid "&Close Tab"
msgstr "Zamknij zakładkę"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Następny wiersz polecenia"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Ustaw wiersz polecenia do następnego polecenia w historii"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Poprzedni wiersz polecenia"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Ustaw wiersz polecenia do poprzedniego polecenia w historii"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Pełny"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Widok kolumn"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Porównaj &zawartość"
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr "Porównaj katalogi"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Porównaj katalogi"
#: tfrmmain.actconfigarchivers.caption
msgid "Configuration of Archivers"
msgstr ""
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Konfiguracja ulubionych katalogów"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Konfiguracja ulubionych zakładek"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Konfiguracja zakładek folderów"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Konfiguracja skrótów klawiszowych"
#: tfrmmain.actconfigplugins.caption
msgid "Configuration of Plugins"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Zapisz ustawienia"
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr "Konfiguracja wyszukiwań"
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Pasek narzędzi..."
#: tfrmmain.actconfigtooltips.caption
msgid "Configuration of tooltips"
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Konfiguracja menu widoku drzewa"
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Konfiguracja kolorów menu widoku drzewa"
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Pokaż menu kontekstowe"
#: tfrmmain.actcopy.caption
msgctxt "TFRMMAIN.ACTCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiuj"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Skopiuj wszystkie zakładki na przeciwną stronę"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Skopiuj wszystkie pokazane &kolumny"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Kopiuj nazwę pliku(ów) ze ścieżką &dostępu"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "&Kopiuj nazwę(y) pliku(ów) do schowka"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Kopiuj bez pytania o potwierdzenie"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr "Kopiuj pełną scieżkę wybranego pliku(ów) bez końcowego separatora katalogu"
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Kopiuj pełną ścieżkę wybranego pliku(ów)"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Kopiuj do tego samego panelu"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "Kopiuj"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Pokaż zajęte miejsce"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Wytnij"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Pokaż parametry polecenia"
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Usuń"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr "Dla wszystkich wyszukiwań, anuluj, zamknij i zwolnij z pamięci"
#: tfrmmain.actdirhistory.caption
msgid "Directory history"
msgstr "Historia katalogów"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Ulubione katalogi"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Wybierz dowolne polecenie i wykonaj je"
#: tfrmmain.actedit.caption
msgctxt "TFRMMAIN.ACTEDIT.CAPTION"
msgid "Edit"
msgstr "Edytuj"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Edytuj k&omentarz..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Utwórz plik"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Edycja ścieżki nad listą plików"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Zamień panele"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr "Uruchom skrypt"
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "Zakończ"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "&Rozpakuj pliki..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Skoj&arzenia plików..."
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "P&ołącz pliki..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Pokaż &właściwości pliku"
#: tfrmmain.actfilespliter.caption
msgid "Spl&it File..."
msgstr "Po&dziel plik"
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "Płaski widok (bez podkatalogów)"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Przejdź do lini poleceń"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actfocustreeview.caption
msgid "Focus on tree view"
msgstr ""
#: tfrmmain.actfocustreeview.hint
msgid "Switch between current file list and tree view (if enabled)"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Umieść kursor na pierwszym pliku listy"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Umieść kursor na ostatnim pliku listy"
#: tfrmmain.acthardlink.caption
msgid "Create &Hard Link..."
msgstr "Utwórz link &twardy..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "Zawartość"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "Poziome ustawienie paneli"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "Skróty klawiaturowe"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Krótki widok w lewym panelu"
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Widok kolumn w lewym panelu"
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Lewa &= Prawa"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "Płaski widok w lewym panelu"
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Otwórz listę dysków z lewej"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Odwrotna kolejność w lewym panelu"
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Sortuj lewy panel wg &Atrybutów"
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Sortuj lewy panel wg &Daty"
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "Sortuj lewy panel wg Rozsz&erzenia"
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "SOrtuj lewy panel wg &Nazwy"
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Sortuj lewy panel wg Rozmiaru"
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Widok miniatur w lewym panelu"
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "Załaduj zakładki z Ulubionych zakładek"
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Wczytaj zaznaczenie ze S&chowka"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "Wczytaj wybór z p&liku..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "Wczytaj zakładki z p&liku"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "Utwórz katalog"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Zaznacz wszystko z tym samym &rozszerzeniem"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr "Zaznacz wszystkie pliki z tą samą nazwą"
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr "Zaznacz wszystkie pliki z tą samą nazwą i rozszerzeniem"
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr "Zaznacz wszystkie z tą samą ścieżką"
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "&Odwróć zaznaczenie"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "Zaznacz &wszystko"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "Odznacz grupę..."
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "Zaznacz &grupę..."
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "&Usuń zaznaczenie"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimalizuj okno"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Zmiany w&ielokrotne"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Połączenie sieciowe"
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "Rozłącz sieć"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Szybkie połączenie sieciowe..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Nowa zakładka"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr "Wczytaj następne Ulubione zakładki z listy"
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Przełącz do &kolejnej zakładki"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Otwórz"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Otwórz archiwum"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Otwórz plik paska"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Otwórz katalog w &nowej zakładce"
#: tfrmmain.actopendrivebyindex.caption
msgid "Open Drive by Index"
msgstr ""
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgid "Open &VFS List"
msgstr "Otwórz listę VFS"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "Podgląd &operacji"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "Opcje"
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "S&pakuj pliki"
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Ustaw położenie elementu rozdzielającego"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "Wklej"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Wczytaj poprzednie Ulubione zakładki z listy"
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Wróć do &poprzedniej zakładki"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Szybki filtr"
#: tfrmmain.actquicksearch.caption
msgid "Quick search"
msgstr "Szybkie wyszukiwanie"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "&Panel szybkiego podglądu"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "Odśwież"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Wczytaj ponownie ostatnio wczytane Ulubione zakładki"
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Przenieś"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Przenieś/zmień nazwę bez potwierdzania"
#: tfrmmain.actrenameonly.caption
msgctxt "tfrmmain.actrenameonly.caption"
msgid "Rename"
msgstr "Zmień nazwę"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "Zmień &nazwę zakładki"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Przywróć wybór"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "&Odwrotna kolejność"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Krótki widok z prawym panelu"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Widok kolumn w prawym panelu"
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Prawy &= lewy"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "Płaski widok w prawym panelu"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Otwórz listę dysków z prawej"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "Odwróć kolejnoś w prawym panelu"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Sortuj prawy panel wg &Atrybutów"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Sortuj prawy panel wg &Daty"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Sortuj prawy panel wg Rozsz&erzenia"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Sortuj prawy panel wg &Nazwy"
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "SOrtuj prawy panel wg Rozmiaru"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Widok miniatur w prawym panelu"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Otwórz &terminal"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Zapisz bieżące zakładki do Nowych Ulubionych Zakładek"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "&Zapisz wybór"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Z&apisz wybór do pliku..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "Zapi&sz zakładki do pliku"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Znajdź..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Wszystkie zakładki Zablokowane z otwieraniem katalogów w nowych zakładkach"
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Ustaw wszystkie zakładki jako Normalne"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Ustaw wszystkie zakładki jako Zablokowane"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Wszystkie zakładki Zablokowane z możliwością zmiany katalogu"
#: tfrmmain.actsetfileproperties.caption
msgid "Change &Attributes..."
msgstr "Zmień &atrybuty..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Katalogi otwierane w &nowych zakładkach"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normalna"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Zablokowana"
#: tfrmmain.actsettaboptionpathresets.caption
msgid "Locked with &Directory Changes Allowed"
msgstr "Zablokowana, ale możliwa zmiana &katalogu"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Otwórz"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Otwórz za pomocą skojarzeń systemowych"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Pokaż menu na przyciskach"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Pokaż historie linii poleceń"
#: tfrmmain.actshowmainmenu.caption
msgid "Menu"
msgstr "Menu"
#: tfrmmain.actshowsysfiles.caption
msgid "Show &Hidden/System Files"
msgstr "Pokaż pliki &ukryte/systemowe"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Sortuj wg &atrybutów"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Sortuj wg &daty"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Sortuj wg rozszerzenia"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Sortuj wg &nazwy"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Sortuj wg &wielkości"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Otwórz listę dysków"
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Włącz/wyłącz plik ignorowania plików, aby nie pokazywać nazw plików"
#: tfrmmain.actsymlink.caption
msgid "Create Symbolic &Link..."
msgstr "Utwórz link &symboliczny..."
#: tfrmmain.actsyncdirs.caption
msgid "Syn&chronize dirs..."
msgstr "Synchronizuj katalogi..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Wyrównaj zawartości okien"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Testuj ar&chiwum"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Miniatury"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Widok miniatur"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr "Przełącz pełnoekranowy tryb konsoli"
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Otwórz ten katalog w lewym oknie"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Otwórz ten katalog w prawym oknie"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "Panel widoku drzewa"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr "Sortuj według parametrów"
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Odznacz wszystko z tym samym rozszerzeniem"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr "Odznacz wszystkie pliki z tą samą nazwą"
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr "Odznacz wszystkie pliki z tą samą nazwą i rozszerzeniem"
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr "Odznacz wszystkie z tą samą ścieżką"
#: tfrmmain.actview.caption
msgctxt "TFRMMAIN.ACTVIEW.CAPTION"
msgid "View"
msgstr "Podgląd"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Pokaż historię odwiedzanych ścieżek dla aktywnego widoku"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Przejdź do następnego wpisu w historii"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Przejdź do poprzedniego wpisu w historii"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Podgląd pliku dziennika"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr "Zobacz wystąpienia bieżącego wyszukiwania"
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Odwiedź stronę Double Commander"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Wyczyść"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr "Praca z ulubionymi katalogami i parametrami"
#: tfrmmain.btnf10.caption
msgctxt "TFRMMAIN.BTNF10.CAPTION"
msgid "Exit"
msgstr "Wyjście"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Katalog"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Usuń"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminal"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Ulubione katalogi"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Pokaż bieżący katalog prawego panelu w lewym panelu"
#: tfrmmain.btnlefthome.caption
msgctxt "tfrmmain.btnlefthome.caption"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Idź do katalogu domowego"
#: tfrmmain.btnleftroot.caption
msgctxt "tfrmmain.btnleftroot.caption"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Idź do katalogu głównego"
#: tfrmmain.btnleftup.caption
msgctxt "tfrmmain.btnleftup.caption"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Przejdź do katalogu nadrzędnego"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Lista katalogów"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Pokaż bieżący katalog lewego panelu w prawym panelu"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "tfrmmain.lblcommandpath.caption"
msgid "Path"
msgstr "Ścieżka"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Anuluj"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Kopiuj..."
#: tfrmmain.mihardlink.caption
msgid "Create link..."
msgstr "Utwórz link..."
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Wyczyść"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiuj"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Ukryj"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Zaznacz wszystko"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Przenieś..."
#: tfrmmain.misymlink.caption
msgid "Create symlink..."
msgstr "Utwórz link symboliczny..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Opcje zakładek"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "Koniec"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Przywróć"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Start"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Anuluj"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "Polecenia"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "Konfiguracja"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Ulubione"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "Pliki"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "Pomoc"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "Zaznacz"
#: tfrmmain.mnunetwork.caption
msgctxt "tfrmmain.mnunetwork.caption"
msgid "Network"
msgstr "Sieć"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "Widok"
#: tfrmmain.mnutaboptions.caption
msgid "Tab &Options"
msgstr "&Opcje"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "Zakładki"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiuj"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Wytnij"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Usuń"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Edytuj"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Wstaw"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmmaincommandsdlg.caption
msgctxt "tfrmmaincommandsdlg.caption"
msgid "Select your internal command"
msgstr "Wybierz wewnętrzne polecenie"
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Wybierz wszystkie kategorie z domyślnych"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Zaznaczenie:"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "&Kategorie:"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "&Nazwa polecenia:"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Filtr:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Wskazówka:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Skrót:"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "Kategoria"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Pomoc"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Wskazówka"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Skrót"
#: tfrmmaskinputdlg.btnaddattribute.caption
msgctxt "TFRMMASKINPUTDLG.BTNADDATTRIBUTE.CAPTION"
msgid "&Add"
msgstr "Dod&aj"
#: tfrmmaskinputdlg.btnattrshelp.caption
msgctxt "TFRMMASKINPUTDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "Pomoc"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "Definiuj..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Wielkość liter"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr "Ignoruj akcenty i ligatury"
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr "Atry&buty:"
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Wprowadź maskę:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "Lub wybierz predefiniowany rodzaj zaznaczenia:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Utwórz nowy katalog"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "Podaj nazwę katalogu:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr "Nowy rozmiar"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Wysokość:"
#: tfrmmodview.lblpath1.caption
msgctxt "tfrmmodview.lblpath1.caption"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Jakośc kompresji do Jpg"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Szerokość:"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Wysokość"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "tfrmmodview.tewidth.text"
msgid "Width"
msgstr "Cyfry"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr "456456465465465"
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Zamknij"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "Usuń"
#: tfrmmultirename.btnedit.caption
msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "Edytuj"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "Wczytaj"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "Zmień nazwę"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Porzuć wszystko"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "Zapisz"
#: tfrmmultirename.caption
msgid "MultiRename"
msgstr "Wielokrotna zmiana nazwy"
#: tfrmmultirename.cblog.caption
msgid "Ena&ble"
msgstr "Włącz"
#: tfrmmultirename.cbregexp.caption
msgid "Regular e&xpressions"
msgstr "Wyrażenie regularne"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "Podmiana"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Rozszerzenie"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Licznik"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Znajdź i zamień"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Rezultat"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Maska"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Wzorce"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "Rozszerzenie"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "Znajdź"
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "Przerwa"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "Nazwa pliku"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "Zamień..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "Liczba początkowa"
#: tfrmmultirename.lbwidth.caption
msgid "&Width"
msgstr "Szerokość"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Licznik"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Dzień"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Dzień (2 cyfry)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Dzień tygodnia (krótki, np. \"pon\")"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Dzień tygodnia (długi, np. \"poniedziałek\")"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Znak na pozycji x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Znaki na pozycjach od x do y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Godzina"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Godzina (2 cyfry)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minuta"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minuty (2 cyfry)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[М] Miesiąc"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Miesiąc (2 cyfry)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Nazwa miesiąca (krótka, np. \"sty\")"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Nazwa miesiąca (długa, np. \"styczeń\")"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Nazwa"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Znak na pozycji x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:x] Znaki na pozycjach od x do y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Czas..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Rozszerzenie..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Nazwa..."
#: tfrmmultirename.miplugin.caption
msgctxt "tfrmmultirename.miplugin.caption"
msgid "Plugin"
msgstr "Wtyczka"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] sekunda"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Sekundy (2 cyfry)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Rok (2 cyfry)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Rok (4 cyfry)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Edytuj nazw..."
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Wczytaj nazwy z pliku..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgid "Old File Name"
msgstr "Stara nazwa pliku"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgid "New File Name"
msgstr "Nowa nazwa pliku"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgid "File Path"
msgstr "Ścieżka"
#: tfrmmultirenamewait.caption
msgctxt "TFRMMULTIRENAMEWAIT.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Wybierz aplikację"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Własne polecenie"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Zapisz skojarzenia"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Ustaw wybraną aplikację jako domyślną akcję"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Typ pliku do otwarcia: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Wiele nazw plików"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Wiele URI"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Pojedyncza nazwa pliku"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "Pojedynczy URI"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgid "&Apply"
msgstr "Zastosuj"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Opcje"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Proszę wybrać jedną z podstron, ta strona nie zawiera żadnych ustawień"
#: tfrmoptionsarchivers.btnarchiveradd.caption
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
msgid "A&dd"
msgstr "Dodaj"
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverapply.caption
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
msgid "A&pply"
msgstr "Zastosuj"
#: tfrmoptionsarchivers.btnarchivercopy.caption
msgctxt "tfrmoptionsarchivers.btnarchivercopy.caption"
msgid "Cop&y"
msgstr "Kopiuj"
#: tfrmoptionsarchivers.btnarchiverdelete.caption
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
msgid "Delete"
msgstr "Usuń"
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverother.caption
msgctxt "tfrmoptionsarchivers.btnarchiverother.caption"
msgid "Oth&er..."
msgstr "Inne..."
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionsarchivers.btnarchiverrename.caption
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
msgid "&Rename"
msgstr "Zmień nazwę"
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiverids.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
msgid "Options:"
msgstr "Opcje:"
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
msgid "Format parsing mode:"
msgstr "Tryb parsowania formatu:"
#: tfrmoptionsarchivers.chkarchiverenabled.caption
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
msgid "E&nabled"
msgstr "Włączone"
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
msgid "De&bug mode"
msgstr "Tryb debugowania"
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
msgid "S&how console output"
msgstr "Pokaż wyjście konsoli"
#: tfrmoptionsarchivers.chkfilenameonlylist.caption
msgid "Use archive name without extension as list"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
msgid "Uni&x file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
msgid "&Unix path delimiter \"/\""
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
msgid "Windows &file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
msgid "Windows path deli&miter \"\\\""
msgstr ""
#: tfrmoptionsarchivers.lblarchiveradd.caption
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
msgid "Add&ing:"
msgstr "Dodaj:"
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
msgid "Arc&hiver:"
msgstr "Archiwizer:"
#: tfrmoptionsarchivers.lblarchiverdelete.caption
msgid "De&lete:"
msgstr "Usuń:"
#: tfrmoptionsarchivers.lblarchiverdescription.caption
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
msgid "De&scription:"
msgstr "Opis:"
#: tfrmoptionsarchivers.lblarchiverextension.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
msgid "E&xtension:"
msgstr "Rozszerzenia:"
#: tfrmoptionsarchivers.lblarchiverextract.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
msgid "Ex&tract:"
msgstr "Wypakuj:"
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
msgid "Extract &without path:"
msgstr "Rozpakuj bez ścieżki:"
#: tfrmoptionsarchivers.lblarchiveridposition.caption
msgid "ID Po&sition:"
msgstr "ID pozycji:"
#: tfrmoptionsarchivers.lblarchiverids.caption
msgid "&ID:"
msgstr "ID:"
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
msgid "ID See&k Range:"
msgstr "Zakres wyszukiwania ID:"
#: tfrmoptionsarchivers.lblarchiverlist.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
msgid "&List:"
msgstr "Listuj:"
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
msgid "Archi&vers:"
msgstr "Archiwizatory:"
#: tfrmoptionsarchivers.lblarchiverlistend.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
msgid "Listing &finish (optional):"
msgstr "Koniec listingu (opcjonalnie)"
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
msgid "Listing for&mat:"
msgstr "Format listingu:"
#: tfrmoptionsarchivers.lblarchiverliststart.caption
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
msgid "Listin&g start (optional):"
msgstr "Początek listingu (opcjonalnie):"
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
msgid "Password &query string:"
msgstr "Ciąg zapytania hasła:"
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
msgid "Create self extractin&g archive:"
msgstr "Utwórz archiwum samorozpakowujące:"
#: tfrmoptionsarchivers.lblarchivertest.caption
msgid "Tes&t:"
msgstr "Test:"
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
msgid "Auto Configure"
msgstr "Auto konfiguracja"
#: tfrmoptionsarchivers.miarchiverdisableall.caption
msgid "Disable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
msgid "Discard modifications"
msgstr ""
#: tfrmoptionsarchivers.miarchiverenableall.caption
msgid "Enable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverexport.caption
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
msgid "Export..."
msgstr "Eksport..."
#: tfrmoptionsarchivers.miarchiverimport.caption
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
msgid "Import..."
msgstr "Importuj..."
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
msgid "Sort archivers"
msgstr ""
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgid "Additional"
msgstr "Dodatkowe"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr "Ogólne"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgid "When &size, date or attributes change"
msgstr "Po zmianie &wielkości, daty lub atrybutów"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "Dla następujących ścieżek i ich podkatalogów:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgid "When &files are created, deleted or renamed"
msgstr "Po &utworzeniu pliku, skasowaniu i zmianie nazwy"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgid "When application is in the &background"
msgstr "Gdy program działa w &tle"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgid "Disable auto-refresh"
msgstr "Wyłącz autoodświeżanie"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgid "Refresh file list"
msgstr "Odśwież listę plików"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgid "Al&ways show tray icon"
msgstr "Ikona zawsze widoczna na pasku"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Automatycznie ukryj odmontowane urządzenia"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgid "Mo&ve icon to system tray when minimized"
msgstr "Pokazuj ikonę na pasku gdy zminimalizowany"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgid "A&llow only one copy of DC at a time"
msgstr "Pozwól uruchomic tylko jedną kopię DC na raz"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Tu można wpisać jeden lub więcej dysków oddzielonych średnikiem \";\"."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Czarna lista napędów"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Rozmiar kolumn"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Pokaż rozszerzenia pliku"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "wyrównane (z Tabulatorem)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "bezpośrednio po nazwie pliku"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Automatycznie"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Stała liczba kolumn"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Stała szerokość kolumn"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "Obetnij tekst do szerokości kolumny"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "Linie poziome"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "Linie pionowe"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "Automatycznie wypełniaj kolumny"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Pokaż siatkę"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Autorozmiar kolumn"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Autorozmiar kolumn:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "Zastosuj"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "Edytuj"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "Historię linii poleceń"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgid "&Directory history"
msgstr "Historię katalogów"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "Historię masek plików"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "Konfigurację"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "Historię znajdź/zamień"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Katalog"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Położenie plików konfiguracji"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Zapisz przy wyjściu"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Kolejność sortowania porządku konfiguracji w drzewie po lewej"
#: tfrmoptionsconfiguration.gpconfigurationtreestate.caption
msgid "Tree state when entering in configuration page"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Ustaw w linii komend"
#: tfrmoptionsconfiguration.lblhighlighters.caption
msgid "Highlighters:"
msgstr ""
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "Katalog programu (wersja portable)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "Katalog domowy użytkownika"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszsytkich kolumn"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszytskich kolumn"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
msgid "All"
msgstr "Wszystko"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
msgid "Apply modification to all columns"
msgstr "Zastosuj zmiany do wszystkich kolumn"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
msgid "&Delete"
msgstr "Usuń"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Przejdź do ustawień domyślnych"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
msgid "New"
msgstr "Nowy"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "Następny"
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "Poprzedni"
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
msgid "Rename"
msgstr "Zmień nazwę"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
msgid "Reset to default"
msgstr "Przywróć domyślne"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
msgid "Save as"
msgstr "Zapisz jako"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
msgid "Save"
msgstr "Zapisz"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Zezwól na nakładanie kolorów"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "Po kliknięciu zmiany, zmień dla wszystkich kolumn"
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
msgid "General"
msgstr "Ogólne"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Obramowanie kursora"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Użyj ramki kursora"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Użyj koloru nieaktywnego zaznaczenia"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Użyj odwrotnego zaznaczenia"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Użyj niestandardowej czcionki i koloru dla tego widoku"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgid "BackGround:"
msgstr "Tło:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgid "Background 2:"
msgstr "Tło 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Konfiguracja kolumn dla systemu plików:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Bieżąca nazwa kolumny]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgid "Cursor Color:"
msgstr "Kolor kursora:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgid "Cursor Text:"
msgstr "Kolor tekstu pod kursorem:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgid "Font:"
msgstr "Czcionka:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
msgid "Size:"
msgstr "Rozmiar:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgid "Text Color:"
msgstr "Kolor tekstu:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Kolor nieaktywnego kursora:"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Kolor nieaktywnego zazn.:"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgid "Mark Color:"
msgstr "Kolor zaznaczenia:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Ustawienia dla kolumn:"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgid "Add column"
msgstr "Dodaj kolumnę"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Położenie ramki panelu po porównaniu:"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr "Dodaj kopię wybranego wpisu"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Dodaj separator"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Zwiń wszystko"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Usuń wybraną pozycję"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Otwórz wszystkie gałęzie"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Dodaj.."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Kopia zapasowa..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Usuń..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Eksportuj..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION"
msgid "&Help"
msgstr "Pomoc"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Importuj..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Wstaw..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "Różne..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgid "Some functions to select appropriate target"
msgstr "Niektóre funkcje by wybrać odpowiedni cel"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Sortuj..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "Gdy dodajesz katalog, dodaj także cel"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Zawsze rozwijaj drzewo"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Pokaż tylko prawidłowe zmienne środowiskowe"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Nazwa, a-z"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr "Nazwa, a-z"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Lista katalogów (zmień porządek przez \"przeciągnij i upuść\")"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Pozostałe opcje"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr "Nazwa:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr "Ścieżka:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgid "&Target:"
msgstr "Cel:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "do pliku ulubionych katalogów (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "do \"wincmd.ini\" z TC (zachowaj istniejące)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "do \"wincmd.ini\" z TC (usuń istniejące)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Przejdź do powiązanej informacji konfiguracji TC"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to &configure TC related info"
msgstr "Przejdź do powiązanej informacji konfiguracji TC"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "Menu testowe ulubionych katalogów"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "z pliku ulubionych katalogów (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "z TC \"wincmd.ini\""
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "Przywróć kopię ulubionych katalogów"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "Zapisz kopię bieżących ulubionych katalogów"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Znajdź i zamień..."
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...wszystko od A do Z!"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr "Testuj wynikowe menu"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Dla wszystkich obsługiwanych formatów, pytaj jakich użyć za każdym razem"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Podczas zapisywania tekstu Unicode, zapisz go w formacie UTF8 (w przeciwnym razie będzie UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Po upuszczeniu tekstu, automatycznie generuj nazwę pliku (w przeciwnym razie będzie monitował użytkownika)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Pokaż okno dialogowe potwierdzenia po upuszczeniu"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Podczas przeciągania i upuszczania tekstu do paneli:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Umieścić najbardziej pożądany format na szczycie listy (użyj przeciągnij i upuść):"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(jeśli najbardziej pożądany nie jest obecny, bierzemy drugi i tak dalej)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(jeśli nie działa z jakąś źródłową aplikacją, spróbuj odznaczyć jeśli problem)"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Pokaż system plików"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Pokaż wolne miejsce"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Pokaż nazwę"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Lista urządzeń"
#: tfrmoptionseditor.chkautoindent.caption
msgid "Auto Indent"
msgstr ""
#: tfrmoptionseditor.chkautoindent.hint
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
msgstr ""
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr ""
#: tfrmoptionseditor.chkscrollpastendline.hint
msgid "Allows caret to go into empty space beyond end-of-line position"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Pokaż znaki specjalne"
#: tfrmoptionseditor.chkshowspecialchars.hint
msgid "Shows special characters for spaces and tabulations"
msgstr ""
#: tfrmoptionseditor.chksmarttabs.caption
msgid "Smart Tabs"
msgstr ""
#: tfrmoptionseditor.chksmarttabs.hint
msgid "When using <Tab> key, caret will go to the next non-space character of the previous line"
msgstr ""
#: tfrmoptionseditor.chktabindent.caption
msgid "Tab indents blocks"
msgstr ""
#: tfrmoptionseditor.chktabindent.hint
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.caption
msgid "Use spaces instead tab characters"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.hint
msgid "Converts tab characters to a specified number of space characters (when entering)"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.caption
msgid "Delete trailing spaces"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.hint
msgid "Auto delete trailing spaces, this applies only to edited lines"
msgstr ""
#: tfrmoptionseditor.edtabwidth.hint
msgctxt "tfrmoptionseditor.edtabwidth.hint"
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Opcje wewnętrznego edytora"
#: tfrmoptionseditor.lbltabwidth.caption
msgid "Tab width:"
msgstr ""
#: tfrmoptionseditor.lbltabwidth.hint
msgctxt "tfrmoptionseditor.lbltabwidth.hint"
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Tło"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "Tło"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Resetuj"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr "Zapisz"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Atrybuty jednostki"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Kolor pierwszego planu"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "Kolor pierwszego planu"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "Zaznaczony tekst"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Używaj (i edytuj) globalny schemat kolorów"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Używaj własny schemat kolorów"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "Pogrubienie"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Odwróć"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Wyłączony"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "Włączony"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "Kursywa"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Odwróć"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Wyłączony"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "Włączony"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "Przekreślony"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Odwróć"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Wyłączony"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "Włączony"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "Podkreślony"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "Odwróć"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "Wyłączony"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "Włączony"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION"
msgid "Add..."
msgstr "Dodaj..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION"
msgid "Delete..."
msgstr "Usuń..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Importuj/Eksportuj"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION"
msgid "Insert..."
msgstr "Wstaw..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION"
msgid "Rename"
msgstr "Zmień nazwę"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION"
msgid "Sort..."
msgstr "Sortuj..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Brak"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION"
msgid "Always expand tree"
msgstr "Zawsze rozwiń drzewo"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Nie"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Lewy"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Prawy"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Lista ulubionych zakładek (zmień kolejność przez \"przeciągnij i upuść\")"
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION"
msgid "Other options"
msgstr "Inne opcje"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Istniejące zakładki do zachowania:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Zapisz historię katalogów"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION"
msgid "a separator"
msgstr "separator"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Dodaj separator"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION"
msgid "sub-menu"
msgstr "pod-menu"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION"
msgid "Add sub-menu"
msgstr "Dodaj pod-menu"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION"
msgid "Collapse all"
msgstr "Zwiń wszystko"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION"
msgid "Cut"
msgstr "Wytnij"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION"
msgid "delete all!"
msgstr "usuń wszystko!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION"
msgid "sub-menu and all its elements"
msgstr "podmenu i wszystkie jego elementy"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION"
msgid "just sub-menu but keep elements"
msgstr "tylko podmenu ale zachowaj jego elemnty"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION"
msgid "selected item"
msgstr "wybrana pozycja"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION"
msgid "Delete selected item"
msgstr "Usuń wybraną pozycję"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr ""
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr "Menu testowe ulubionych zakładek"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Wstaw separator"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Wstaw pod-menu"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION"
msgid "Open all branches"
msgstr "Otwórz wszystkie gałęzie"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION"
msgid "Paste"
msgstr "Wstaw"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION"
msgid "Rename"
msgstr "Zmień nazwę"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr "...wszystko od A do Z!"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr "Testuj wynikowe menu"
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Dodaj"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "Add"
msgstr "Dodaj"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "Dodaj"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "C&lone"
msgstr "Klonuj"
#: tfrmoptionsfileassoc.btncommands.hint
msgctxt "tfrmoptionsfileassoc.btncommands.hint"
msgid "Select your internal command"
msgstr "Wybierz wewnętrzne polecenie"
#: tfrmoptionsfileassoc.btndownact.caption
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "Do&wn"
msgstr "W dół"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edi&t"
msgstr "Edytuj"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Wstaw"
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "&Insert"
msgstr "Wstaw"
#: tfrmoptionsfileassoc.btnparametershelper.hint
msgctxt "tfrmoptionsfileassoc.btnparametershelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsfileassoc.btnrelativecommand.hint
msgctxt "tfrmoptionsfileassoc.btnrelativecommand.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionsfileassoc.btnremoveact.caption
msgid "Remo&ve"
msgstr "Usuń"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgid "Re&move"
msgstr "Usuń"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "Usuń"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "Zmi&eń nazwę"
#: tfrmoptionsfileassoc.btnstartpathpathhelper.hint
msgctxt "tfrmoptionsfileassoc.btnstartpathpathhelper.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionsfileassoc.btnstartpathvarhelper.hint
msgctxt "tfrmoptionsfileassoc.btnstartpathvarhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "W górę"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr ""
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted (manually entering)."
msgstr ""
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description"
msgstr "Opis akcji:"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Akcja"
#: tfrmoptionsfileassoc.gbexts.caption
msgid "Extensions"
msgstr "Rozszerzenie"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Może być sortowane przez \"przeciągnij i upuść\""
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Typ pliku"
#: tfrmoptionsfileassoc.gbicon.caption
msgid "Icon"
msgstr "Ikona"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Czynności mogą być sortowane przez \"przeciągnij i upuść\""
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Rozszerzenia mogą być sortowane przez \"przeciągnij i upuść\""
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Typy plików mogą być sortowane przez \"przeciągnij i upuść\""
#: tfrmoptionsfileassoc.lblaction.caption
msgid "Action &name:"
msgstr "Nazwa akcji:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "Command:"
msgstr "Polecenie:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parametry:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Ścieżka startowa:"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Niestandardowe z..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Niestandardowe"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Edytuj"
#: tfrmoptionsfileassoc.mieditor.caption
msgid "Open in Editor"
msgstr "Otwórz w edytorze"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Edytuj za pomocą..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgid "Get output from command"
msgstr "Wyświetl zwrócone komunikaty polecenia"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Otwórz w wewnętrznym Edytorze"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Otwórz w wewnetrznej Przeglądarce"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Otwórz"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Otwórz za pomocą..."
#: tfrmoptionsfileassoc.mishell.caption
msgid "Run in terminal"
msgstr "Uruchom w terminalu"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Podgląd"
#: tfrmoptionsfileassoc.miviewer.caption
msgid "Open in Viewer"
msgstr "Otwórz w przeglądarce"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Podgląd za pomocą..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Kliknij by zmienić ikonę!"
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "Uruchom przez shell"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Rozszerzone menu kontekstowe"
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Konfiguracja skojarzeń plików"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "Uruchom przez terminal i zamknij"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "Uruchom przez terminal i pozostaw otwarty"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Opcje rozszerzonych pozycji:"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgid "Show confirmation window for:"
msgstr "Pokaż okno potwierdzenia dla:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Operacja kopiowania"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Operacja usuwania"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Usuń do kosza (z Shiftem - usuwa bezpowrotnie)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Operacja usuwania do Kosza"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgid "D&rop readonly flag"
msgstr "Zdejmij flagę \"Tylko do odczytu\""
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "Operacja przenoszenia"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "Komentarze do plików/katalogów"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Przy zmianie nazwy edytuj tylko nazwę (bez rozszerzenia)"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Pokaż pasek postępu podczas kopiowania/przenoszenia"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "Komunikaty o błędach przy operacjach na plikach pokazuj tylko w oknie logów"
#: tfrmoptionsfileoperations.cbverifychecksumconfirmation.caption
msgid "Verify checksum operation"
msgstr ""
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Wykonywanie operacji"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Interfejs użytkownika"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "Rozmiar bufora do operacji na plikach (w KB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Pokaż postęp operacji początkowo w"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgid "Duplicated name auto-rename style:"
msgstr ""
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "Liczba przebiegów zacierania:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Przywróć domyślne ustawienia DC"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Zezwól na nakładanie kolorów"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Używaj kursora jako ramki"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Używaj gradientu kolorów wskaźnika"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Użyj koloru odwrotnej selekcji"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "Używaj odwrotnej selekcji"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Obramowanie kursora"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr "Wskaźnik wolnego miejsca na dysku"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "Tło:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgid "Backg&round 2:"
msgstr "Tło 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgid "C&ursor Color:"
msgstr "Kolor kursora:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgid "Cursor Te&xt:"
msgstr "Tekst pod kursorem:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Kolor nieaktywnego kursora:"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Kolor nieaktywnego zazn.:"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "Przyciemnienie nieaktywnego panelu"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Kolor tła wskaźnika:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Kolor wskaźnika:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgid "&Mark Color:"
msgstr "Kolor zaznaczania:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "Poniżej znajduje się podgląd. Można przesuwać kursor i wybierać pliki, aby natychmiast uzyskać rzeczywisty wygląd różnych ustawień."
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgid "T&ext Color:"
msgstr "Kolor tekstu:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr "Po uruchomieniu wyszukiwania plików, wyczyść filtr maski pliku"
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "&Szukaj części nazwy pliku"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr "Pokaż pasek menu w \"Znajdź pliki\""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr "Wyszukiwanie tekstu w plikach"
#: tfrmoptionsfilesearch.gbfilesearch.caption
msgctxt "TFRMOPTIONSFILESEARCH.GBFILESEARCH.CAPTION"
msgid "File search"
msgstr "Wyszukiwanie plików"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr "Bieżące filtry z przyciskiem \"Nowe wyszukiwanie\":"
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr "Domyślny szablon wyszukiwania:"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Użyj mapowania pamięci dla wyszukiwanego tekstu w plikach"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr ""
#: tfrmoptionsfilesviews.btnaddattribute.caption
msgctxt "TFRMOPTIONSFILESVIEWS.BTNADDATTRIBUTE.CAPTION"
msgid "&Add"
msgstr "Dod&aj"
#: tfrmoptionsfilesviews.btnattrshelp.caption
msgctxt "TFRMOPTIONSFILESVIEWS.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "Pomoc"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "Nie ładuj listy plików aż zakładka zostanie wybrana"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "Pokazuj nazwy katalogów w nawiasach kwadratowych"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Wyróżnij nowe i zaktualizowane pliki"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr ""
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgid "Load &file list in separate thread"
msgstr "Wczytuj listę plików w oddzielnym wątku"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgid "Load icons af&ter file list"
msgstr "Wczytuj ikony po liście plików"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgid "Show s&ystem and hidden files"
msgstr "Pokaż pliki ukryte/systemowe"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Klawisz <spacja> przenosi do następnego pliku (tak jak <INSERT>)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formatowanie"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr "Zaznaczenie/Odznaczenie wpisów"
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Sortowanie"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgid "Default attribute mask value to use:"
msgstr "Domyślna wartość atrybutu maski do użycia:"
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Pisownia wielkich liter:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Nieprawidłowy format"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "Format daty i czasu:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Format rozmiaru pliku:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "Wstaw nowe pliki:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Sortowanie katalogów:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "&Metoda sortowania:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "Przenieś zaktualizowane pliki:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "Dodaj"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "Zastosuj"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "Usuń"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Szablon..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Kolor typu plików (sortuj przez \"przeciągnij i upuść\")"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "Atrybuty kategorii:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Kolor kategorii:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
msgid "Category &mask:"
msgstr "Maska kategorii:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
msgid "Category &name:"
msgstr "Nazwa kategorii:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "&Czcionka konsoli"
#: tfrmoptionsfonts.lbleditorfont.caption
msgid "&Editor font"
msgstr "Czcionka edytora"
#: tfrmoptionsfonts.lbllogfont.caption
msgid "&Log font"
msgstr "Czcionka logów"
#: tfrmoptionsfonts.lblmainfont.caption
msgid "Main &font"
msgstr "Czcionka podstawowa"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Czcionka ścieżki"
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Czcionka wyników eyszukiwania"
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgid "Viewer&Book Font"
msgstr "Czcionka przeglądarki książek"
#: tfrmoptionsfonts.lblviewerfont.caption
msgid "&Viewer font"
msgstr "Czcionka podglądu"
#: tfrmoptionshotkeys.actaddhotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTADDHOTKEY.CAPTION"
msgid "Add &hotkey"
msgstr "Dodaj klawisz skrótu"
#: tfrmoptionshotkeys.actcopy.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiuj"
#: tfrmoptionshotkeys.actdelete.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Usuń"
#: tfrmoptionshotkeys.actdeletehotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETEHOTKEY.CAPTION"
msgid "&Delete hotkey"
msgstr "Usuń klawisz skrótu"
#: tfrmoptionshotkeys.actedithotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTEDITHOTKEY.CAPTION"
msgid "&Edit hotkey"
msgstr "Edytuj klawisz skrótu"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr "Następna kategoria"
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr "Poprzednia kategoria"
#: tfrmoptionshotkeys.actrename.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTRENAME.CAPTION"
msgid "Rename"
msgstr "Zmień nazwę"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr "Przyuwróć domyślne"
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr "Zapisz teraz"
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr "Sortuj według nazwy polecenia"
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr "Sortuj według skrótów klawiszowych (pogrupowane)"
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr "Sortuj według skrótów klawiszowych (po jednym w linii)"
#: tfrmoptionshotkeys.lbfilter.caption
msgid "&Filter"
msgstr "Filtr"
#: tfrmoptionshotkeys.lblcategories.caption
msgid "C&ategories:"
msgstr "Kategorie:"
#: tfrmoptionshotkeys.lblcommands.caption
msgid "Co&mmands:"
msgstr "Polecenia:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgid "&Shortcut files:"
msgstr "Pliki skrótów:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr "Kolejność so&rtowania:"
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr "Kategorie"
#: tfrmoptionshotkeys.micommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.MICOMMANDS.CAPTION"
msgid "Command"
msgstr "Polecenie"
#: tfrmoptionshotkeys.miseparator1.caption
msgctxt "TFRMOPTIONSHOTKEYS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr "Kolejność sortowania"
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Dla następujących ścieżek i ich podkatalogów:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Pokaż ikony dla działań w &menu"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr "Pokaż ikony na przyciskach"
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgid "Show o&verlay icons, e.g. for links"
msgstr "Pokazuj ikony nakładkowo (np dla linków symbolicznych)"
#: tfrmoptionsicons.chkshowhiddendimmed.caption
msgid "&Dimmed hidden files (slower)"
msgstr ""
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Wyłącz specjalne ikony"
#: tfrmoptionsicons.gbiconssize.caption
msgid " Icon size "
msgstr " Rozmiar ikon"
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgid " Show icons to the left of the filename "
msgstr " Pokazuj ikony po lewej stronie nazwy pliku"
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
msgid "A&ll"
msgstr "Wszystkie"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgid "All associated + &EXE/LNK (slow)"
msgstr "Wszystkie skojarzone + &EXE/LNK (wolne)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgid "&No icons"
msgstr "Bez ikon"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgid "Only &standard icons"
msgstr "Tylko standardowe ikony"
#: tfrmoptionsignorelist.btnaddsel.caption
msgid "A&dd selected names"
msgstr "Dodaj wybrane nazwy"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgid "Add selected names with &full path"
msgstr "Dodaj wybrane nazwy z pełną ścieżką"
#: tfrmoptionsignorelist.btnrelativesavein.hint
#, fuzzy
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignoruj (nie pokazuj) następujących plików i katalogów:"
#: tfrmoptionsignorelist.lblsavein.caption
msgid "&Save in:"
msgstr "&Zapisz w:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Strzałki w prawo, lewo zmieniają katalog (nawigacja w stylu Lynksa)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Pisanie"
#: tfrmoptionskeyboard.lblalt.caption
msgid "Alt+L&etters:"
msgstr "Alt+Litery:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+Litery:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "Litery:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
msgid "&Flat buttons"
msgstr "Płaskie przyciski"
#: tfrmoptionslayout.cbflatinterface.caption
msgid "Flat i&nterface"
msgstr "Płaski wygląd"
#: tfrmoptionslayout.cbflattoolbar.caption
msgid "Flat b&uttons"
msgstr "Płaskie przyciski"
#: tfrmoptionslayout.cbfreespaceind.caption
msgid "Show fr&ee space indicator on drive label"
msgstr "Pokaż pasek wolnego miejsca przy etykiecie napędu"
#: tfrmoptionslayout.cblogwindow.caption
msgid "Show lo&g window"
msgstr "Pokaż okno dziennika"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgid "Show panel of operation in background"
msgstr "Pokaż panel operacji w tle"
#: tfrmoptionslayout.cbproginmenubar.caption
msgid "Show common progress in menu bar"
msgstr "Pokaż postęp ogólny na pasku menu"
#: tfrmoptionslayout.cbshowcmdline.caption
msgid "Show command l&ine"
msgstr "Pokaż &linię poleceń"
#: tfrmoptionslayout.cbshowcurdir.caption
msgid "Show current director&y"
msgstr "Pokaż nazwę &bieżącego katalogu"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgid "Show &drive buttons"
msgstr "Pokaż przyciski &dysków"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgid "Show free s&pace label"
msgstr "Pokaż wolne miejsce na dysku"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Pokaż p&rzycisk listy dysków"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgid "Show function &key buttons"
msgstr "Pokaż przyciski klawiszy &funkcyjnych"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgid "Show &main menu"
msgstr "Pokaż główne menu"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgid "Show tool&bar"
msgstr "Pokaż pasek &przycisków"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Pokaż mały opis wolnego miejsca"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgid "Show &status bar"
msgstr "Pokaż pasek &stanu"
#: tfrmoptionslayout.cbshowtabheader.caption
msgid "S&how tabstop header"
msgstr "Pokaż nagłówki &kolumn"
#: tfrmoptionslayout.cbshowtabs.caption
msgid "Sho&w folder tabs"
msgstr "Pokaż &zakładki katalogów"
#: tfrmoptionslayout.cbtermwindow.caption
msgid "Show te&rminal window"
msgstr "Pokaż okno terminala"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Pokazuj dwa paski napędów (zmienna szerokość, nad oknami plików)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgid " Screen layout "
msgstr " Wygląd ekranu głównego"
#: tfrmoptionslog.btnrelativelogfile.hint
#, fuzzy
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Podgląd zawartości pliku dziennika"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Dołącz datę w nazwie pliku dziennika"
#: tfrmoptionslog.cblogarcop.caption
msgid "&Pack/Unpack"
msgstr "Pakowanie/Rozpakowywanie"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Wykonanie wiersza polecenia zewnętrznego"
#: tfrmoptionslog.cblogcpmvln.caption
msgid "Cop&y/Move/Create link/symlink"
msgstr "Kopiowanie/Przenoszenie/Tworzenie dowiązań"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "Usuwanie"
#: tfrmoptionslog.cblogdirop.caption
msgid "Crea&te/Delete directories"
msgstr "Tworzenie/Usuwanie katalogów"
#: tfrmoptionslog.cblogerrors.caption
msgid "Log &errors"
msgstr "Błędy"
#: tfrmoptionslog.cblogfile.caption
msgid "C&reate a log file:"
msgstr "&Utwórz plik dziennika:"
#: tfrmoptionslog.cbloginfo.caption
msgid "Log &information messages"
msgstr "Wyświetlanie komunikatów"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Uruchomienie/zamknięcie"
#: tfrmoptionslog.cblogsuccess.caption
msgid "Log &successful operations"
msgstr "Informacje o zakończonej operacji"
#: tfrmoptionslog.cblogvfs.caption
msgid "&File system plugins"
msgstr "Wtyczki systemu plików"
#: tfrmoptionslog.gblogfile.caption
msgid "File operation log file"
msgstr "Plik dziennika dla operacji na plikach"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Zapisz operacje"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Stan operacji"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
#, fuzzy
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
#, fuzzy
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
#, fuzzy
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "Usuń miniatury dla nie istniejących plików"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr "Podgląd zawartości pliku dziennika"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION"
msgid "Create new with the encoding:"
msgstr "Utwórz nowy z kodowaniem:"
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Zawsze idź do katalogu głównego dysku podczas zmiany dysków"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Pokaż tylko komunikaty o błędach (z przyciskiem \"Ok\")"
#: tfrmoptionsmisc.chkthumbsave.caption
msgid "&Save thumbnails in cache"
msgstr "Zapisz miniatury w pamięci cache"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Miniatury"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr "Plik komentarza (descript.on)"
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr ""
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION"
msgid "Default encoding:"
msgstr "Domyślne kodowanie:"
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Plik konfiguracji:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "Plik wykonywalny TC"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Ścieżka wyjściowa paska narzędzi:"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "piksele"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "Rozmiar miniatur"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "Zaznaczanie myszką"
#: tfrmoptionsmouse.chkcursornofollow.caption
msgid "The text cursor no longer follows the mouse cursor"
msgstr ""
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
msgid "By clic&king on icon"
msgstr ""
#: tfrmoptionsmouse.gbopenwith.caption
msgctxt "tfrmoptionsmouse.gbopenwith.caption"
msgid "Open with"
msgstr "Otwórz z ..."
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Przewijanie"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Wybór"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "Tryb:"
#: tfrmoptionsmouse.rbdoubleclick.caption
msgid "Double click"
msgstr ""
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "Wiersz po wierszu"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Wiersz po wierszu z przesuwaniem kursora"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "Strona po stronie"
#: tfrmoptionsmouse.rbsingleclickboth.caption
msgid "Single click (opens files and folders)"
msgstr ""
#: tfrmoptionsmouse.rbsingleclickfolders.caption
msgid "Single click (opens folders, double click for files)"
msgstr ""
#: tfrmoptionspluginsbase.btnaddplugin.caption
msgctxt "tfrmoptionspluginsbase.btnaddplugin.caption"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionspluginsbase.btnconfigplugin.caption
msgctxt "tfrmoptionspluginsbase.btnconfigplugin.caption"
msgid "Con&figure"
msgstr "Konfiguruj"
#: tfrmoptionspluginsbase.btnenableplugin.caption
msgctxt "tfrmoptionspluginsbase.btnenableplugin.caption"
msgid "E&nable"
msgstr "Włącz"
#: tfrmoptionspluginsbase.btnremoveplugin.caption
msgctxt "tfrmoptionspluginsbase.btnremoveplugin.caption"
msgid "&Remove"
msgstr "Usuń"
#: tfrmoptionspluginsbase.btntweakplugin.caption
msgctxt "tfrmoptionspluginsbase.btntweakplugin.caption"
msgid "&Tweak"
msgstr "Dostosuj"
#: tfrmoptionspluginsbase.lblplugindescription.caption
msgctxt "tfrmoptionspluginsbase.lblplugindescription.caption"
msgid "Description"
msgstr "Opis"
#: tfrmoptionspluginsbase.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Aktywne"
#: tfrmoptionspluginsbase.stgplugins.columns[1].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Wtyczka"
#: tfrmoptionspluginsbase.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Zarejestrowany dla"
#: tfrmoptionspluginsbase.stgplugins.columns[3].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Nazwa pliku"
#: tfrmoptionspluginsdsx.lblplugindescription.caption
msgctxt "tfrmoptionspluginsdsx.lblplugindescription.caption"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Zezwalaj na szukanie wtyczek wg alternatywnych algorytmów i narzędzi zewnętrznych (np. \"locate\")"
#: tfrmoptionspluginsgroup.btnpathtoberelativetoall.caption
msgid "Apply current settings to all current configured plugins"
msgstr ""
#: tfrmoptionspluginsgroup.ckbautotweak.caption
msgid "When adding a new plugin, automatically go in tweak window"
msgstr ""
#: tfrmoptionspluginsgroup.gbconfiguration.caption
msgid "Configuration:"
msgstr ""
#: tfrmoptionspluginsgroup.lbpathtoberelativeto.caption
msgid "Path to be relative to:"
msgstr ""
#: tfrmoptionspluginsgroup.lbpluginfilenamestyle.caption
msgid "Plugin filename style when adding a new plugin:"
msgstr ""
#: tfrmoptionspluginswcx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswcx.lblplugindescription.caption"
msgid "Pack&er plugins are used to work with archives"
msgstr "Obsługa archiwów z użyciem wtyczek."
#: tfrmoptionspluginswcx.stgplugins.columns[0].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Aktywna"
#: tfrmoptionspluginswcx.stgplugins.columns[1].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Wtyczka"
#: tfrmoptionspluginswcx.stgplugins.columns[2].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Zarejestrowany dla"
#: tfrmoptionspluginswcx.stgplugins.columns[3].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Nazwa pliku"
#: tfrmoptionspluginswdx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswdx.lblplugindescription.caption"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Wtyczki pozwalające wyświetlać dodatkowe informacje o plikach (np. tagi mp3, atrybuty grafiki) w panelach oraz przy szukaniu i zamianie."
#: tfrmoptionspluginswfx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswfx.lblplugindescription.caption"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Wtyczki obsługujące niedostępne dla systemu dyski i urządzenia zewnętrzne (np. Palm/PocketPC)"
#: tfrmoptionspluginswlx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswlx.lblplugindescription.caption"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Wtyczki pozwalające wyświetlić za pomocą przeglądarki (listera, komendą F3) pliki takie jak np. grafika, bazy danych akusze kalkulacyjne"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgid "&Beginning (name must start with first typed character)"
msgstr "Początek (nazwa musi zaczynać się pierwszego wpisanego znaku)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgid "En&ding (last character before a typed dot . must match)"
msgstr "Zakończenie (ostatni znak przed kropką . musi być dopasowany)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Opcje"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Dokładna nazwa dopasowania"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Wielkość liter"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Szukaj tych pozycji"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Zachowaj zmienioną nazwę po odblokowaniu zakładki"
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Aktywuj panel docelowy po kliknięciu na jednej z jego zakładek"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgid "&Show tab header also when there is only one tab"
msgstr "Nagłówek zakładki widoczny nawet przy jednej zakładce"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Zamknij zduplikowane zakładki przy zamykaniu aplikacji"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgid "Con&firm close all tabs"
msgstr "Potwierdź zamknięcie wszystkich zakładek"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Potwierdź zamknięcie zablokowanych zakładek"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr "Ogranicz &długość tytułu zakładki do"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgid "Show locked tabs &with an asterisk *"
msgstr "Zablokowane zakładki oznacz &gwiazdką"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgid "&Tabs on multiple lines"
msgstr "Zakładki w kilku rzędach"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&Up otwiera nową zakładkę na pierwszym planie"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgid "Open &new tabs near current tab"
msgstr "Otwieraj &nowe zakładki obok bieżącej"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr ""
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgid "Show ta&b close button"
msgstr "Pokaż przycisk zamykania zakładki"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Zawsze pokazuj literę dysku w tytule zakładki"
#: tfrmoptionstabs.gbtabs.caption
msgid "Folder tabs headers"
msgstr "Nagłówki zakładek folderów"
#: tfrmoptionstabs.lblchar.caption
msgid "characters"
msgstr "znaków"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Czynność do wykonania po dwukrotnym kliknięciu na zakładce:"
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr "Pozycja zakładek"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr "Brak"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Nie"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr "Lewy"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr "Prawy"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr ""
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr ""
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr ""
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
#, fuzzy
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Zachowaj zapisaną historię katalogów w ulubionych zakładkach"
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr ""
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Polecenie tylko do uruchomienia w terminalu:"
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Polecenie do uruchomienia polecenia w terminalu i zamknięciu po:"
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Polecenie do uruchomienia polecenia w terminalu i pozostawieniu otwartym:"
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION"
msgid "Command:"
msgstr "Polecenie:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parametry:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION"
msgid "Command:"
msgstr "Polecenie:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parametry:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION"
msgid "Command:"
msgstr "Polecenie:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parametry:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "Klonuj przycisk"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "Usuń"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgid "Edit hot&key"
msgstr "Edytuj"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgid "&Insert new button"
msgstr "Dodaj nowy przycisk"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Wybierz"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Inne..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr "Usuń skrót klawiaturowy"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Sugeruj"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "Płaskie przyciski"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Raportuj błędy z poleceń"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr ""
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Wygląd"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "Rozmiar paska:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgid "Comman&d:"
msgstr "Polecenie:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parametry:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr "Pomoc"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Skrót klawiaturowy"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Plik ikony:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Rozmiar ikon:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgid "Co&mmand:"
msgstr "Polecenie:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgid "&Parameters:"
msgstr "Parametry:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Katalog startowy:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "Podpowiedź:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "Dodaj pasek narzędzi z WSZYSTKIMI poleceniami DC"
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "dla zewnętrznego polecenia"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "dla wewnętrznego polecenia"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "dla separatora"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "dla paska pod-narzędzi"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr "Kopia zapasowa..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr "Eksport..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Bieżący pasek narzędzi..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "do pliku paska narzędzi (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "do \"wincmd.ini\" z TC (zachowaj istniejące)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "do \"wincmd.ini\" z TC (usuń istniejące)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Górny pasek narzędzi..."
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Zapisz kopię paska narzędzi"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "do pliku paska narzędzi (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "do \"wincmd.ini\" z TC (zachowaj istniejące)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "do \"wincmd.ini\" z TC (usuń istniejące)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "bezpośrednio po bieżącym zaznaczeniu"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr "jako pierwszy element"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr "jako ostatni element"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "bezpośrednio przed bieżącym zaznaczeniem"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr "Importuj..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Przywróć kopię Paska narzędzi"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "aby dodać do bieżącego paska narzędzi"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "aby dodać nowy pasek narzędzi do bieżącego paska narzędzi"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "aby dodać nowy pasek narzędzi do górnego paska narzędzi"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr "aby dodać do górnego paska narzędzi"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr "aby zastąpić górny pasek narzędzi"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "z pliku paska narzędzi (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "aby dodać do bieżącego paska narzędzi"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "aby dodać nowy pasek narzędzi do bieżącego paska narzędzi"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "aby dodać nowy pasek narzędzi do górnego paska narzędzi"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "aby dodać do górnego paska narzędzi"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "aby zastąpić górny pasek narzędzi"
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "z pojedynczego pliku TC .BAR"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "aby dodać do bieżącego paska narzędzi"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "aby dodać nowy pasek narzędzi do bieżącego paska narzędzi"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "aby dodać nowy pasek narzędzi do górnego paska narzędzi"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "aby dodać do górnego paska narzędzi"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "aby zastąpić górny pasek narzędzi"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "z \"wincmd.ini\" TC..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "aby dodać do bieżącego paska narzędzi"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "aby dodać nowy pasek narzędzi do bieżącego paska narzędzi"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "aby dodać nowy pasek narzędzi do górnego paska narzędzi"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr "aby dodać do górnego paska narzędzi"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr "aby zastąpić górny pasek narzędzi"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "bezpośrednio po bieżącym zaznaczeniu"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr "jako pierwszy element"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr "jako ostatni element"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "bezpośrednio przed bieżącym zaznaczeniem"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr "Znajdź i zamień..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "bezpośredni po bieżącym zaznaczeniu"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "jako pierwszy element"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "jako ostatni element"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "bezpośrednio przed bieżącym zaznaczeniem"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "we wszystkich powyższych"
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "we wszystkich poleceniach..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "we wszystkich nazwach ikon..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "we wszystkich parametrach..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "we wszystkich ścieżkach startowych..."
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr "bezpośrednio po bieżącym zaznaczeniu"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr "jako pierwszy element"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr "jako ostatni element"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr "bezpośrednio przed bieżącym zaznaczeniem"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Typ przycisku"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje, aby wybrać odpowiednią ścieżkę"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "Zachowaj otwarty terminal po wykonaniu programu"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "Wykonaj w terminalu"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "Użyj zewnętrznego programu"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "Dodatkowe parametry"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "Ścieżka do programu"
#: tfrmoptionstooltips.btnaddtooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnaddtooltipsfiletype.caption"
msgid "A&dd"
msgstr "Dodaj"
#: tfrmoptionstooltips.btnapplytooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnapplytooltipsfiletype.caption"
msgid "A&pply"
msgstr "Zastosuj"
#: tfrmoptionstooltips.btncopytooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btncopytooltipsfiletype.caption"
msgid "Cop&y"
msgstr "Kopiuj"
#: tfrmoptionstooltips.btndeletetooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btndeletetooltipsfiletype.caption"
msgid "Delete"
msgstr "Usuń"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Szablon..."
#: tfrmoptionstooltips.btnrenametooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnrenametooltipsfiletype.caption"
msgid "&Rename"
msgstr "Zmień nazwę"
#: tfrmoptionstooltips.btntooltipother.caption
msgctxt "tfrmoptionstooltips.btntooltipother.caption"
msgid "Oth&er..."
msgstr "Inne..."
#: tfrmoptionstooltips.bvltooltips1.caption
msgid "Tooltip configuration for selected file type:"
msgstr ""
#: tfrmoptionstooltips.bvltooltips2.caption
msgid "General options about tooltips:"
msgstr ""
#: tfrmoptionstooltips.chkshowtooltip.caption
msgid "&Show tooltip for files in the file panel"
msgstr "Pokaż podpowiedzi dla plików w panelu plików"
#: tfrmoptionstooltips.lblfieldslist.caption
msgid "Category &hint:"
msgstr "Wskazówka kategorii:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Maska kategorii:"
#: tfrmoptionstooltips.lbltooltiphidingdelay.caption
msgid "Tooltip hiding delay:"
msgstr ""
#: tfrmoptionstooltips.lbltooltipshowingmode.caption
msgid "Tooltip showing mode:"
msgstr ""
#: tfrmoptionstooltips.lbltooltipslistbox.caption
msgid "&File types:"
msgstr ""
#: tfrmoptionstooltips.mitooltipsfiletypediscardmodification.caption
msgid "Discard Modifications"
msgstr ""
#: tfrmoptionstooltips.mitooltipsfiletypeexport.caption
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeexport.caption"
msgid "Export..."
msgstr "Eksport..."
#: tfrmoptionstooltips.mitooltipsfiletypeimport.caption
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeimport.caption"
msgid "Import..."
msgstr "Importuj..."
#: tfrmoptionstooltips.mitooltipsfiletypesortfiletype.caption
msgid "Sort Tooltip File Types"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr "Z dwukrotnym kliknięciem na pasku w górnej części panelu plików"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "Z menu i poleceniem wewnętrznym"
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr "Podwójne kliknięcie myszy w drzewie - wybór i wyjście"
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION"
msgid "With the menu and internal command"
msgstr "Z menu i poleceniem wewnętrznym"
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr "Z podwójnym kliknięciem na karcie (jeśli skonfigurowany dla niego)"
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr "Pojedyncze kliknięcie myszy w drzewie - wybór i wyjście"
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr "Użyj dla historii Linii Poleceń"
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr "Użyj dla Historii Katalogów"
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr "Użyj dla Widoku Historii (Odwiedzane ścieżki dla aktywnego widoku)"
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr "Zachowanie dotyczące wyboru:"
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr "Powiązane opcej Widoku Drzewa:"
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr "Gdzie można używać Widoku Drzewa:"
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr "Z Ulubionymi Katalogami:"
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr "Z Ulubionymi Zakładkami:"
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr "Z historią:"
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr "Użyj i wyświetl skrót klawiaturowy dla wybranych elementów"
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr "Opcje układu i kolorów:"
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Kolor tła:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Kolor kursora:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Kolor znalezionego tekstu:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Znaleziony tekst pod kursorem:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Kolor normalnego tekstu:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Normalny tekst pod kursorem:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Podgląd Widoku Drzewa:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr "Kolor drugiego tekstu"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr "Kolor drugiego tekstu pod kursorem:"
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Kolor skrótu:"
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr "Skrót pod kursorem:"
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr "Kolor niewybranego tekstu:"
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr "Niewybrane pod kursorem:"
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr "Zmień kolor po lewej i zobaczysz tutaj podgląd jak Twój Widok Drzewa będzie wyglądał z tym przykładem."
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Przeglądarka w trybie książki"
#: tfrmoptionsviewer.gbviewerexample.caption
msgid "Example"
msgstr "Przykład"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "Kolor tła w trybie książki"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "Kolor czcionki w tr. książki"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "Ilość kolumn w tr. książki"
#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "&Konfiguruj"
#: tfrmpackdlg.caption
msgid "Pack files"
msgstr "Pakowanie plików"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Utwórz oddzielne archiwa dla każdego z katalogów/plików"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Utwórz samorozpakowujące się archiwum"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "Za&szyfrowane"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "&Usuń pliki po ich zarchwizowaniu"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Wieloczęściowe archiwum dyskowe"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "Spakuj najpierw do archiwum TAR"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Przy archwizowaniu z podkatalogami zachowaj ścieżki"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Nazwa pliku archiwum:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Paker"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Zamknij"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Wypakuj &wszystko i uruchom"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "Wypakuj i &uruchom"
#: tfrmpackinfodlg.caption
msgid "Properties of packed file"
msgstr "Właściwości spakowanego pliku"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Atrybuty:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Stopień kompresji:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Data:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Metoda:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Wielkość oryginalna:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Plik:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Wielkość po skompresowaniu:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Paker:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Czas:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Zamknij panel filtra"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Wpisz tekst do wyszukiwania lub filtrowania"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Uwzględnia pisownię wielkich liter"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "D"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Katalog"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Pliki"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Początek odnalezionego wzorca"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Koniec odnalezionego wzorca"
#: tfrmquicksearch.tglfilter.caption
msgid "Filter"
msgstr "Filtr"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Przełączanie między wyszukiwaniem lub filtrowaniem"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "Więcej reguł"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "Mniej reguł"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Użyj wtyczek zawartości, w połączeniu z:"
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Wtyczka"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Pole"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Operator"
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Wartość"
#: tfrmsearchplugin.headercontrol.sections[4].text
msgid "Unit"
msgstr ""
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&AND (wszystkie dopasowane)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&OR (dowolne dopasowanie)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Anuluj"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "Zamknij"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "Pomoc"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "Wybierz znaki do wstawienia:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmsetfileproperties.caption
msgid "Change attributes"
msgstr "Zmień atrybuty"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Przyklejony"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgid "Archive"
msgstr "Archiwum"
#: tfrmsetfileproperties.chkcreationtime.caption
msgid "Created:"
msgstr "Utworzony:"
#: tfrmsetfileproperties.chkhidden.caption
msgid "Hidden"
msgstr "Ukryty"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Dostęp:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Modyfikacja:"
#: tfrmsetfileproperties.chkreadonly.caption
msgid "Read only"
msgstr "Tylko do odczytu"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Dołącz podfoldery"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "tfrmsetfileproperties.chksystem.caption"
msgid "System"
msgstr "System"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Właściwości znacznika czasu"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atrybuty"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atrybuty"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bity:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grupa"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(szare pole oznacza niezmienioną wartość)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Inne"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Właściciel"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Jako tekst:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Wykonywalny"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(szare pole oznacza niezmienioną wartość)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Ósemkowo:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Odczyt"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zapis"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "OK"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje, aby wybrać odpowiednią ścieżkę"
#: tfrmsplitter.caption
msgid "Splitter"
msgstr "Dzielenie"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Wymaga pliku weryfikacyjnego CRC32"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Nazwa pliku"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Wielkość i liczba części"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "Katalog docelowy"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Plik źródłowy"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "Liczba części"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Bajty"
#: tfrmsplitter.rbtngigab.caption
msgid "&Gigabytes"
msgstr "Gigabajty"
#: tfrmsplitter.rbtnkilob.caption
msgid "&Kilobytes"
msgstr "Kilobajty"
#: tfrmsplitter.rbtnmegab.caption
msgid "&Megabytes"
msgstr "Megabajty"
#: tfrmstartingsplash.caption
msgctxt "tfrmstartingsplash.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "tfrmstartingsplash.lblbuild.caption"
msgid "Build"
msgstr "Kompilacja"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Stystem operacyjny"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Platforma"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Wydanie"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr "Wersja"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr "Wersja zastawu widżetów"
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Anuluj"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Ok"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Utwórz link symboliczny"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Obiekt docelowy, który będzie wskazywał link"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Nazwa linku"
#: tfrmsyncdirsdlg.actselectclear.caption
msgid "Remove selection"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopydefault.caption
msgid "Select for copying (default direction)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
msgid "Select for copying -> (left to right)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
msgid "Reverse copy direction"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
msgid "Select for copying <- (right to left)"
msgstr ""
#: tfrmsyncdirsdlg.actselectdeleteright.caption
msgid "Select for deleting -> (right)"
msgstr ""
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr "Zamknij"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr "Porównaj"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Synchronizuj"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Synchronizuj katalogi"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "asymetrycznie"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "wg zawartości"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "ignoruj datę"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "tylko zaznaczone"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Podkatalogi"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Pokaż:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
msgid "Name"
msgstr "Nazwa"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
msgid "Size"
msgstr "Rozmiar"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
msgid "Date"
msgstr "Data"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
msgid "Date"
msgstr "Data"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
msgid "Size"
msgstr "Rozmiar"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
msgid "Name"
msgstr "Nazwa"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(w oknie głównym)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Porównaj"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Lewy widok"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Prawy widok"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "duplikaty"
#: tfrmsyncdirsdlg.sbequal.caption
msgctxt "tfrmsyncdirsdlg.sbequal.caption"
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgctxt "tfrmsyncdirsdlg.sbnotequal.caption"
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "pojedyncze"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Proszę nacisnąć przycisk \"Porównaj\", aby rozpocząć"
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr "Synchronizuj"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Potwierdź nadpisanie"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Widok Drzewa"
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr "Wybierz swój ulubiony katalog:"
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr "Wyszukiwanie uwzględnia wielkość liter"
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr "Zwiń wszystko"
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr "Rozwiń wszystko"
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr "Wyszukiwanie ignoruje akcenty i ligatury"
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr "Wyszukiwanie nie uwzględnia wielkości liter"
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr "Wyszukiwanie ściśle dotyczy akcentów i ligatur"
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr "Nie pokazuj zawartości gałęzi, \"tylko dlatego\", że wyszukiwany ciąg znajduje się w nazwie gałęzi"
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr "Jeżeli poszukiwany ciąg znajduje się w nazwie gałęzi, pokaż całą gałąź, nawet jeśli elementy nie pasują do siebie"
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr "Zamknij Widok Drzewa"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT"
msgid "Configuration of Tree View Menu"
msgstr "Konfiguracja Widoku Drzewa"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT"
msgid "Configuration of Tree View Menu Colors"
msgstr "Konfiguracja kolorów Widoku Drzewa"
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "Dodaj nowy"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Porzuć"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "Zmień"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Domyślny"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "OK"
#: tfrmtweakplugin.btnrelativeplugin1.hint
msgctxt "tfrmtweakplugin.btnrelativeplugin1.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmtweakplugin.btnrelativeplugin2.hint
msgctxt "tfrmtweakplugin.btnrelativeplugin2.hint"
msgid "Some functions to select appropriate path"
msgstr "Niektóre funkcje by wybrać odpowiednią ścieżkę"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "Usuń"
#: tfrmtweakplugin.caption
msgid "Tweak plugin"
msgstr "Ustawienia wtyczki"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Wykryj typ archiwum wg zawartości"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Możliwość usunięcia pliku z archiwum"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Wsparcie szyfrowania"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Pokazuj jako zwykły plik (nie pokazuj ikony archiwum)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Wsparcie pakowania w pamięci"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Pozwól na modyfikację archiwum"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "Archiwum może zawierać kilka plików"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Może tworzyć nowe archiwum"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "Z oknem dialogowym"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Pozwala przeszukiwać archiwa"
#: tfrmtweakplugin.lbldescription.caption
msgid "&Description:"
msgstr "Opis:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "Wykryj łańcuch (string):"
#: tfrmtweakplugin.lblextension.caption
msgid "&Extension:"
msgstr "Rozszerzenie:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Flagi:"
#: tfrmtweakplugin.lblname.caption
msgctxt "tfrmtweakplugin.lblname.caption"
msgid "&Name:"
msgstr "Nazwa:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "Wtyczka:"
#: tfrmtweakplugin.lblplugin2.caption
msgctxt "tfrmtweakplugin.lblplugin2.caption"
msgid "&Plugin:"
msgstr "Wtyczka:"
#: tfrmviewer.actabout.caption
msgid "About Viewer..."
msgstr "O listerze..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Wyświetla komunikat \"O...\""
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
msgid "Copy File"
msgstr "Skopiuj plik"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Skopiuj plik"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Kopiuj do schowka"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr "Kopiuj do Schowka sformatowane"
#: tfrmviewer.actdeletefile.caption
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
msgid "Delete File"
msgstr "Skasuj plik"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Skasuj plik"
#: tfrmviewer.actexitviewer.caption
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "Koniec"
#: tfrmviewer.actfind.caption
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Znajdź"
#: tfrmviewer.actfindnext.caption
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Znajdź następny"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr "Znajdź poprzedni"
#: tfrmviewer.actfullscreen.caption
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Pełny ekran"
#: tfrmviewer.actimagecenter.caption
msgid "Center"
msgstr "Wyśrodkuj"
#: tfrmviewer.actloadnextfile.caption
msgid "&Next"
msgstr "&Następny"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Wczytaj następny plik"
#: tfrmviewer.actloadprevfile.caption
msgid "&Previous"
msgstr "&Poprzedni"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Wczytaj poprzedni plik"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr "Odbicie poziome"
#: tfrmviewer.actmirrorhorz.hint
msgid "Mirror"
msgstr "Odbicie lustrzane"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr "Odbicie pionowe"
#: tfrmviewer.actmovefile.caption
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
msgid "Move File"
msgstr "Przenieś plik"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Przenieś plik"
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Podgląd"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Wczytaj ponownie"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Wczytaj ponownie bieżący plik"
#: tfrmviewer.actrotate180.caption
msgid "+ 180"
msgstr "Obróć o 180°"
#: tfrmviewer.actrotate180.hint
msgid "Rotate 180 degrees"
msgstr "Obróć o 180°"
#: tfrmviewer.actrotate270.caption
msgid "- 90"
msgstr "Obróć o 270°"
#: tfrmviewer.actrotate270.hint
msgid "Rotate -90 degrees"
msgstr "Obróć o 270°"
#: tfrmviewer.actrotate90.caption
msgid "+ 90"
msgstr "Obróć o 90°"
#: tfrmviewer.actrotate90.hint
msgid "Rotate +90 degrees"
msgstr "Obróć o 90°"
#: tfrmviewer.actsave.caption
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Zapisz"
#: tfrmviewer.actsaveas.caption
msgid "Save As..."
msgstr "Zapisz jako..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Zapisz plik jako..."
#: tfrmviewer.actscreenshot.caption
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Zrzut ekranu"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "Opóźnienie 3 sek"
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "Opóźnienie 5 sek"
#: tfrmviewer.actselectall.caption
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Zaznacz wszystko"
#: tfrmviewer.actshowasbin.caption
msgid "Show as &Bin"
msgstr "Tryb binarny"
#: tfrmviewer.actshowasbook.caption
msgid "Show as B&ook"
msgstr "Pokaż jak&o Książkę"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr "Tryb &Dec"
#: tfrmviewer.actshowashex.caption
msgid "Show as &Hex"
msgstr "Tryb szesnastkowy (hex)"
#: tfrmviewer.actshowastext.caption
msgid "Show as &Text"
msgstr "Jako tekst"
#: tfrmviewer.actshowaswraptext.caption
msgid "Show as &Wrap text"
msgstr "Tekst z zawijaniem wierszy"
#: tfrmviewer.actshowgraphics.caption
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Grafika"
#: tfrmviewer.actshowplugins.caption
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Wtyczki"
#: tfrmviewer.actstretchimage.caption
msgid "Stretch"
msgstr "Rozciągnij"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Rozciągnij obrazek"
#: tfrmviewer.actstretchonlylarge.caption
msgid "Stretch only large"
msgstr "Rozciągnij tylko duże"
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Powiększenia"
#: tfrmviewer.actzoomin.caption
msgid "Zoom In"
msgstr "Powiększ"
#: tfrmviewer.actzoomout.caption
msgid "Zoom Out"
msgstr "Zmniejsz"
#: tfrmviewer.btncuttuimage.hint
msgid "Crop"
msgstr "Przytnij"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Pełny ekran"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Wyróżnij"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Maluj"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Czerwone oczy"
#: tfrmviewer.btnresize.hint
msgid "Resize"
msgstr "Zmień rozmiar"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Cofnij"
#: tfrmviewer.caption
msgctxt "TFRMVIEWER.CAPTION"
msgid "Viewer"
msgstr "Lister"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Pokaz slajdów"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Ołówek"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Zaznacz"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Maluj"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Pokaz slajdów"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Podgląd"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "O programie"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "Edytuj"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Kodowanie"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "Plik"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "Rysunek"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Drukuj..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Obróć"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Zrzut ekranu"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Podgląd"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Zaznacz wszystko"
#: tfrmviewoperations.btnstartpause.caption
#, fuzzy
msgctxt "tfrmviewoperations.btnstartpause.caption"
msgid "&Start"
msgstr "Start"
#: tfrmviewoperations.btnstop.caption
msgid "S&top"
msgstr ""
#: tfrmviewoperations.caption
#, fuzzy
msgctxt "tfrmviewoperations.caption"
msgid "File operations"
msgstr "Operacje na plikach"
#: tfrmviewoperations.cbalwaysontop.caption
msgid "Always on top"
msgstr ""
#: tfrmviewoperations.lblusedragdrop.caption
msgid "&Use \"drag && drop\" to move operations between queues"
msgstr ""
#: tfrmviewoperations.mnucanceloperation.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
msgid "Cancel"
msgstr "Anuluj"
#: tfrmviewoperations.mnucancelqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
msgid "Cancel"
msgstr "Anuluj"
#: tfrmviewoperations.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnunewqueue.caption"
msgid "New queue"
msgstr "Nowa kolejka"
#: tfrmviewoperations.mnuoperationshowdetached.caption
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.mnuputfirstinqueue.caption
msgid "Put first in queue"
msgstr ""
#: tfrmviewoperations.mnuputlastinqueue.caption
msgid "Put last in queue"
msgstr ""
#: tfrmviewoperations.mnuqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue.caption"
msgid "Queue"
msgstr "Kolejka"
#: tfrmviewoperations.mnuqueue0.caption
msgid "Out of queue"
msgstr ""
#: tfrmviewoperations.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Kolejka 1"
#: tfrmviewoperations.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Kolejka 2"
#: tfrmviewoperations.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Kolejka 3"
#: tfrmviewoperations.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Kolejka 4"
#: tfrmviewoperations.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Kolejka 5"
#: tfrmviewoperations.mnuqueueshowdetached.caption
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.tbpauseall.caption
msgid "&Pause all"
msgstr ""
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Gdy plik istnieje"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Gdy plik istnieje"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION"
msgid "Copy d&ate/time"
msgstr "Kopiuj datę/czas"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Praca w tle (oddzielne połączenie)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Gdy plik istnieje"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Wysokość"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Szerokość"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Anuluj szybki filtr"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Anuluj bieżącą operację"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Wprowadź nazwę pliku z rozszerzeniem, dla upuszczonego tekstu"
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Format tekstu do importu"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Uszkodzone:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Ogólne:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Brakujące:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Błąd odczytu:"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Pomyślne:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Wprowadź sumę kontrolną i wybierz algorytm:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Sprawdź sumę kontrolną"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Ogółem:"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr "Czy chcesz wyczyścić filtry dla tego nowego wyszukiwania?"
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Schowek nie zawiera żadnych ważnych danych paska narzędzi"
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr "Wszystko;Aktywny Panel;Lewy Panel;Prawy Panel;Opercje na pliku;Konfiguracja;Sieć;Różne;Port równoległy;Drukuj;Zaznacz;Bezpieczeństwo;Schowek;FTP;Nawigacja;Pomoc;Okno;Linia poleceń;Narzędzia;Widok;Użytkownik;Zakładki;Sortowanie;Dziennik"
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr ""
#: ulng.rscolattr
msgid "Attr"
msgstr "Atr."
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Data"
#: ulng.rscolext
msgid "Ext"
msgstr "Rozsz."
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Nazwa"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Rozmiar"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Wyrównywanie"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Nagłówek"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Usuń"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Pola danych"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Przenieś"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Szerokość"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Dostosuj kolumny"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Konfiguruj skojarzenia plików"
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "Potwierdzenie wiersza polecenia i parametrów"
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Kopiuj (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Zaimportowany pasek narzędzi DC"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Zaimportowany pasek narzędi TC"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "_UpuszczonyTekst"
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "_UpuszczonytekstHTML"
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "_UpuszczonyRTF"
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "_Upuszczonyprostytekst"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "_UpuszczonytekstUnicodeUTF16"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "_UpuszczonytekstUnicodeUTF8"
#: ulng.rsdiffadds
msgid " Adds: "
msgstr "Dodanych:"
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr "Usuniętych:"
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "Dwa pliki są identyczne!"
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr "Pasujące:"
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr "Zmodyfikowane:"
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Przerwij"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "Wszystko"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "Dodaj"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "A&utomatyczna zmiana nazwy plików źródłowych"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Anuluj"
#: ulng.rsdlgbuttoncompare
msgid "Compare &by content"
msgstr ""
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "Kontynuuj"
#: ulng.rsdlgbuttoncopyinto
msgid "&Merge"
msgstr "Połącz"
#: ulng.rsdlgbuttoncopyintoall
msgid "Mer&ge All"
msgstr "Połącz &wszystkieh"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "Wyjdź z programu"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr "Ig&noruj"
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Ignoruj wszystko"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Nie"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "Żaden"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&OK"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "Inne"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Zastąp"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Z&astąp wszystko"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Nadpisz wszystkie &większe"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Nadpisz wszystkie &starsze"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Nadpisz wszystkie &mniejsze"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Zmień nazwę"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Wznów"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Ponów"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Pomiń"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Pomiń &wszystko"
#: ulng.rsdlgbuttonunlock
msgid "&Unlock"
msgstr ""
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Tak"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Kopiuj plik(i)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Przenieś plik(i)"
#: ulng.rsdlgoppause
msgid "Pau&se"
msgstr "Pauza"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "Start"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Kolejka"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Prędkość %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Prędkość %s/s, pozostały czas %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr "Format RTF;Format HTML;Format Unicode;Format tekstowy"
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<brak etykiety>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<brak nośnika>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Wewnętrzny edytor Double Commandera"
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Idź do linii:"
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr "Idź do linii"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "nowy.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Nazwa pliku:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Otwórz plik"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "Cofnij"
#: ulng.rseditsearchcaption
msgid "Search"
msgstr "Szukaj"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "Naprzód"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Zamień"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "w zewnętrznym edytorze"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "w wewnętrznym edytorze"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Uruchom przez shell"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Uruchom przez terminal i zamknij"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Uruchom przez terminal i pozostaw otwarty"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Lewy;Prawy;Aktywny;Nieaktywny;Oba,Żaden"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Nie;Tak"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Wyeksportowane_z_DC"
#: ulng.rsfileopcopymovefileexistsoptions
msgid "Ask;Overwrite;Skip"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
msgid "Ask;Merge;Skip"
msgstr "Pytaj;Połącz;Pomiń"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Pytaj;Zastąp;Zastąp starsze;Pomiń"
#: ulng.rsfileopsetpropertyerroroptions
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Pytaj;Nie ustawiaj więcej;Ignoruj błędy"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "FILTR"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Zdefiniuj wzorzec"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s poziom(y)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "Wszystko (bez ograniczeń)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "Tylko bieżący katalog"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Katalog %s nie istnieje!"
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Szukaj: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Zapisz szablon wyszukiwania"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Nazwa szablonu:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Przeskanowano: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Skanowanie"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Znajdź plik"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Czas skanowania:"
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Zacznij w"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Wolne %s z %s"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s bajtów wolnych"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Data/czas dostępu"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Atrybuty"
#: ulng.rsfunccomment
msgid "Comment"
msgstr "Komentarz"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Rozmiar skompresowany"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Data/czas utworzenia"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Rozszerzenie"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Grupa"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Zmień datę/czas"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Link do"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Data/czas modyfikacji"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Nazwa"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Nazwa bez rozszerzenia"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Właściciel"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Ścieżka"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Rozmiar"
#: ulng.rsfunctype
msgid "Type"
msgstr "Typ"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Błąd podczas tworzenia twardego linku."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "brak;Nazwa, a-z;Nazwa, z-a;Rozsz., a-z;Rozsz., z-a;Rozm. 9-0;Rozm. 0-9;Data 9-0;Data 0-9"
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"Ostrzeżenie! Przywrócenie pliku kopii zapasowej .hotlist, spowoduje usunięcie istniejącej listy i zastąpienie jej przez zaimportowaną.\n"
"\n"
"Czy na pewno chcesz kontynuować?\n"
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Okno dialogowe kopiuj/przenieś"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Różnice"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Okno dialogowe edycji komentarza"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Edytor"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Znajdź pliki"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Główny"
#: ulng.rshotkeycategorysyncdirs
msgid "Synchronize Directories"
msgstr ""
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Lister"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr "Czy na pewno chcesz przywrócić domyślny?"
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr "Kopia z %s"
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr "Wprowadź nową nazwę"
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr "Należy zachować co najmniej jeden plik skrótu."
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr "Nowa nazwa"
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr "Wg nazwy polecenia;Wg klawisza skrótu (pogrupowane);Wg klawisza skrótu (po jednym w linii)"
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "Nie można znaleźć odniesienia do domyślnego pliku bar"
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr "Lista okien \"Znajdź pliki\""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Maska odznaczania"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Maska zaznaczania"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Maska wejściowa:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Widok kolumn o tej nazwie już istnieje."
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr "Aby zmienić bieżącą edycję widoku kolmun, albo ZAPISAĆ, SKOPIOWAĆ lub USUNĄĆ obecną edycję"
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Konfiguruj niestandardowe kolumny"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Wpisz nową nazwę kolumny niestandardowej"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Polecenia"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr "Kopiuj nazwy ze ścieżką UNC"
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Odłącz dysk sieciowy"
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Edytuj"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Wysuń"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Wypakuj tutaj"
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Mapuj dysk sieciowy"
#: ulng.rsmnumount
msgid "Mount"
msgstr "Zamontuj"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Nowy"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Brak dostępnego nośnika"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Otwórz"
#: ulng.rsmnuopenwith
msgctxt "ulng.rsmnuopenwith"
msgid "Open with"
msgstr "Otwórz z ..."
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Inne..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Spakuj tutaj..."
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Sortuj wg"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Odmontuj"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Podgląd"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Konto:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgapplicationname
msgid "Description: %s"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Dodatkowe parametry linii poleceń archiwizera:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr "Chcesz dołączyć cudzysłowie?"
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"Nieprawidłowy CRC32 dla pliku wynikowego:\n"
"\"%s\"\n"
"\n"
"Czy chcesz mimo to zachować uszkodzony plik wynikowy?\n"
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Nie można skopiować/przenieść pliku \"%s\" do niego samego!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Nie mogę usunąć katalogu %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr "Nie można nadpisać katalogu \"%s\" nie-katalogiem \"%s\""
#: ulng.rsmsgchdirfailed
msgid "Change current directory to \"%s\" failed!"
msgstr "Nieudane przejście do katalogu [%s] !"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Usunąć nieaktywne zakładki?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Zakładka (%s) jest zablokowana! Zamknąć mimo to?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Na pewno zakończyć?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "Plik %s został zmieniony. Czy chcesz skopiować go wstecz?"
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "Nie można skopiować wstecz - czy chcesz zachować zmieniony plik?"
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Skopiować %d wybranych plików/katalogów?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Skopiować wybrane \"%s\"?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Utwórz nowy typ pliku \"%s plików\" >"
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Podaj położenie i nazwę pliku do zapisania plików Paska Narzędzi DC"
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Niestandardowa akcja"
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Skasować ten częściowo skopiowany plik?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Usunąć %d wybranych plików/katalogów?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Wyrzucić do kosza %d wybranych plików/katalogów?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Usunąć wybrane \"%s\"?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Usunąć wybrane \"%s\" do kosza?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Nie można usunąć \"%s\" do kosza! Usunąć bezpośrednio?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Dysk jest niedostępny"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr "Podaj nazwę niestandardowej akcji:"
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Podaj rozszerzenie:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Podaj nazwę:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Wprowadź nazwę nowego typu pliku, aby utworzyć rozszerzenie \"%s\""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Błąd CRC w archiwum danych"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Błąd w danych"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Nie można połączyć z serwerem: \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Nie można skopiować pliku %s do %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Katalog o nazwie \"%s\" już istnieje."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Data %s nie jest obsługiwana"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Katalog %s już istnieje!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Przerwane przez użytkownika."
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Błąd zamknięcia pliku"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Nie można utworzyć pliku"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Nie ma więcej plików w archiwum"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Nie można otworzyć pliku"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Błąd odczytu z pliku"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Błąd zapisu do pliku"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Nie można utworzyć katalogu %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Błędny link"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Nie znaleziono plików"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Za mało pamięci"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Funkcja nie jest obsługiwana!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Błąd w poleceniu menu kontekstowego"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Błąd podczas ładowania konfiguracji"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Błąd składni w wyrażeniu regularnym!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Nie można zmienić nazwy pliku %s na %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Nie można zapisać powiązania!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Nie można zapisać pliku"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Nie można ustawić atrybutów dla \"%s\""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Nie można ustawić daty/czasu dla \"%s\""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Nie można ustawić właściciela/grupy dla \"%s\""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "Nie można ustawić uprawnień dla \"%s\""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Za mały bufor"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Zbyt wiele plików do spakowania"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Nieznany format archiwum"
#: ulng.rsmsgexecutablepath
msgid "Executable: %s"
msgstr ""
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "Czy na pewno chcesz usunąć wszystkie wpisy z Twoich Ulubionych Zakładek? (Nie jest możliwe \"cofnięcie\" operacji do tej akcji!)"
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Przeciągnij tutaj inne wpisy"
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name for this new Favorite Tabs entry:"
msgstr "Podaj nazwę dla tego wpisu Ulubionych Zakładek"
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "Zapisywanie nowych wpisów Ulubionych Zakładek"
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Liczba Ulubionych Zakładek wyeksportowanych pomyślnie: %d z %d"
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Liczba plików zaimportowanych pomyślnie: %d z %d"
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Starsze zakładki zaimportowane"
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr "Wybierz plik(i) .tab do zaimportowania (może być więcej niż jeden!)"
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Zachowaj zapisaną historię katalogów w ulubionych zakładkach"
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Nazwa podmenu"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "Spowoduje to załadowanie Ulubionych Zakładek: \"%s\""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr "Zapisz bieżące zakładki na istniejącym wpisie Ulubionych Zakładek"
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Plik %s zmieniono, zapisać?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s bajtów, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Nadpisz:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Plik o nazwie %s istnieje, zastąpić?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Plikiem:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Plik \"%s\" nie został znaleziony."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Aktywne operacje na plikach"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Niektóre operacje na plikach nie zostały zakończone. Zamknięcie Double Commandera może spowodować utratę danych."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
"Długość nazwy docelowej (%d) jest większa niż %d znaków!\n"
"%s\n"
"Większość programów nie będzie mogła uzyskać dostępu do pliku/katalogu z długą nazwą!\n"
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Plik %s jest oznaczony jako tylko do odczytu/ukryty/systemowy. Usunąć mimo to?"
#: ulng.rsmsgfilereloadwarning
msgid "Are you sure you want to reload the current file and lose the changes?"
msgstr ""
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "Rozmiar pliku \"%s\" jest zbyt duży dla docelowego systemu plików!"
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "Katalog o nazwie %s istnieje, zastąpić?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Iść za linkiem \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Wybierz format tekstu do zaimportowania"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Dodaj %d wybranych katalogów"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Dodaj wybrany katalog:"
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Dodaj bieżący katalog:"
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Wykonaj polecenie"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_somthing"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Konfiguracja ulubionych katalogów"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Czy na pewno chcesz usunąć wszystkie wpisy z listy ulubionych katalogów? (Tej operacji nie można \"cofnąć\"!"
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Spowoduje to wykonanie następujacego polecenia:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "To jest ulubiony folder o nazwie "
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Spowoduje to zmianę aktywnej ramki do następującej ścieżki"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "I zmień nieaktywne ramki dla następującej ścieżki:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Błąd tworzenia kopii zapasowej wpisów..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Błąd eksportowania wpisów..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Eksportuj wszystko!"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Eksportuj ulubione katalogi - wybierz pozycje które chcesz eksportować"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Eksportuj wybrane"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Importuj wszystko!"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Importuj ulubione katalogi - Wybierz pozycje, które chcesz importować"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Importuj wybrane"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Ścieżka"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Znajdź plik \".hotlist\" do zaimportowania"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Nazwa ulubionego katalogu"
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Liczba nowych wpisów: %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "Nie wybrano nic do eksportu!"
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Ścieżka ulubionego katalogu"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Dodaj ponownie wybrany katalog: "
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Dodaj ponownie bieżący katalog: "
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Wprowadź lokalizację i nazwę pliku ulubionych katalogów do przywrócenia"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Polecenie:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(koniec podmenu)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Nazwa menu:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Nazwa:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(separator)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Nazwa podmenu"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Docelowy ulubiony katalog"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Ustal jeśli chcesz, aby w aktywnej ramce były sortowane w określonej kolejności po zmianie katalogu"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Ustal jeśli chcesz, aby w nie aktywnej ramce były sortowane w określonej kolejności po zmianie katalogu"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Różne funkcje, aby wybrać odpowiednią ścieżkę względną, bezwzględną, folderów specjalnych windows itd."
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Liczba zapisanych wpisów: %d\n"
"\n"
"Nazwa pliku kopii zapasowej: %s\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Liczba wyeksportowanych wpisów: "
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"Czy chcesz usunąć wszystkie elementy wewnątrz podmenu [%s]?\n"
"Odpowiedź NIE usunie tylko ograniczniki menu, ale pozostawi element wewnątrz podmenu.\n"
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Wprowadź lokalizację i nazwę pliku, w którym zapisać plik ulubionych katalogów"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Nieprawidłowa wynikowa długość pliku dla pliku : \"%s\"\""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Proszę włożyć następny dysk lub coś podobnego.\n"
"\n"
"Pozwoli to na zapisanie tego pliku:\n"
"\"%s\"\n"
"\n"
"Liczba bajtów pozostałych do zapisania: %d\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Błąd w linii poleceń"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Błędna nazwa pliku"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Nieprawidłowy format pliku konfiguracyjnego"
#: ulng.rsmsginvalidhexnumber
msgid "Invalid hexadecimal number: \"%s\""
msgstr ""
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Zła ścieżka"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Ścieżka %s zawiera niedozwolone znaki."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "To nie jest prawidłowa wtyczka!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Ta wtyczka jest zbudowana dla Double Commander %s.%sNie będzie działać z Double Commander %s!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Błędne cytowanie"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Błędny wybór."
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Wczytywanie listy plików..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr "Zlokalizuj plik konfiguracyjny TC (wincmd.ini)"
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "Zlokalizuj plik wykonywalny TC (totalcmd.exe lub totalcmd64.exe)"
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Kopiowanie pliku %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Kasowanie pliku %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Błąd: "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr "Uruchom zewnętrzny"
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Rozpakowywanie pliku %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Informacja: "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Tworzenie twardego linku %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Tworzenie katalogu %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Przenoszenie pliku %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Archiwizowanie do pliku %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Usunięcie katalogu %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Wykonano: "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Tworzenie linku symbolicznego %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Testowanie integralności pliku %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Zatrzyj plik %s"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Zatrzyj katalog %s"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Hasło główne"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Proszę wprowadzić hasło główne:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Nowy plik"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Kolejny wolumin zostanie rozpakowany"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Brak plików"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Brak wybranych plików."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Brak miejsca na dysku. Kontynuować?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Brak miejsca na dysku. Ponowić próbę?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Pliku %s nie można skasować"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Nie zaimplementowano."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgopeninanotherprogram
msgid "The action cannot be completed because the file is open in another program:"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Poniżej znajduje się podgląd. Można przesuwać kursor i wybierać pliki, aby natychmiast uzyskać rzeczywisty wygląd różnych ustawień."
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Hasło:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Hasła są różne!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Proszę wprowadzić hasło:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Hasło (Firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Proszę ponownie wprowadzić hasło dla weryfikacji:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Usuń %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Wzorzec \"%s\" istnieje. Zastąpić?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Problem z wykonaniem polecenia (%s)"
#: ulng.rsmsgprocessid
msgid "PID: %d"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Nazwa pliku dla przeciągniętego tekstu:"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Proszę udostępnić ten plik. Ponowić próbę?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Podaj nową przyjazną nazwę dla tych Ulubionych Zakładek"
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Podaj nową nazwę dla tego menu"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Zmienić nazwę/przenieść %d wybranych plików/katalogów?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Zmienić nazwę/przenieść wybrany \"%s\"?"
#: ulng.rsmsgreplacethistext
msgid "Do you want to replace this text?"
msgstr ""
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Proszę ponownie uruchomić Double Commander aby zastosować zmiany"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Wybierz, aby dodać rozszerzenie typu pliku \"%s\""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Wybrane: %s z %s, plików: %d z %d, katalogów: %d z %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Wybierz plik wykonywalny dla"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Proszę wybrać tylko sumy kontrolne plików!"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Wybierz lokalizację kolejnego woluminu"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Zmień etykietę wolumniu"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Specjalny katalog"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Dodaj ścieżkę z aktywnej ramki"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Dodaj ścieżkę z nieaktywnej ramki"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Przeglądaj i użyj wybranej ścieżki"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Użyj zmiennej środowiskowej..."
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Idź do specjalnej ścieżki Double Commandera..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Idź do zmiennej środowiskowej ..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Idź do innego specjalnego folderu Windows..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Idź do specjalnego folderu Windows (TC)..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Utwórz względną do ścieżki ulubionego katalogu"
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Utwórz ścieżkę bezwzględną"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Utwórz względną do specjalnej ścieżki Double Commandera..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Utwórz względną do zmiennej środowiskowej..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Utwórz względną do specjalnego folderu Windows (TC)..."
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Utwórz względną do innego folderu specjalnego Windows..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Użyj specjalnej scieżki Double Commander..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr "Użyj scieżki ulubionego katalogu"
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Użyj innego specjalnego folderu Windows..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Użyj specjalnego folderu Windows (TC)..."
#: ulng.rsmsgtabforopeninginnewtab
#, fuzzy,badformat
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr "Ta zakładka (5s) jest zablokowana! Otworzyć katalog w innej zakładce?"
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Zmień nazwę zakładki"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Nazwa nowej zakładki:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Ścieżka docelowa:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Błąd! Nie można znależć pliku konfiguracji TC:\n"
"%s\n"
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Błąd! Nie można znaleźć konfiguracji pliku wykonywalnego TC:\n"
"%s\n"
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Błąd! TC jest nadal uruchomiony, a powinien być zamknięty dla tej operacji.\n"
"Zamknij go i naciśnij przycisk OK lub naciśnij przycisk ANULUJ, aby przerwać.\n"
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Błąd! Nie można znaleźć żądanego folderu wyjściowego paska narzędzi TC:\n"
"%s\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Wprowadź lokalizację i nazwę pliku, w którym chcesz zapisać plik paska narzędzi TC"
#: ulng.rsmsgterminateprocess
msgid "WARNING: Terminating a process can cause undesired results including loss of data and system instability. The process will not be given the chance to save its state or data before it is terminated. Are you sure you want to terminate the process?"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr "\"%s\" jest teraz w schowku"
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr ""
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Zlokalizuj plik \".toolbar\" do zaimportowania"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Zlokalizuj plik \".BAR\" do zaimportowania"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Wprowadź położenie i nazwę paska narzędzi do przywrócenia"
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Zapisano!\n"
"Nazwa paska narzędzi: %s\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Wybrano zbyt dużo plików"
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Nieokreślony"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr "BŁĄD: Nieoczekiwane użycie Widoku Drzewa"
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "<BRAK ROZSZ.>"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr "<BRAK NAZWY>"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Nazwa użytkownika:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Nazwa użytkownika (Firewall):"
#: ulng.rsmsgverify
msgid "VERIFICATION:"
msgstr ""
#: ulng.rsmsgverifychecksum
msgid "Do you want to verify selected checksums?"
msgstr ""
#: ulng.rsmsgverifywrong
msgid "The target file is corrupted, checksum mismatch!"
msgstr ""
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Etykieta woluminu:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Proszę wpisać rozmiar części:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Zamazać %d wybranych plików/katalogów?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Zamazać \"%s\"?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "z"
#: ulng.rsmsgwrongpasswordtryagain
msgid ""
"Wrong password!\n"
"Please try again!\n"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Bez zmian;WIELKIMI ZNAKAMI;małymi znakami;Pierwsza wielka;Pierwszy Znak Każdego Słowa Wielki;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr "Plik zawiera błędną liczbę wierszy: %d, powinno być %d!"
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr "Zachowaj;Wyczyść;Pytaj"
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr "Brak równoważnego wewnętrznego polecenia"
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr "Przepraszamy, brak okna \"Znajdź pliki\"..."
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr "Przepraszamy, brak innych okien \"Znajdź pliki\" do zamknięcia i zwolnienia pamięci"
#: ulng.rsopenwithdevelopment
msgid "Development"
msgstr ""
#: ulng.rsopenwitheducation
msgid "Education"
msgstr ""
#: ulng.rsopenwithgames
msgid "Games"
msgstr ""
#: ulng.rsopenwithgraphics
#, fuzzy
msgctxt "ulng.rsopenwithgraphics"
msgid "Graphics"
msgstr "Grafika"
#: ulng.rsopenwithmultimedia
msgid "Multimedia"
msgstr ""
#: ulng.rsopenwithnetwork
#, fuzzy
msgctxt "ulng.rsopenwithnetwork"
msgid "Network"
msgstr "Sieć"
#: ulng.rsopenwithoffice
msgid "Office"
msgstr ""
#: ulng.rsopenwithother
#, fuzzy
msgctxt "ulng.rsopenwithother"
msgid "Other"
msgstr "Inne"
#: ulng.rsopenwithscience
msgid "Science"
msgstr ""
#: ulng.rsopenwithsettings
msgid "Settings"
msgstr ""
#: ulng.rsopenwithsystem
#, fuzzy
msgctxt "ulng.rsopenwithsystem"
msgid "System"
msgstr "System"
#: ulng.rsopenwithutility
msgid "Accessories"
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Przerwane"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Obliczanie sumy kontrolnej"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Obliczanie sumy kontrolnej dla \"%s\""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "Obliczanie sumy kontrolnej z \"%s\""
#: ulng.rsopercalculatingstatictics
msgid "Calculating"
msgstr "Obliczanie"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Obliczanie \"%s|\""
#: ulng.rsopercombining
msgid "Joining"
msgstr "Łączenie\""
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Łączenie plików w \"%s\" do \"%s\""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Kopiowanie"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Kopiowanie z \"%s\" do \"%s\""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Kopiowanie \"%s\" do \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Tworzenie katalogu"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Tworzenie katalogu \"%s\""
#: ulng.rsoperdeleting
msgid "Deleting"
msgstr "Usuwanie"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Usuwanie w \"%s|\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Usuwanie \"%s\""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Wykonywanie"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Wykonywanie \"%s\""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Wyodrębnianie"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Wyodrębnianie z \"%s\" do \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Zakończony"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Lista"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Lista \"%s\""
#: ulng.rsopermoving
msgid "Moving"
msgstr "Przenoszenie"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Przenoszenie z \"%s\" do \"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Przenoszenie \"%s\" do \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Nie uruchomiony"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Pakowanie"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Pakowanie z \"%s\" do \"%s\""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Pakowanie \"%s\" do \"%s\""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Pauza"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Wstrzymywanie"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Działające"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Ustawianie właściwości"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Ustawianie właściwości w \"%s\""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Ustawianie właściwości \"%s\""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Dzielenie"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Dzielenie \"%s\" do \"%s\""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Uruchamianie"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Zatrzymane"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Zatrzymywanie"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Testowanie"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Testowanie w \"%s\""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Testowanie \"%s\""
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Sprawdzanie sumy kontrolnej"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Sprawdzanie sumy kontrolnej w \"%s\""
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "Sprawdzanie sumy kontrolnej z \"%s\""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Oczekiwanie na dostęp do źródła pliku"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Oczekiwanie na odpowiedź użytkownika"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Wycieranie"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Wycieranie w \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Wycieranie \"%s\""
#: ulng.rsoperworking
msgid "Working"
msgstr "Działanie"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Dodaj na początku;Dodaj na końcu;Po prostu dodaj"
#: ulng.rsoptaddingtooltipfiletype
msgid "Adding new tooltip file type"
msgstr ""
#: ulng.rsoptarchiveconfiguresavetochange
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsoptarchiveradditonalcmd
msgid "Mode dependent, additional command"
msgstr ""
#: ulng.rsoptarchiveraddonlynotempty
msgid "Add if it is non-empty"
msgstr ""
#: ulng.rsoptarchiverarchivel
msgid "Archive File (long name)"
msgstr ""
#: ulng.rsoptarchiverarchiver
msgid "Select archiver executable"
msgstr ""
#: ulng.rsoptarchiverarchives
msgid "Archive file (short name)"
msgstr ""
#: ulng.rsoptarchiverchangeencoding
msgid "Change Archiver Listing Encoding"
msgstr ""
#: ulng.rsoptarchiverconfirmdelete
msgctxt "ulng.rsoptarchiverconfirmdelete"
msgid "Are you sure you want to delete: \"%s\"?"
msgstr ""
#: ulng.rsoptarchiverdefaultexportfilename
msgid "Exported Archiver Configuration"
msgstr ""
#: ulng.rsoptarchivererrorlevel
msgid "errorlevel"
msgstr ""
#: ulng.rsoptarchiverexportcaption
msgid "Export archiver configuration"
msgstr ""
#: ulng.rsoptarchiverexportdone
msgctxt "ulng.rsoptarchiverexportdone"
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverexportprompt
msgctxt "ulng.rsoptarchiverexportprompt"
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsoptarchiverfilelistl
msgid "Filelist (long names)"
msgstr ""
#: ulng.rsoptarchiverfilelists
msgid "Filelist (short names)"
msgstr ""
#: ulng.rsoptarchiverimportcaption
msgid "Import archiver configuration"
msgstr ""
#: ulng.rsoptarchiverimportdone
msgctxt "ulng.rsoptarchiverimportdone"
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverimportfile
msgid "Select the file to import archiver configuration(s)"
msgstr ""
#: ulng.rsoptarchiverimportprompt
msgctxt "ulng.rsoptarchiverimportprompt"
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsoptarchiverjustname
msgid "Use name only, without path"
msgstr ""
#: ulng.rsoptarchiverjustpath
msgid "Use path only, without name"
msgstr ""
#: ulng.rsoptarchiverprograml
msgid "Archive Program (long name)"
msgstr ""
#: ulng.rsoptarchiverprograms
msgid "Archive Program (short name)"
msgstr ""
#: ulng.rsoptarchiverquoteall
msgid "Quote all names"
msgstr ""
#: ulng.rsoptarchiverquotewithspace
msgid "Quote names with spaces"
msgstr ""
#: ulng.rsoptarchiversinglefprocess
msgid "Single filename to process"
msgstr ""
#: ulng.rsoptarchivertargetsubdir
msgid "Target subdirecory"
msgstr ""
#: ulng.rsoptarchiveruseansi
msgid "Use ANSI encoding"
msgstr ""
#: ulng.rsoptarchiveruseutf8
msgid "Use UTF8 encoding"
msgstr ""
#: ulng.rsoptarchiverwheretosave
msgid "Enter location and filename where to save archiver configuration"
msgstr ""
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Nazwa rodzaju archiwum:"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Skojarz wtyczkę \"%s\" z:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Pierwszy;Ostatni;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Klasyczny, starszy porządek;Kolejność alfabetyczna (ale wciąż pierwszy język)"
#: ulng.rsoptconfigtreestate
msgid "Full expand;Full collapse"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Ramka aktywnego panelu po lewej, nieaktywnego po prawej (starsze);Lewa ramka panelu po lewej, prawa po prawej"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Wpisz rozszerzenie"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "Dodaj na początku;Dodaj na końcu;Alfabetyczne sortowanie"
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "oddzielnym oknie;zminimalizowanym oddzielnym oknie;panelu operacji"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "dynamiczny;bajty;kbajty;Mbajty;Gbajty"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Skrót %s do cm_Delete zostanie dodany, a więc może zostać używany do odwracania tego ustawienia."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Dodaj klawisz skrótu dla %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Dodaj skrót"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Nie można ustawić skrótu"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Zmień skrót"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Polecenia"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Skrót %s do cm_Delete ma parametr, który zastępuje to ustawienie. Czy chcesz zmienić ten parametr, aby używać ustawienia globalnego?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
#, fuzzy,badformat
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Skrót %s do cm_Delete musi mieć parametr zmieniajacy trafność skrótu % s. Czy chcesz zmienić?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Opis"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Edytuj skrót klawiszowy do %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Popraw parametr"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Skrót"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Skróty"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<brak>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parametry"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Ustaw skrót do usunięcia pliku"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Dla tego ustawienia do pracy ze skrótem %s, skrót %s musi być przypisany do cm_Delete ale jest już przypisany do %s. Czy chcesz to zmienić?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Skrót %s dla cm_Delete to skrót sekwencji, dla którego nie można przypisać skrót klawiszowy z odwróconym Shift. To ustawienie może nie działać."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Skrót jest używany"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "Skrót %s jest już używany."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Zmienić na %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "używany przez %s w %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "używany dla tego polecenia ale z różnymi parametrami"
#: ulng.rsoptionseditorarchivers
msgid "Archivers"
msgstr "Archiwizatory"
#: ulng.rsoptionseditorautorefresh
msgid "Auto refresh"
msgstr "Automatyczne odświeżanie"
#: ulng.rsoptionseditorbehavior
msgid "Behaviors"
msgstr "Zachowanie"
#: ulng.rsoptionseditorbriefview
msgid "Brief"
msgstr "Krótki"
#: ulng.rsoptionseditorcolors
msgid "Colors"
msgstr "Kolory"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Kolumny"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Konfiguracja"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Niestandardowe kolumny"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Ulubione katalogi"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Przeciągnij i upuść"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Przycisk listy dysków"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Ulubione zakładki"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Dodatkowe skojarzenia plików"
#: ulng.rsoptionseditorfileassoc
msgid "File associations"
msgstr "Skojarzenia plików"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Nowy"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Operacje na plikach"
#: ulng.rsoptionseditorfilepanels
msgid "File panels"
msgstr "Panele plików"
#: ulng.rsoptionseditorfilesearch
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Wyszukiwanie pliku"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Widoki plików"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Typy plików"
#: ulng.rsoptionseditorfoldertabs
msgid "Folder tabs"
msgstr "Zakładki katalogów"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Dodatkowe zakładki folderów"
#: ulng.rsoptionseditorfonts
msgid "Fonts"
msgstr "Czcionki"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Podświetlanie"
#: ulng.rsoptionseditorhotkeys
msgid "Hot keys"
msgstr "Skróty klawiaturowe"
#: ulng.rsoptionseditoricons
msgid "Icons"
msgstr "Ikony"
#: ulng.rsoptionseditorignorelist
msgid "Ignore list"
msgstr "Lista ignorowanych plików/katalogów"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Klawisze"
#: ulng.rsoptionseditorlanguage
msgid "Language"
msgstr "Język"
#: ulng.rsoptionseditorlayout
msgid "Layout"
msgstr "Wygląd"
#: ulng.rsoptionseditorlog
msgid "Log"
msgstr "Plik dziennika"
#: ulng.rsoptionseditormiscellaneous
msgid "Miscellaneous"
msgstr "Różne"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Mysz"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
"Opcje zostały zmienione w \"%s\"\n"
"\n"
"Czy chcesz zapisać zmiany?\n"
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Wtyczki"
#: ulng.rsoptionseditorquicksearch
msgid "Quick search/filter"
msgstr "Szybkie wyszukiwanie/filtr"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Pasek narzędzi"
#: ulng.rsoptionseditortools
msgid "Tools"
msgstr "Narzędzia"
#: ulng.rsoptionseditortooltips
msgid "Tooltips"
msgstr "Podpowiedzi"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Menu widoku drzewa"
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr "Kolory menu widoku drzewa"
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Brak;Wiersz polecenia;Szybkie wyszukiwanie;Szybki filtr"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Lewy klawisz;Prawy klawisz;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "na początku listy plików;po katalogach(jeśli katalogi są sortowane przed plikami);od sortowanej pozycji;na końcu listy plików"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Wtyczka %s jest już przypisana do następujących rozszerzeń:"
#: ulng.rsoptplugindisable
msgid "D&isable"
msgstr "Wyłącz"
#: ulng.rsoptpluginenable
msgctxt "ulng.rsoptpluginenable"
msgid "E&nable"
msgstr "Włącz"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Aktywna"
#: ulng.rsoptpluginsdescription
msgctxt "ulng.rsoptpluginsdescription"
msgid "Description"
msgstr "Opis"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Nazwa pliku"
#: ulng.rsoptpluginshowbyextension
msgid "By extension"
msgstr ""
#: ulng.rsoptpluginshowbyplugin
msgid "By Plugin"
msgstr ""
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Nazwa"
#: ulng.rsoptpluginsortonlywhenbyextension
msgid "Sorting WCX plugins is only possible when showing plugins by extension!"
msgstr ""
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Skojarzenia"
#: ulng.rsoptrenamingtooltipfiletype
msgid "Renaming tooltip file type"
msgstr ""
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "Uwzględnij;Ignoruj"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "Pliki;Katalogi;Pliki i katalogi"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "Ukryj panel filtru gdy brak pasujących;Zachowaj zapisane ustawienia zmian dla następnej sesji"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "nie uwzględnia wielkości liter; według ustawień lokalnych (aAbBcC); napierw wielkie, potem małe litery (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "według nazwy i pokaż pierwsze; sortuj jako pliki i pokaż pierwsze; sortuj jako pliki"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Alfabetycznie, uwzględniając akcenty;Naturalne sortowanie: alfabetycznie i numery"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Góra;Dół;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "Separator;Polecenie wewnętrzne;Polecenie zewnętrzne;Men&u"
#: ulng.rsopttooltipconfiguresavetochange
msgid "To change file type tooltip configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsopttooltipfiletype
msgid "Tooltip file type name:"
msgstr "Nazwa kategorii:"
#: ulng.rsopttooltipfiletypealreadyexists
msgid "\"%s\" already exists!"
msgstr ""
#: ulng.rsopttooltipfiletypeconfirmdelete
msgctxt "ulng.rsopttooltipfiletypeconfirmdelete"
msgid "Are you sure you want to delete: \"%s\"?"
msgstr ""
#: ulng.rsopttooltipfiletypedefaultexportfilename
msgid "Exported tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeexportcaption
msgid "Export tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeexportdone
msgctxt "ulng.rsopttooltipfiletypeexportdone"
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsopttooltipfiletypeexportprompt
msgctxt "ulng.rsopttooltipfiletypeexportprompt"
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsopttooltipfiletypeimportcaption
msgid "Import tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeimportdone
msgctxt "ulng.rsopttooltipfiletypeimportdone"
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsopttooltipfiletypeimportfile
msgid "Select the file to import tooltip file type configuration(s)"
msgstr ""
#: ulng.rsopttooltipfiletypeimportprompt
msgctxt "ulng.rsopttooltipfiletypeimportprompt"
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsopttooltipfiletypewheretosave
msgid "Enter location and filename where to save tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipsfiletypename
msgid "Tooltip file type name"
msgstr ""
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "DC legacy - Kopiuj (x) nazwapliku.roz;Windows - nazwapliku (x).roz;Pozostałe - nazwapliku(x).roz"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "nie zmieniaj pozycji;użyj takich samych ustawień dla nowych plików; do posortowanej pozycji"
#: ulng.rspluginfilenamestylelist
msgid "With complete absolute path;Path relative to %COMMANDER_PATH%;Relative to the following"
msgstr ""
#: ulng.rspluginsearchcontainscasesenstive
msgid "contains(case)"
msgstr ""
#: ulng.rspluginsearchcontainsnotcase
msgid "contains"
msgstr ""
#: ulng.rspluginsearchequalcasesensitive
msgid "=(case)"
msgstr ""
#: ulng.rspluginsearchequalnotcase
msgctxt "ulng.rspluginsearchequalnotcase"
msgid "="
msgstr "="
#: ulng.rspluginsearchfieldnotfound
msgid "Field \"%s\" not found!"
msgstr ""
#: ulng.rspluginsearchnotcontainscasesenstive
msgid "!contains(case)"
msgstr ""
#: ulng.rspluginsearchnotcontainsnotcase
msgid "!contains"
msgstr ""
#: ulng.rspluginsearchnotequacasesensitive
msgid "!=(case)"
msgstr ""
#: ulng.rspluginsearchnotequalnotcase
msgctxt "ulng.rspluginsearchnotequalnotcase"
msgid "!="
msgstr "!="
#: ulng.rspluginsearchpluginnotfound
msgid "Plugin \"%s\" not found!"
msgstr ""
#: ulng.rspluginsearchunitnotfound
msgid "Unit \"%s\" not found!"
msgstr ""
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Pliki: %d, foldery: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Nie można zmienić praw dostępu dla \"%s\""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Nie można zmienić właściciela dla \"%s\""
#: ulng.rspropsfile
msgid "File"
msgstr "Plik"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Katalog"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Nazwany strumień"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Socket"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Specjalne urządzenie blokowe"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Specjalne urządzenie wirtualne"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Link symboliczny"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Nieznany typ"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Wynik wyszukiwania"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "WYSZUKAJ"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<szablon bez nazwy>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Przeszukanie pliku za pomocą wtyczki DSX jest już w toku.\n"
"Przed uruchomieniem nowego musisz zamknąć bieżące.\n"
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Przeszukanie pliku za pomocą wtyczki WDX jest już w toku.\n"
"Przed uruchomieniem nowego musisz zamknąć bieżące.\n"
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Wybierz katalog"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr "Wybierz okno"
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "Pokaż pomoc dla %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Wszystko"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Kategoria"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Kolumna"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Polecenie"
#: ulng.rssimplewordfalse
msgid "False"
msgstr ""
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Nazwa pliku"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "pliki"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr "Litera"
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Parametr"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Wynik"
#: ulng.rssimplewordtrue
msgid "True"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "Folder roboczy"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bajty"
#: ulng.rssizeunitgbytes
msgid "Gigabytes"
msgstr "Gigabajty"
#: ulng.rssizeunitkbytes
msgid "Kilobytes"
msgstr "Kilobajty"
#: ulng.rssizeunitmbytes
msgid "Megabytes"
msgstr "Megabajty"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabajty"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Plików: %d, Katalogów: %d, Rozmiar: %s (%s bajtów)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Nie można utworzyć katalogu docelowego!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Nieprawidłowy format wielkości pliku!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Pliku nie da się podzielić!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Liczba części jest większa niż 100! Kontynuować?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr "Automatycznie;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Wybierz katalog:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;#195€;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr "Tylko podgląd"
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr "Pozostałe"
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr "Na marginesie"
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr "Płaski"
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr "Ograniczony"
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr "Prosty"
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr "Fantastyczny"
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr "Cudowny"
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr "Ogromny"
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr "Wybierz katalog z historii katalogów"
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr "Wybierz ulubione zakładki"
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr "Wybierz polecenie z historii listy poleceń"
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr "Wybierz czynność z głównego menu"
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr "Wybierz czynność z głównego paska narzędzi"
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr "Wybierz katalog z Hot katalogu:"
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr "Wybierz katalog z pliku widoku historii"
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr "Wybierz plik lub katalog"
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Błąd przy tworzeniu linku symbolicznego."
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr "Domyślny tekst"
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr "Zwykły tekst"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "Nie rób nic;Zamknij zakładkę;Dostęp do ulubionych zakładek;Menu kontekstowe zakładek"
#: ulng.rstimeunitday
msgid "Day(s)"
msgstr "Dzień (dni)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Godzin(y)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minut(y)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Miesiąc(e)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Sekund(y)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Tydzień (tygodnie)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Rok (Lata)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Zmień nazwę ulubionych zakładek"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Zmień nazwę podmenu ulubionych zakładek"
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Różnice"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Edytor"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Błąd przy otwieraniu porównywania"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Błąd przy otwieraniu edytora"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Błąd przy otwieraniu terminalu"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Błąd przy otwieraniu podglądu"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rstooltiphidetimeoutlist
msgid "System default;1 sec;2 sec;3 sec;5 sec;10 sec;30 sec;1 min;Never hide"
msgstr ""
#: ulng.rstooltipmodelist
msgid "Combine DC and system tooltip, DC first (legacy);Combine DC and system tooltip, system first;Show DC tooltip when possible and system when not;Show DC tooltip only;Show system tooltip only"
msgstr ""
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Lister"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Proszę zgłosić ten błąd do systemu śledzenia błędów wraz z opisem wcześniejszych działań i następującym plikiem:%sWciśnij %s aby kontynuować lub %s aby zakończyć program."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "Oba panele, z aktywnego do nieaktywnego"
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "Oba panele, od lewej do prawej"
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Ścieżka panelu"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "Każdą nazwę należy ująć w nawiasach lub w czym chcesz"
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Tylko nazwa pliku, bez rozszerzenia"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "Pełna nazwa pliku (ścieżka+nazwa pliku)"
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr ""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr ""
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Lewy panel"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "Tymczasowa nazwa pliku listy nazw plików"
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "Tymczasowa nazwa pliku listy pełnych nazw plików (ścieżka+nazwa pliku)"
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr "Nazwy plików na liście w UTF-16 z BOM"
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr "Nazwy plików na liście w UTF-16 z BOM, wewnątrz cudzysłowów"
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr "Nazwy plików na liście w UTF-8"
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr "Nazwy plików na liście w UTF-8, wewnatrz cudzysłowów"
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "Tymczasowy nazwa pliku listy nazw plików z ścieżkąwzględną"
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Tylko rozszerzenie pliku"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Tylko nazwa pliku"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Inny przykład tego, co jest możliwe"
#: ulng.rsvarpath
#, fuzzy
#| msgid "Path, with ending delimiter"
msgid "Path, without ending delimiter"
msgstr "Ścieżka z końcowym separatorem"
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr "Zwraca znak procentu"
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "Poprzedź każdą nazwę \"-a \" lub czym chcesz"
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "%[Pytaj użytkownika o parametr;Proponuj wartość domyślną]"
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "Nazwa pliku ze ścieżką względną"
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Prawy panel"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "Pełna ścieżka drugiego wybranego pliku w prawym panelu"
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "Pokaż poprzednio wykonane polecenie"
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "%[Prosta wiadomość]"
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "Pokaże prostą wiadomość"
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Aktywny panel (źródło)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Nieaktywny panel (cel)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr ""
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "Polecenie zostanie wykonane w terminalu i pozostanie on otwarty po zakończeniu"
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr "Ścieżki nie mają końcowego ogranicznika"
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "Nazwy plików nie zostaną tutaj podane"
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "Polecenie zostanie wykonane w terminalu i zostanie on zamknięty po zakończeniu"
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr "Ścieżki nie mają końcowego ogranicznika (domyślnie)"
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Sieć"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Program wewnętrzny Double Commandera do podglądu"
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Zła jakość"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Kodowanie"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Typ obrazu"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Nowy rozmiar"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s nie znaleziony!"
#: ulng.rsviewpainttoolslist
msgid "Pen;Rect;Ellipse"
msgstr ""
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "w zewnętrznej przeglądarce"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "w wewnętrznej przeglądarce"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Liczba zamienionych: %d"
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "Nie było zmienionych"