doublecmd/language/doublecmd.pt.po
2018-11-21 17:07:49 +00:00

12934 lines
351 KiB
Text

# Pedro Albuquerque <palbuquerque73@gmail.com>, 2017.
msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2017-12-11 07:55+0000\n"
"Last-Translator: Pedro Albuquerque <palbuquerque73@gmail.com>\n"
"Language-Team: Português <>\n"
"Language: pt\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Plural-Forms: nplurals=2; plural=(n != 1);\n"
"X-Generator: Gtranslator 2.91.6\n"
"X-Native-Language: Português\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "A comparar - %d%% (ESC para cancelar)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Direita: eliminar %d ficheiro(s)"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Encontrados: %d (iguais: %d, diferentes: %d, únicos esquerdos: %d, únicos direitos: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Esquerda->direita: copiar %d ficheiros, tamanho: %d bytes"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Direita->esquerda: copiar %d ficheiros, tamanho: %d bytes"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Escolher modelo..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "&Verificar espaço livre"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Cop&iar atributos"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Copiar &propriedade"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Copiar &permissões"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Copiar d&ata/hora"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Corrigir li&gações"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
msgid "Drop readonly fla&g"
msgstr "Lar&gar atributo Só de leitura"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "E&xcluir pastas vazias"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Seguir &ligações"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "&Reservar espaço"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr "&Verificar"
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "O que fazer quando não conseguir definir hora, atributos, etc. do ficheiro"
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Usar modelo de ficheiro"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Quando a pasta &existe"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When &file exists"
msgstr "Quando o &ficheiro existe"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Quando &não conseguir definir propriedade"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<sem modelos>"
#: tfrmabout.btnclose.caption
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Fe&char"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Copiar para área de transferência"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "Sobre"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Versão"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Página web:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revisão"
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Versão"
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Repor"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Escolher atributos"
#: tfrmattributesedit.cbarchive.caption
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
msgid "&Archive"
msgstr "&Arquivo"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Co&mprimido"
#: tfrmattributesedit.cbdirectory.caption
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
msgid "&Directory"
msgstr "&Pasta"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "&Encriptado"
#: tfrmattributesedit.cbhidden.caption
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
msgid "&Hidden"
msgstr "&Oculto"
#: tfrmattributesedit.cbreadonly.caption
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
msgid "Read o&nly"
msgstr "Só de &leitura"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "Es&parso"
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Pegajoso"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "Ligação &simbólica"
#: tfrmattributesedit.cbsystem.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "S&istema"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Temporário"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Atributos NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Atributos gerais"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grupo"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Outro"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Dono"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Executar"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Ler"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Como te&xto:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Escrever"
#: tfrmbenchmark.caption
msgid "Benchmark"
msgstr ""
#: tfrmbenchmark.lblbenchmarksize.caption
msgid "Benchmark data size: %d MB"
msgstr ""
#: tfrmbenchmark.stgresult.columns[0].title.caption
msgid "Hash"
msgstr ""
#: tfrmbenchmark.stgresult.columns[1].title.caption
msgid "Time (ms)"
msgstr ""
#: tfrmbenchmark.stgresult.columns[2].title.caption
msgid "Speed (MB/s)"
msgstr ""
#: tfrmchecksumcalc.caption
msgctxt "TFRMCHECKSUMCALC.CAPTION"
msgid "Calculate checksum..."
msgstr "Calcular checksum..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Abrir ficheiro checksum após terminar a tarefa"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "C&riar ficheiro checksum separado para cada ficheiro"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "Gravar ficheiro&s checksum em:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Fe&char"
#: tfrmchecksumverify.caption
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Verificar checksum..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "A&dicionar"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "L&igar"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "&Eliminar"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Gestor de ligações"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Ligar a:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "A&dicionar à fila"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "O&pções"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "Gra&var estas opções como predefinição"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Copiar ficheiro(s)"
#: tfrmcopydlg.mnunewqueue.caption
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Nova fila"
#: tfrmcopydlg.mnuqueue1.caption
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Fila 1"
#: tfrmcopydlg.mnuqueue2.caption
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Fila 2"
#: tfrmcopydlg.mnuqueue3.caption
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Fila 3"
#: tfrmcopydlg.mnuqueue4.caption
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Fila 4"
#: tfrmcopydlg.mnuqueue5.caption
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Fila 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Gravar descrição"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Comentário do ficheiro/pasta"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "E&ditar comentário de:"
#: tfrmdescredit.lblencoding.caption
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "A co&dificar:"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "Sobre"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Comparar automaticamente"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Modo binário"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Copiar bloco à direita"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Copiar bloco à direita"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Copiar bloco à esquerda"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Copiar bloco à esquerda"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Copiar"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Cortar"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Eliminar"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Colar"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Refazer"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Seleccion&ar tudo"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Desfazer"
#: tfrmdiffer.actexit.caption
msgctxt "TFRMDIFFER.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Sair"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION"
msgid "First Difference"
msgstr "Primeira diferença"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Primeira diferença"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Ignorar maiúsculas"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Ignorar espaços"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Continuar rolamento"
#: tfrmdiffer.actlastdifference.caption
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION"
msgid "Last Difference"
msgstr "Última diferença"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Última diferença"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Diferenças de linha"
#: tfrmdiffer.actnextdifference.caption
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION"
msgid "Next Difference"
msgstr "Diferença seguinte"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Diferença seguinte"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Abrir esquerdo..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Abrir direito..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Pintar fundo"
#: tfrmdiffer.actprevdifference.caption
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION"
msgid "Previous Difference"
msgstr "Diferença anterior"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Diferença anterior"
#: tfrmdiffer.actreload.caption
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
msgid "&Reload"
msgstr "&Recarregar"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Recarregar"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Gravar"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Gravar"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Gravar como..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Gravar como..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Gravar esquerdo"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Gravar esquerdo"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Gravar esquerdo como..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Gravar esquerdo como..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Gravar direito"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Gravar direito"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Gravar direito como..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Gravar direito como...."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Comparar"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Comparar"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Codificar"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Codificar"
#: tfrmdiffer.caption
msgctxt "TFRMDIFFER.CAPTION"
msgid "Compare files"
msgstr "Comparar ficheiros"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Esquerdo"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "Di&reito"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Acções"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmdiffer.mnuencoding.caption
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codificar"
#: tfrmdiffer.mnufile.caption
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "&Ficheiro"
#: tfrmdiffer.mnuoptions.caption
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
msgid "&Options"
msgstr "&Opções"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Adicionar novo atalho à sequência"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Remover último atalho da sequência"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr "Seleccione o atalho da lista de teclas ainda disponíveis"
#: tfrmedithotkey.cghkcontrols.caption
msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION"
msgid "Only for these controls"
msgstr "Só para estes controlos"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parâmetros (cada numa linha separada):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Atalhos:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "Sobre"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "Sobre"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Configuração"
#: tfrmeditor.actconfhigh.hint
msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT"
msgid "Configuration"
msgstr "Configuração"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Copiar"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Copiar"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Cortar"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Cortar"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Eliminar"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Eliminar"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Localizar"
#: tfrmeditor.acteditfind.hint
msgctxt "TFRMEDITOR.ACTEDITFIND.HINT"
msgid "Find"
msgstr "Localizar"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Localizar seguinte"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Localizar seguinte"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Localizar anterior"
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr "Ir para linha..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Colar"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Colar"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Refazer"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Refazer"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "Substitui&r"
#: tfrmeditor.acteditrplc.hint
msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT"
msgid "Replace"
msgstr "Substituir"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Seleccion&ar tudo"
#: tfrmeditor.acteditselectall.hint
msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT"
msgid "Select All"
msgstr "Seleccionar tudo"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Desfazer"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Desfazer"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "Fe&char"
#: tfrmeditor.actfileclose.hint
msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT"
msgid "Close"
msgstr "Fechar"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Sair"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Sair"
#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "&Novo"
#: tfrmeditor.actfilenew.hint
msgctxt "TFRMEDITOR.ACTFILENEW.HINT"
msgid "New"
msgstr "Novo"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Abrir"
#: tfrmeditor.actfileopen.hint
msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT"
msgid "Open"
msgstr "Abrir"
#: tfrmeditor.actfilereload.caption
#, fuzzy
msgctxt "tfrmeditor.actfilereload.caption"
msgid "Reload"
msgstr "Recarregar"
#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Gravar"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Gravar"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Gr&avar como..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Gravar como"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Gra&var tudo"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Gravar tudo"
#: tfrmeditor.caption
msgctxt "TFRMEDITOR.CAPTION"
msgid "Editor"
msgstr "Editor"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "A&juda"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codificar"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Abrir como"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Gravar como"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Ficheiro"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Realçar sintaxe"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Fim de linha"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
msgid "C&ase sensitivity"
msgstr "Sensível a m&aiúsculas"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
msgid "S&earch from caret"
msgstr "&Localizar do cursor"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "Expressões &regulares"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
msgid "Selected &text only"
msgstr "Só &texto seleccionado"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
msgid "&Whole words only"
msgstr "Só &palavras completas"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
msgid "Option"
msgstr "Opção"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
msgid "&Replace with:"
msgstr "Substitui&r com"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
msgid "&Search for:"
msgstr "Proc&urar por:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
msgid "Direction"
msgstr "Direcção"
#: tfrmextractdlg.caption
msgctxt "TFRMEXTRACTDLG.CAPTION"
msgid "Unpack files"
msgstr "Descomprimir ficheiros"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Descomprimir nomes de caminho se armazenados com os ficheiros"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Descomprimir cada arquivo para pastas &separadas (nome do arquivo)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "Sobrescre&ver ficheiros existentes"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Para a &pasta:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "&Extrair ficheiros com esta máscara:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "Senha de ficheiros encri&ptados:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Fe&char"
#: tfrmfileexecuteyourself.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
msgid "Wait..."
msgstr "Aguarde..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Nome de ficheiro:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "De:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Clique em Fechar quando o ficheiro temporário puder ser apagado!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&Para o painel"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Ver tudo"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Operação actual"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "De:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Para:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Fe&char"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "&Definir propriedades"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "P&ara todos os seleccionados"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Sa&ltar este ficheiro"
#: tfrmfileproperties.caption
msgctxt "TFRMFILEPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Propriedades"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Pegajoso"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr "Permitir &Executar ficheiro como programa"
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Dono"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grupo"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Outro"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Dono"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Texto:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Contém:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Executar"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr "Executar:"
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Nome de ficheiro"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Nome de ficheiro"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Caminho:"
#: tfrmfileproperties.lblgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
msgid "&Group"
msgstr "&Grupo"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Último acesso:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Última modificação:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Última alteração de estado:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Octal:"
#: tfrmfileproperties.lblownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
msgid "O&wner"
msgstr "&Dono"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Ler"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Tamanho:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Ligação simbólica a:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Tipo:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Escrever"
#: tfrmfileproperties.sgimage.columns[0].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Nome"
#: tfrmfileproperties.sgimage.columns[1].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Valor"
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributos"
#: tfrmfileproperties.tsplugins.caption
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Extensões"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Propriedades"
#: tfrmfileunlock.btnclose.caption
#, fuzzy
msgctxt "tfrmfileunlock.btnclose.caption"
msgid "Close"
msgstr "Fechar"
#: tfrmfileunlock.btnterminate.caption
msgid "Terminate"
msgstr ""
#: tfrmfileunlock.btnunlock.caption
msgctxt "tfrmfileunlock.btnunlock.caption"
msgid "Unlock"
msgstr ""
#: tfrmfileunlock.btnunlockall.caption
msgid "Unlock All"
msgstr ""
#: tfrmfileunlock.caption
msgctxt "tfrmfileunlock.caption"
msgid "Unlock"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[0].title.caption
msgid "File Handle"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[1].title.caption
msgid "Process ID"
msgstr ""
#: tfrmfileunlock.stgfilehandles.columns[2].title.caption
msgid "Executable Path"
msgstr ""
#: tfrmfinddlg.actcancel.caption
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "C&ancelar"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "Cancelar procura e fechar janela"
#: tfrmfinddlg.actclose.caption
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "Fe&char"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Configuração de atalhos"
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Editar"
#: tfrmfinddlg.actfeedtolistbox.caption
msgctxt "tfrmfinddlg.actfeedtolistbox.caption"
msgid "Feed to &listbox"
msgstr "Enviar à &lista"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr "Cancelar procura, fechar e libertar memória"
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr "Para todos os \"Localizar ficheiros\", cancelar, fechar e libertar memória"
#: tfrmfinddlg.actgotofile.caption
msgctxt "tfrmfinddlg.actgotofile.caption"
msgid "&Go to file"
msgstr "&Ir para ficheiro"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Localizar dados"
#: tfrmfinddlg.actlastsearch.caption
msgctxt "tfrmfinddlg.actlastsearch.caption"
msgid "&Last search"
msgstr "Ú&ltima procura"
#: tfrmfinddlg.actnewsearch.caption
msgctxt "tfrmfinddlg.actnewsearch.caption"
msgid "&New search"
msgstr "&Nova procura"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr "Nova procura (limpar filtros)"
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Ir para a página \"Avançado\""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Ir para a página \"Carregar/Gravar\""
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr "Mudar para a página seguin&te"
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Ir para a página \"Extensões\""
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr "Mudar para a &página anterior"
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Ir para a página \"Resultados\""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Ir para a página \"Padrão\""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Iniciar"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Ver"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Adicionar"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "A&juda"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Gravar"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Eliminar"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "&Carregar"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "Gr&avar"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Gra&var com \"Iniciar na pasta\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Se gravado então \"Iniciar na pasta\" será restaurado ao carregar o modelo. Use se quer fixar a procura numa determinada pasta"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Usar modelo"
#: tfrmfinddlg.caption
msgctxt "TFRMFINDDLG.CAPTION"
msgid "Find files"
msgstr "Localizar ficheiros"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Sensível a ma&iúsculas"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "&Data de:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Da&ta até:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "Ta&manho de:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Tam&anho até:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "Procurar em &arquivos"
#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "Localizar &texto num ficheiro"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION"
msgid "Follow s&ymlinks"
msgstr "Seguir s&imbólicas"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "Localizar ficheiros S&EM o texto"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Mais recentes q&ue:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Separadores abertos"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Procurar parte do nome de ficheiro"
#: tfrmfinddlg.cbregexp.caption
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "Expressão &regular"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "Substituir &por"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Pastas e &ficheiros seleccionados"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "&Expressão regular"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "&Hora de:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "H&ora até:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "&Usar extensão de procura:"
#: tfrmfinddlg.chkhex.caption
msgid "Hexadecimal"
msgstr ""
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Insira os nomes das pastas a excluir da procura separados por \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Insira os nomes dos ficheiros a excluir da procura separados por \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Insira os nomes de ficheiros separados por \";\""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION"
msgid "Directories"
msgstr "Pastas"
#: tfrmfinddlg.gbfiles.caption
msgctxt "TFRMFINDDLG.GBFILES.CAPTION"
msgid "Files"
msgstr "Ficheiros"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Localizar dados"
#: tfrmfinddlg.lblattributes.caption
msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION"
msgid "Attri&butes"
msgstr "Atri&butos"
#: tfrmfinddlg.lblencoding.caption
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
msgid "Encodin&g:"
msgstr "Co&dificar"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "E&xcluir sub-pastas"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "&Excluir ficheiros"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "&Máscara"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Iniciar na &pasta"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Procurar em su&b-pastas:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "Procuras &prévias"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr "&Acção"
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr "Para todos os outros, cancelar, fechar e libertar memória"
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Abrir em novo separador"
#: tfrmfinddlg.mioptions.caption
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Opções"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Remover da lista"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr "&Resultado"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Mostrar todos os itens"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Mostrar no editor"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Mostrar no visualizador"
#: tfrmfinddlg.miviewtab.caption
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Ver"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Avançado"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Carregar/Gravar"
#: tfrmfinddlg.tsplugins.caption
msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Extensões"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Resultados"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Padrão"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Localizar"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Localizar"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "Sensível a m&aiúsculas"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Criar ligação física"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Destino para onde a ligação aponta"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Nome da &ligação"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr "Importar tudo!"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr "Importar selecção"
#: tfrmhotdirexportimport.caption
msgctxt "tfrmhotdirexportimport.caption"
msgid "Select the entries your want to import"
msgstr "Seleccione as entradas a importar"
#: tfrmhotdirexportimport.lbhint.caption
msgctxt "tfrmhotdirexportimport.lbhint.caption"
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Ao clicar num sub-menu, selecciona todo o menu"
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Prima Ctrl e clique para seleccionar múltiplas entradas"
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgctxt "TFRMLINKER.CAPTION"
msgid "Linker"
msgstr "Ligador"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Gravar em..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Item"
#: tfrmlinker.lblfilename.caption
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "Nome de &ficheiro"
#: tfrmlinker.spbtndown.caption
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "A&baixo"
#: tfrmlinker.spbtndown.hint
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
msgid "Down"
msgstr "Abaixo"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "&Remover"
#: tfrmlinker.spbtnrem.hint
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "Eliminar"
#: tfrmlinker.spbtnup.caption
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "A&cima"
#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Acima"
#: tfrmmain.actabout.caption
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
msgid "&About"
msgstr "&Sobre"
#: tfrmmain.actactivatetabbyindex.caption
msgid "Activate Tab By Index"
msgstr ""
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Adicionar nome de ficheiro à linha de comandos"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr "Nova instância de procura..."
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Adicionar caminho e nome de ficheiro à linha de comandos"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Copiar caminho para a linha de comandos"
#: tfrmmain.actbenchmark.caption
msgid "&Benchmark"
msgstr ""
#: tfrmmain.actbriefview.caption
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr "Vista breve"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Vista breve"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Calcular espaço &ocupado"
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Alterar pasta"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Alterar pasta para home"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Alterar pasta para pasta-mãe"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Alterar pasta para raiz"
#: tfrmmain.actchecksumcalc.caption
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "Calcular check&sum"
#: tfrmmain.actchecksumverify.caption
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "&Verificar checksum"
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Limpar diário"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Limpar janela de diário"
#: tfrmmain.actclosealltabs.caption
msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION"
msgid "Close &All Tabs"
msgstr "Fech&ar todos os separadores"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Fechar separadores duplicados"
#: tfrmmain.actclosetab.caption
msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION"
msgid "&Close Tab"
msgstr "Fe&char separador"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Linha de comandos seguinte"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Definir linha de comandos para o comando seguinte do histórico"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Linha de comandos anterior"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Definir linha de comandos para o comando anterior do histórico"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Completo"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Vista de colunas"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "&Comparar por conteúdos"
#: tfrmmain.actcomparedirectories.caption
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
msgid "Compare Directories"
msgstr "Comparar pastas"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Comparar pastas"
#: tfrmmain.actconfigarchivers.caption
msgid "Configuration of Archivers"
msgstr ""
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Configuração da lista de pastas"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Configuração de separadores favoritos"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Configuração de separadores de pastas"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Configuração de atalhos"
#: tfrmmain.actconfigplugins.caption
msgid "Configuration of Plugins"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Gravar definições"
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr "Configuração de procuras"
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Barra de ferramentas..."
#: tfrmmain.actconfigtooltips.caption
msgid "Configuration of tooltips"
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Configuração do menu da árvore"
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Configuração de cores do menu da árvore"
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Mostrar menu contextual"
#: tfrmmain.actcopy.caption
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Copiar"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Copiar todos os separadores para o lado oposto"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Copiar todas as &colunas mostradas"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Copiar nomes de ficheiros com caminho com&pleto"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Copiar nomes de &ficheiros para a área de transferência"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Copiar ficheiros sem pedir confirmação"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr "Copiar caminho completo dos ficheiros seleccionados sem separador de pasta final"
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Copiar caminho completo dos ficheiros seleccionados"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Copiar para o mesmo painel"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Copiar"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Mostrar espaço oc&upado"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Cor&tar"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Mostrar parâmetros de comando"
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Eliminar"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr "Para todas as procuras, cancelar, fechar e libertar memória"
#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "Histórico da pasta"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "&Lista da pasta"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Seleccione qualquer comando e execute-o"
#: tfrmmain.actedit.caption
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Editar"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Editar co&mentário..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Editar novo ficheiro"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Editar campo de caminho acima da lista de ficheiros"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Trocar &painéis"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr "Executar script"
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Sair"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "&Extrair ficheiros..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "&Associações de ficheiros..."
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "Com&binar ficheiros..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Mostrar propriedades de &ficheiro"
#: tfrmmain.actfilespliter.caption
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
msgid "Spl&it File..."
msgstr "D&ividir ficheiro"
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "Vista &plana"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Foco na linha de comandos"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr "Trocar foco"
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr "Trocar entre a lista esquerda e direita"
#: tfrmmain.actfocustreeview.caption
msgid "Focus on tree view"
msgstr ""
#: tfrmmain.actfocustreeview.hint
msgid "Switch between current file list and tree view (if enabled)"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Colocar cursor no primeiro ficheiro da lista"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Colocar cursor no último ficheiro da lista"
#: tfrmmain.acthardlink.caption
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
msgid "Create &Hard Link..."
msgstr "Criar li&gação física"
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Conteúdo"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "Modo Painéis &horizontais"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Teclado"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Vista breve no painel esquerdo"
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Vista de colunas no painel esquedo"
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Esquerdo &= Direito"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "Vista &plana no painel esquerdo"
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Abrir lista esquerda de unidades"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Orden in&versa no painel esquerdo"
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Ordenar painel esquerdo por &atributos"
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Ordenar painel esquerdo por &data"
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "Ordenar painel esquerdo por &extensão"
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "Ordenar painel esquerdo por &nome"
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Ordenar painel esquerdo por &tamanho"
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Vista de miniaturas no painel esquerdo"
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "Carregar separadores dos favoritos"
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Carregar selecção da área de transferência"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "Carregar se&lecção de ficheiro..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "Carregar &separadores de ficheiro"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "Criar &pasta"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Seleccionar todos com a mesma e&xtensão"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr "Seleccionar todos com o mesmo nome"
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr "Seleccionar todos com o mesmo nome e extensão"
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr "Seleccionar todos no mesmo caminho"
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "&Inverter selecção"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "&Seleccionar tudo"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "Remover selecção de grupo..."
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "Seleccionar &grupo"
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "Rem&over todas as selecções"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimizar janela"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Ferramenta Multi-renomear"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Li&gar a rede..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "&Desligar de rede"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Ligação &rápida a rede..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Novo separador"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr "Carregar os favoritos seguintes na lista"
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Mudar para o separador seguin&te"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Abrir"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Tentar abrir arquivo"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Abrir ficheiro barra"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Abrir &pasta em novo separador"
#: tfrmmain.actopendrivebyindex.caption
msgid "Open Drive by Index"
msgstr ""
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
msgid "Open &VFS List"
msgstr "Abrir lista do S&VF"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "&Visualizador de operações"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Opções..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "&Comprimir ficheiros"
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Definir posição do divisor"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "Co&lar"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Carregar os favoritos anteriores na lista"
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Mudar para o se&parador anterior"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Filtro rápido"
#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Procura rápida"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "Painel &Vista rápida"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Actualizar"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Recarregar os últimos favoritos carregados"
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Mover"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Mover/Renomear ficheiros sem pedir confirmação"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Renomear"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "&Renomear separador"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Regravar os últimos favoritos carregados"
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Restaurar selecção"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "Ordem in&versa"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Vista breve no painel direito"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Vista de colunas no painel direito"
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Direito &= Esquerdo"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "Vista &plana no painel direito"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Abrir lista direita de unidades"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "Ordem in&versa no painel direito"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Ordenar painel direito por &atributos"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Ordenar painel direito por &data"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Ordenar painel direito por &extensão"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Ordenar painel direito por &nome"
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Ordenar painel direito por &tamanho"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Vista de miniaturas no painel direito"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Executar &terminal"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Gravar separadores actuais como novos favoritos"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Gra&var selecção"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Gravar s&elecção para ficheiro..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "Gravar &separadores em ficheiro"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Procurar..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Todos os separadores bloqueados com pasta aberta em novos separadores"
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Definir todos os separadores como Normal"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Definir todos os separadores como Bloqueado"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Todos os separadores bloqueados com alterações a pasta permitidas"
#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "Alterar &atributos"
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Bloqueado com pastas aber&tas em novos separadores"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normal"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "B&loqueado"
#: tfrmmain.actsettaboptionpathresets.caption
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
msgid "Locked with &Directory Changes Allowed"
msgstr "Bloqueado com alterações de pastas permiti&das"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Abrir"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Abrir usando associações do sistema"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Mostrar menu de botões"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Mostrar histórico da linha de comandos"
#: tfrmmain.actshowmainmenu.caption
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Menu"
#: tfrmmain.actshowsysfiles.caption
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "Mostrar fic&heiros ocultos/de sistema"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Ordenar por &atributos"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Ordenar por &data"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Ordenar por &extensão"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Ordenar por &nome"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Ordenar por &tamanho"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Abrir lista de unidades"
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Activar/Desactivar exibição de nomes na lista de ignorados"
#: tfrmmain.actsymlink.caption
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "Criar &ligação simbólica..."
#: tfrmmain.actsyncdirs.caption
msgid "Syn&chronize dirs..."
msgstr "Sincronizar pastas..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Destino &= Origem"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Arquivo(s) de &teste"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Miniaturas"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Vista Miniaturas"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr "Alternar modo de ecrã completo"
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Transferir a pasta sob o cursor para a janela esquerda"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Transferir a pasta sob o cursor para a janela direita"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "Vis&ta em árvore"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr "Ordenar de acordo com os parâmetros"
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "De-seleccionar todos com a mesma ex&tensão"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr "De-seleccionar todos com o mesmo nome"
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr "De-seleccionar todos com o mesmo nome e extensão"
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr "De-seleccionar todos no mesmo caminho"
#: tfrmmain.actview.caption
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Ver"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Mostrar histórico de caminhos visitados na vista activa"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Ir para a entrada seguinte no histórico"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Ir para a entrada anterior no histórico"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Ver diário"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr "Ver instâncias actuais de procura"
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Visitar a página web do Double Commander"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Limpar"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr "Trabalhar com a lista de pastas e parâmetros"
#: tfrmmain.btnf10.caption
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Sair"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Pasta"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Eliminar"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminal"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Lista de pastas"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Mostrar a pasta actual do painel direito no painel esquerdo"
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
msgid "Go to home directory"
msgstr "Ir para a pasta home"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
msgid "Go to root directory"
msgstr "Ir para a pasta raiz"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
msgid "Go to parent directory"
msgstr "Ir para a pasta-mãe"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Lista de pastas"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Mostrar a pasta actual do painel esquerdo no painel direito"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Caminho"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Copiar..."
#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Criar ligação..."
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Limpar"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Copiar"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Ocultar"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Seleccionar tudo"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Mover..."
#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Criar ligação simbólica..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Opções do separador"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Sair"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Restaurar"
#: tfrmmain.mnualloperpause.caption
msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Iniciar"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Comandos"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "C&onfiguração"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Favoritos"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Ficheiros"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "A&juda"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Marcar"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Rede"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "Mo&strar"
#: tfrmmain.mnutaboptions.caption
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "&Opções do separador"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Separadores"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Copiar"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Cortar"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Eliminar"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Editar"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Colar"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmmaincommandsdlg.caption
msgctxt "tfrmmaincommandsdlg.caption"
msgid "Select your internal command"
msgstr "Seleccione o seu comando interno"
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Ordem de idade"
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr "Ordem de idade"
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Escolher todas as categorias por predefinição"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Selecção:"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "&Categorias:"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "&Nome do comando:"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Filtro:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Dica:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Atalho:"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr "cm_name"
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "Categoria"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Ajuda"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Dica"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Atalho"
#: tfrmmaskinputdlg.btnaddattribute.caption
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Adicionar"
#: tfrmmaskinputdlg.btnattrshelp.caption
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "A&juda"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Definir..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Sensível a maiúsculas"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr "Ignorar acentos e ligações"
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr "Atri&butos:"
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Máscara de entrada:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "Ou selecciona&r tipo predefinido:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Criar nova pasta"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "&Insira o nome da nova pasta:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "TFRMMODVIEW.CAPTION"
msgid "New Size"
msgstr "Novo tamanho"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Altura:"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgctxt "tfrmmodview.lblpath2.caption"
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgctxt "tfrmmodview.lblpath3.caption"
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Qualidade de compressão jpg"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Largura:"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Altura"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Largura"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr "456456465465465"
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Fe&char"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Eliminar"
#: tfrmmultirename.btnedit.caption
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "&Editar"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "Ca&rregar"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Renomear"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Re&por tudo"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Gravar"
#: tfrmmultirename.caption
msgctxt "TFRMMULTIRENAME.CAPTION"
msgid "MultiRename"
msgstr "Multi-renomear"
#: tfrmmultirename.cblog.caption
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "Ac&tivar"
#: tfrmmultirename.cbregexp.caption
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "E&xpressões regulares"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "&Usar substituição"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Extensão"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Contador"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Localizar && substituir"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Resultado do diário"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Máscara"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Predefinições"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "&Extensão"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "&Localizar"
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "&Intervalo"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "&Nome de ficheiro"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "Su&bstituir..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "&Número inicial"
#: tfrmmultirename.lbwidth.caption
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "&Largura"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Contador"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Dia"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Dia (2 dígitos)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Dia da semana (curto, ex. \"Seg\")"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Dia da semana (longo, ex. \"Segunda\")"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Carácter na posição x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Caracteres desde a posição x até y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Hora"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Hora (2 dígitos)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minuto"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minuto (2 dígitos)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Mês"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Mês (2 dígitos)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Nome do mês (curto, ex. \"Jan\")"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Nome do mês (longo, ex. \"Janeiro\")"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Nome"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Carácter na posição x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Caracteres desde a posição x até y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Hora..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Extensão..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Nome..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Extensão"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Segundo"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Segundo (2 dígitos)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Ano (2 dígitos)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Ano (4 dígitos)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Editar nomes..."
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Carregar nomes de ficheiro..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION"
msgid "Old File Name"
msgstr "Nome antigo de ficheiro"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION"
msgid "New File Name"
msgstr "Novo nome de ficheiro"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION"
msgid "File Path"
msgstr "Caminho de ficheiro"
#: tfrmmultirenamewait.caption
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr "Clique Aceitar quando fechar o editor para carregar os nomes alterados!"
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Escolha uma aplicação"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Comando personalizado"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Gravar associação"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Definir aplicação seleccionada como acção predefinida"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Tipo de ficheiro a abrir: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Múltiplos nomes de ficheiro"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Múltiplos URIs"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Nome de ficheiro único"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "URI único"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
msgid "&Apply"
msgstr "&Aplicar"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmoptions.caption
msgctxt "TFRMOPTIONS.CAPTION"
msgid "Options"
msgstr "Opções"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Por favor seleccione uma das sub-páginas, esta página não contém definições."
#: tfrmoptionsarchivers.btnarchiveradd.caption
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
msgid "A&dd"
msgstr "A&dicionar"
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverapply.caption
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
msgid "A&pply"
msgstr "A&plicar"
#: tfrmoptionsarchivers.btnarchivercopy.caption
msgctxt "tfrmoptionsarchivers.btnarchivercopy.caption"
msgid "Cop&y"
msgstr "Copiar"
#: tfrmoptionsarchivers.btnarchiverdelete.caption
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
msgid "Delete"
msgstr "&Eliminar"
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverother.caption
msgctxt "tfrmoptionsarchivers.btnarchiverother.caption"
msgid "Oth&er..."
msgstr "Outro..."
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
msgid "Some functions to select appropriate path"
msgstr "Funções para seleccionar o caminho correcto"
#: tfrmoptionsarchivers.btnarchiverrename.caption
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
msgid "&Rename"
msgstr "&Renomear"
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiverids.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
msgid "Options:"
msgstr "Opções:"
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
msgid "Format parsing mode:"
msgstr "Formatar modo de análise:"
#: tfrmoptionsarchivers.chkarchiverenabled.caption
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
msgid "E&nabled"
msgstr "Ac&tivo"
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
msgid "De&bug mode"
msgstr "Modo Dep&uração"
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
msgid "S&how console output"
msgstr "Mostrar saída da co&nsola"
#: tfrmoptionsarchivers.chkfilenameonlylist.caption
msgid "Use archive name without extension as list"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
msgid "Uni&x file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
msgid "&Unix path delimiter \"/\""
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
msgid "Windows &file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
msgid "Windows path deli&miter \"\\\""
msgstr ""
#: tfrmoptionsarchivers.lblarchiveradd.caption
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
msgid "Add&ing:"
msgstr "A ad&icionar:"
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
msgid "Arc&hiver:"
msgstr "Ar&quivador:"
#: tfrmoptionsarchivers.lblarchiverdelete.caption
msgid "De&lete:"
msgstr "Eliminar:"
#: tfrmoptionsarchivers.lblarchiverdescription.caption
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
msgid "De&scription:"
msgstr "De&scrição:"
#: tfrmoptionsarchivers.lblarchiverextension.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
msgid "E&xtension:"
msgstr "E&xtensão:"
#: tfrmoptionsarchivers.lblarchiverextract.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
msgid "Ex&tract:"
msgstr "Ex&trair:"
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
msgid "Extract &without path:"
msgstr "Extrair sem caminho:"
#: tfrmoptionsarchivers.lblarchiveridposition.caption
msgid "ID Po&sition:"
msgstr "Posição da ID:"
#: tfrmoptionsarchivers.lblarchiverids.caption
msgid "&ID:"
msgstr "ID:"
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
msgid "ID See&k Range:"
msgstr "Intervalo de procura de ID:"
#: tfrmoptionsarchivers.lblarchiverlist.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
msgid "&List:"
msgstr "&Lista:"
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
msgid "Archi&vers:"
msgstr "Arquivadores:"
#: tfrmoptionsarchivers.lblarchiverlistend.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
msgid "Listing &finish (optional):"
msgstr "&Final da lista (opcional):"
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
msgid "Listing for&mat:"
msgstr "For&mato da lista:"
#: tfrmoptionsarchivers.lblarchiverliststart.caption
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
msgid "Listin&g start (optional):"
msgstr "Iní&cio da lista (opcional):"
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
msgid "Password &query string:"
msgstr "Cadeia de consulta da palavra passe:"
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
msgid "Create self extractin&g archive:"
msgstr "Criar arquivo de extracção automática:"
#: tfrmoptionsarchivers.lblarchivertest.caption
msgid "Tes&t:"
msgstr "Teste:"
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
msgid "Auto Configure"
msgstr "A&uto-configurar"
#: tfrmoptionsarchivers.miarchiverdisableall.caption
msgid "Disable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
msgid "Discard modifications"
msgstr ""
#: tfrmoptionsarchivers.miarchiverenableall.caption
msgid "Enable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverexport.caption
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
msgid "Export..."
msgstr "Exportar..."
#: tfrmoptionsarchivers.miarchiverimport.caption
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
msgid "Import..."
msgstr "Importar..."
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
msgid "Sort archivers"
msgstr ""
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
msgid "Additional"
msgstr "Adicional"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
msgid "General"
msgstr "Geral"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
msgid "When &size, date or attributes change"
msgstr "Quando tamanho, data ou atributo&s mudem"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Para os seguintes caminhos e suas sub-&pastas:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
msgid "When &files are created, deleted or renamed"
msgstr "Quando &ficheiros sejam criados, eliminados ou renomeados"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
msgid "When application is in the &background"
msgstr "Quando a aplicação está em 2º &plano"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
msgid "Disable auto-refresh"
msgstr "Desactivar actualização automática"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
msgid "Refresh file list"
msgstr "Actualizar lista de ficheiros"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
msgid "Al&ways show tray icon"
msgstr "Mos&trar sempre ícone de tabuleiro"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "&Ocultar automaticamente dispositivos não montados"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
msgid "Mo&ve icon to system tray when minimized"
msgstr "Mo&ver ícone para o tabuleiro de sistema ao minimizar"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
msgid "A&llow only one copy of DC at a time"
msgstr "&Permitir só uma instância do DC de cada vez"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Aqui pode inserir um ou mais dispositivos ou pontos de montagem, separados por \";\"."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Lista &negra de dispositivos"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Tamanho das colunas"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Mostrar extensões de ficheiro"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "Alin&hada (com Tab)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "Após o nome de fichei&ro"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Automático"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Total de colunas fixas"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Largura fixa"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "Cortar &texto na largura da coluna"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr "&Estender largura da célula se o texto não couber na coluna"
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "Linhas &horizontais"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "Linhas &verticais"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "Preencher automaticamente colunas"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Mostrar grelha"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Tamanho de coluna automático"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Tamanho de c&oluna automático:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "A&plicar"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "Histórico da linha de co&mandos"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
msgid "&Directory history"
msgstr "Histórico de &pastas"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "Histórico de máscaras de &ficheiros"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "Gra&var configuração"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "&Histórico de Localizar/Substituir"
#: tfrmoptionsconfiguration.gbdirectories.caption
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Pastas"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Localização dos ficheiros de configuração"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Gravar ao sair"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Ordem da configuração na árvore esquerda"
#: tfrmoptionsconfiguration.gpconfigurationtreestate.caption
msgid "Tree state when entering in configuration page"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Definir na linha de comandos"
#: tfrmoptionsconfiguration.lblhighlighters.caption
msgid "Highlighters:"
msgstr ""
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr "Temas de ícones:"
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr "Memória de miniaturas:"
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "Pasta do p&rograma (versão portátil)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "Pasta home do &utilizador"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Tudo"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr "Aplicar alteração a todas as colunas"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "&Eliminar"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Predefinições"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Novo"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "Seguinte"
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "Anterior"
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Renomear"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr "Repor predefinição"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Gravar como"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "Gravar"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Permitir cor sobreposta"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "Ao clicar para alterar algo, alterar em todas as colunas"
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "Geral"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Contorno do cursor"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Usar cursor vazio"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Usar cor de selecção inactiva"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Usar selecção invertida"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Usar letra e cor personalizadas nesta vista"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "Fundo:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Fundo 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Con&figurar vista de colunas:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Nome actual de coluna]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "Cor do cursor:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Texto do cursor:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Letra:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Tamanho:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "Cor do texto:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Cor do cursor inactivo:"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Cor de marca inactiva:"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "Cor de marca:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Abaixo está uma antevisão. Mova o cursor e seleccione ficheiros para ver imediatamente o aspecto das várias definições."
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Definições da coluna:"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Adicionar coluna"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Posição do painel após a comparação:"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr "Adicionar pasta da moldura &activa"
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr "A&dicionar pastas das molduras activas && inactivas"
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr "Adicionar pasta para onde vou na&vegar"
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr "Adicionar uma cópia da entrada seleccionada"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr "Adicionar &selecção actual ou pastas activas da moldura activa"
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Adicionar um separador"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr "Adicionar um sub-menu"
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr "Adicionar a pasta que vou digitar"
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Colapsar tudo"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr "Colapsar item"
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr "Cortar selecção de entradas"
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr "Eliminar tudo!"
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Eliminar o item seleccionado"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr "Eliminar sub-menu e todos os seus elementos"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr "Eliminar sub-menu mas manter os elementos"
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr "Expandir item"
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr "Focar janela da árvore"
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr "Ir para o 1º item"
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr "Ir para o último item"
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr "Ir para o item seguinte"
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr "Ir para o item anterior"
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr "Inserir pasta da moldura &activa"
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr "Inserir pastas &das molduras activa && inactiva"
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr "Inserir pasta para onde vou na&vegar"
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr "Inserir cópia da entrada seleccionada"
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr "Inserir pastas &selecção actual ou pastas activas da moldura activa"
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr "Inserir um separador"
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr "Inserir sub-menu"
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr "Inserir a pasta que vou digitar"
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr "Mover para seguinte"
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr "Mover para anterior"
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Abrir todos os ramos"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr "Colar o que foi cortado"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr "&Procurar && substituir no caminho"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr "Procurar && substituir no caminho e no destino"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr "Procurar && substituir no caminho des&tino"
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr "Afinar caminho"
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr "Afinar caminho destino"
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Adicionar..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Segurança..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Eliminar..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Exportar..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "Ajuda"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Importar..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Inserir..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "Diversos..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
msgid "Some functions to select appropriate path"
msgstr "Algumas funções para escolher o caminho apropriado"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
msgid "Some functions to select appropriate target"
msgstr "Algumas funções para escolher o destino apropriado"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Ordenar..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "Ao adicionar a pasta, adicionar também o destino"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Expandir sempre a árvore"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Mostrar só variáveis de ambiente válidas"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr "No balão, mostrar [o caminho]"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Nome, a-z"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
msgid "Name, a-z"
msgstr "Nome, a-z"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Lista de pastas (ordenar com arrastar/largar)"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Outras opções"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
msgid "Name:"
msgstr "Nome:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
msgid "Path:"
msgstr "Caminho:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
msgid "&Target:"
msgstr "Destino:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "...só nível actual de itens seleccionados"
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Analisar todos os caminhos de pastas para validar os que realmente existem"
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "Analisar todos os caminhos e destinos de pastas para validar os que realmente existem"
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "para um ficheiro de lista de pastas (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "to a \"wincmd.ini\" of TC (keep existing)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "num \"wincmd.ini\" de TC (eliminar existente)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Ir para a informação de configuração TC"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to &configure TC related info"
msgstr "Ir para a informação de configuração TC"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "Menu de teste HotDir"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "de um ficheiro de lista de pastas (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "de \"wincmd.ini\" de TC"
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr "&Navegar..."
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "Restaurar uma segurança de uma lista de pastas"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "Gravar uma segurança da actual lista de pastas"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Localizar e substituir..."
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...tudo, de A a Z!"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "... só um único grupo de itens!"
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "...conteúdo do sub-menu seleccionado, sem sub-níveis"
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "...conteúdo do sub-menu seleccionado, com sub-níveis"
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr "Testar menu resultante"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr "Afinar camin&ho"
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr "Afinar caminho des&tino"
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr "Adição do painel principal:"
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Entre todos os formatos suportados, perguntar sempre qual usar"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Ao gravar texto Unicode, gravar em formato UTF8 (senão grava em formato UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Ao largar texto, gerar nome de ficheiro automaticamente (senão pede ao utilizador)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Mo&strar diálogo de confirmação após largar"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Ao arrastar e largar texto nos painéis:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Pôr o formato mais desejado no topo da lista (usar arrastar/largar):"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(se o mais desejado não existir, será usado o segundo e assim por diante)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(não funcionará com algumas aplicações fonte, tente desmarcar se tiver problemas)"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Mostrar sistema de &ficheiros"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Mostrar &espaço livre"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Mostrar rótu&lo"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Lista de unidades"
#: tfrmoptionseditor.chkautoindent.caption
msgid "Auto Indent"
msgstr ""
#: tfrmoptionseditor.chkautoindent.hint
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
msgstr ""
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Cursor após o fim da linha"
#: tfrmoptionseditor.chkscrollpastendline.hint
msgid "Allows caret to go into empty space beyond end-of-line position"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Mostrar caracteres especiais"
#: tfrmoptionseditor.chkshowspecialchars.hint
msgid "Shows special characters for spaces and tabulations"
msgstr ""
#: tfrmoptionseditor.chksmarttabs.caption
msgid "Smart Tabs"
msgstr ""
#: tfrmoptionseditor.chksmarttabs.hint
msgid "When using <Tab> key, caret will go to the next non-space character of the previous line"
msgstr ""
#: tfrmoptionseditor.chktabindent.caption
msgid "Tab indents blocks"
msgstr ""
#: tfrmoptionseditor.chktabindent.hint
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.caption
msgid "Use spaces instead tab characters"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.hint
msgid "Converts tab characters to a specified number of space characters (when entering)"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.caption
msgid "Delete trailing spaces"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.hint
msgid "Auto delete trailing spaces, this applies only to edited lines"
msgstr ""
#: tfrmoptionseditor.edtabwidth.hint
msgctxt "tfrmoptionseditor.edtabwidth.hint"
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Opções internas do editor"
#: tfrmoptionseditor.lbltabwidth.caption
msgid "Tab width:"
msgstr ""
#: tfrmoptionseditor.lbltabwidth.hint
msgctxt "tfrmoptionseditor.lbltabwidth.hint"
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "F&undo"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "F&undo"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Repor"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
msgid "Save"
msgstr "Gravar"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Atributos de elemento"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "1º p&lano"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "1º p&lano"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "Marca de &texto"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Usar (e editar) definições de esquema &globais"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Usar definições de esquema &locais"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Negrito"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&verter"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Desl&igar"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "Li&gar"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Itálico"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&verter"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Desl&igar"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "Li&gar"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "&Rasurado"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&verter"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Desl&igar"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "Li&gar"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "&Sublinhado"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "In&verter"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "Desl&igar"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "Li&gar"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr "Adicionar..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr "Eliminar..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Importar/Exportar"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr "Inserir..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Renomear"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr "Ordenar..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Nada"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr "Expandir sempre a árvore"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Não"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Esquerda"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Direita"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Lista de separadores favoritos (ordenar com arrastar/largar)"
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr "Outras opções"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr "O que restaurar onde na entrada seleccionada:"
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Separadores existentes a manter:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Gravar histórico da pasta:"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr "Separadores gravados à esquerda a restaurar:"
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr "Separadores gravados à direita a restaurar:"
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr "um separador"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Adicionar separador"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr "sub-menu"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr "Adicionar sub-menu"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr "Colapsar tudo"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr "...só o nível actual de itens seleccionado"
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Cortar"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr "eliminar tudo!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr "sub-menu e todos os elementos"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr "só sub-menu, manter elementos"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr "item seleccionado"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr "Eliminar o item seleccionado"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr "Exportar selecção para ficheiro(s) .tab"
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr "Menu de tese de favoritos"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr "Importar ficheiro(s) .tab de acordo com a predefinição"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Importar ficheiro(s) .tab na posição seleccionada"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Importar ficheiro(s) .tab na posição seleccionada"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr "Importar ficheiro(s) .tab na posição seleccionada num sub-menu"
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Inserir separador"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Inserir sub-menu"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr "Abrir todos os ramos"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Colar"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Renomear"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr "...tudo, de A a Z!"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr "... só um único grupo de itens!"
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr "Ordenar só grupo único de itens"
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "...conteúdo do sub-menu seleccionado, sem sub-níveis"
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "...conteúdo do sub-menu seleccionado, com sub-níveis"
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr "Testar menu resultante"
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Adicionar"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "Add"
msgstr "&Adicionar"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "A&dicionar"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "C&lone"
msgstr "Clonar"
#: tfrmoptionsfileassoc.btncommands.hint
msgctxt "tfrmoptionsfileassoc.btncommands.hint"
msgid "Select your internal command"
msgstr "Seleccione o seu comando interno"
#: tfrmoptionsfileassoc.btndownact.caption
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "Do&wn"
msgstr "A&baixo"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edi&t"
msgstr "Editar"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Inserir"
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "&Insert"
msgstr "Inserir"
#: tfrmoptionsfileassoc.btnparametershelper.hint
msgctxt "tfrmoptionsfileassoc.btnparametershelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsfileassoc.btnrelativecommand.hint
msgctxt "tfrmoptionsfileassoc.btnrelativecommand.hint"
msgid "Some functions to select appropriate path"
msgstr "Funções para seleccionar o caminho correcto"
#: tfrmoptionsfileassoc.btnremoveact.caption
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
msgid "Remo&ve"
msgstr "Remo&ver"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
msgid "Re&move"
msgstr "Re&mover"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "&Remover"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "R&enomear"
#: tfrmoptionsfileassoc.btnstartpathpathhelper.hint
msgctxt "tfrmoptionsfileassoc.btnstartpathpathhelper.hint"
msgid "Some functions to select appropriate path"
msgstr "Funções para seleccionar o caminho correcto"
#: tfrmoptionsfileassoc.btnstartpathvarhelper.hint
msgctxt "tfrmoptionsfileassoc.btnstartpathvarhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "A&cima"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr "Caminho inicial do comando. Não usar aspas nesta cadeia."
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr "Nome da acção. Nunca é passado ao sistema, é só uma mnemónica escolhida por si e para si"
#: tfrmoptionsfileassoc.edtparams.hint
#, fuzzy
#| msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgid "Parameter to pass to the command. Long filename with spaces should be quoted (manually entering)."
msgstr "Parâmetro a passar ao comando. Usar aspas em nomes de ficheiro longos e com espaços."
#: tfrmoptionsfileassoc.fnecommand.hint
#, fuzzy
#| msgid "Command to execute. Long filename with space should be quoted."
msgid "Command to execute. Never quote this string."
msgstr "Comando a executar. Usar aspas em nomes de ficheiro longos e com espaços."
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description"
msgstr "Descrição da acção:"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Acções"
#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
msgid "Extensions"
msgstr "Extensões"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Pode ordenar com arrastar/largar"
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Tipos de ficheiro"
#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
msgid "Icon"
msgstr "Ícone"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Pode ordenar acções com arrastar/largar"
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Pode ordenar extensões com arrastar/largar"
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Pode ordenar tipos de ficheiro com arrastar/largar"
#: tfrmoptionsfileassoc.lblaction.caption
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
msgid "Action &name:"
msgstr "Nome:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "Command:"
msgstr "&Comando"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parâmetro&s:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Camin&ho inicial:"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Personalizado com..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Personalizado"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Editar"
#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
msgid "Open in Editor"
msgstr "Abrir no editor"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Editar com..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
msgid "Get output from command"
msgstr "Obter saída do comando"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Abrir no editor interno"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Abrir no visualizador interno"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Abrir"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Abrir com..."
#: tfrmoptionsfileassoc.mishell.caption
msgctxt "tfrmoptionsfileassoc.mishell.caption"
msgid "Run in terminal"
msgstr "Executar no terminal"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Ver"
#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
msgid "Open in Viewer"
msgstr "Abrir no visualizador"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Ver com..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Clique para alterar o ícone!"
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "Executar numa shell"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Menu contextual estendido"
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Configuração de associações de ficheiros"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr "Sugerir a adição da associação do ficheiro quando ainda não estiver incluída"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Ao aceder a associações de ficheiros, sugerir a adição do ficheiro actual se ainda não estiver incluído num tipo configurado"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "Executar no terminal e fechar"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "Executar no terminal e manter aberto"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Itens de opções estendidas:"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr "Mostrar diálogo de confirmação para:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Operação Cop&iar"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Operação &Eliminar"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr ""
"Eliminar para a reciclagem (\n"
"Shift rever&te esta definição)\n"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Operação &Eliminar para o lixo"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
msgid "D&rop readonly flag"
msgstr "La&rgar marca Só de leitura"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "Operação &Mover"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "&Comentários do processo com ficheiros/pastas"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Seleccionar nome de &ficheiro sem extensão ao renomear"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Mos&trar painel de selecção de separador no diálogo Copiar/Mover"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "Saltar erros de &operações de ficheiros e escrevê-los no diário"
#: tfrmoptionsfileoperations.cbverifychecksumconfirmation.caption
msgid "Verify checksum operation"
msgstr ""
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "A executar as operações"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Ambiente do utilizador"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "Tamanho do &buffer para operações de ficheiros (em KB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr "Tamanho do buffer para cálculo de &hash (em KB):"
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Mostrar progresso da operação &inicialmente em"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr "Estilo de renomeação automática de duplicados:"
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "&Número de passagens de limpeza:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Repor predefinição do DC"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Permitir cor sobreposta"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Usar &cursor vazio"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Usar indicador de &gradiente"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Usar cor de selecção inactiva"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "U&sar selecção invertida"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Contorno do cursor"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
msgid "Drive Free Space Indicator"
msgstr "Indicador de espaço livre na unidade"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "F&undo:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
msgid "Backg&round 2:"
msgstr "Fu&ndo 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
msgid "C&ursor Color:"
msgstr "Cor do c&ursor:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
msgid "Cursor Te&xt:"
msgstr "Te&xto do cursor:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Cor do cursor inactivo:"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Cor de marca inactiva:"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "Nível de &brilho do painel inactivo"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Cor de fun&do:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Cor de &1º plano:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
msgid "&Mark Color:"
msgstr "Cor da &marca:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "Abaixo está uma antevisão. Pode mover o cursor, seleccionar ficheiros e ver imediatamente o aspecto das várias definições."
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
msgid "T&ext Color:"
msgstr "Cor do t&exto"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr "Ao lançar uma procura de ficheiros, limpar o filtro de máscaras"
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgctxt "tfrmoptionsfilesearch.cbpartialnamesearch.caption"
msgid "&Search for part of file name"
msgstr "&Procurar parte do nome do ficheiro"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr "Mostrar barra de menu no \"Localizar ficheiros\""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgctxt "tfrmoptionsfilesearch.dbtextsearch.caption"
msgid "Text search in files"
msgstr "Procurar texto em ficheiros"
#: tfrmoptionsfilesearch.gbfilesearch.caption
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Procurar ficheiro"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr "Filtros actuais com botão \"Nova procura\":"
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgctxt "tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption"
msgid "Default search template:"
msgstr "Modelo de procura predefinido:"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgctxt "tfrmoptionsfilesearch.rbusemmapinsearch.caption"
msgid "Use memory mapping for search te&xt in files"
msgstr "Usar mapa de memória para procurar te&xto em ficheiros"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgctxt "tfrmoptionsfilesearch.rbusestreaminsearch.caption"
msgid "&Use stream for search text in files"
msgstr "&Usar corrente para procurar texto em ficheiros"
#: tfrmoptionsfilesviews.btnaddattribute.caption
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "&Adicionar"
#: tfrmoptionsfilesviews.btnattrshelp.caption
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "A&juda"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr "Permitir alterar para &pasta-mãe com duplo clique em área vazia da vista de ficheiro"
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "&Não carregar lista de ficheiros até um separador estar activo"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "Mostrar pastas entre parênteses rectos"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Rea&lçar ficheiros novos e actualizados"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Permitir &renomear no local com duplo clique num nome"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
msgid "Load &file list in separate thread"
msgstr "Carregar lista de &ficheiros em linha separada"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
msgid "Load icons af&ter file list"
msgstr "Carregar ícones depois da lis&ta de ficheiros"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
msgid "Show s&ystem and hidden files"
msgstr "Mostrar ficheiros ocultos e de s&istema"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Ao seleccionar ficheiros com a <BARRA DE ESPAÇO>, mover para o próximo ficheiro (tal como com <INSERT>)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr "Filtro estilo Windows ao marcar ficheiros (\"*.*\" também selecciona ficheiros sem extensão, etc.)"
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr "Usar filtro de atributo independente no diálogo de entrada da máscara"
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formatação"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr "Marcar/Desmarcar entradas"
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Ordem"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgid "Default attribute mask value to use:"
msgstr "Valor predefinido de máscara de atributo:"
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "S&ensibilidade a maiúsculas:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Formato incorrecto"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "Formato de &data e hora:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Formato do ta&manho de ficheiro:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "&Inserir novos ficheiros:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "A o&rdenar pastas:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "Método de &ordenação"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "&Mover ficheiros actualizados:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "A&dicionar"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "A&plicar"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "&Eliminar"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Modelo..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Cores de tipos de ficheiros (ordenar com arrastar && largar)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "A&tributos de categoria:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Cor de cate&goria"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
msgid "Category &mask:"
msgstr "&Máscara de categoria:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
msgid "Category &name:"
msgstr "&Nome de categoria:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "Letra da &consola"
#: tfrmoptionsfonts.lbleditorfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
msgid "&Editor font"
msgstr "Letra do &editor"
#: tfrmoptionsfonts.lbllogfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
msgid "&Log font"
msgstr "Letra do &diário"
#: tfrmoptionsfonts.lblmainfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
msgid "Main &font"
msgstr "&Letra do programa"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Letra do caminho"
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Letra dos resultados"
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
msgid "Viewer&Book Font"
msgstr "Letra do livro do vis&ualizador"
#: tfrmoptionsfonts.lblviewerfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
msgid "&Viewer font"
msgstr "Letra do visuali&zador"
#: tfrmoptionshotkeys.actaddhotkey.caption
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Adicionar atal&ho"
#: tfrmoptionshotkeys.actcopy.caption
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Copiar"
#: tfrmoptionshotkeys.actdelete.caption
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Eliminar"
#: tfrmoptionshotkeys.actdeletehotkey.caption
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "&Eliminar atalho"
#: tfrmoptionshotkeys.actedithotkey.caption
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "&Editar atalho"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr "Categoria seguinte"
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr "Fazer balão do menu relacionado com o ficheiro"
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr "Categoria anterior"
#: tfrmoptionshotkeys.actrename.caption
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Renomear"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr "Repor predefinição do DC"
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr "Gravar agora"
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr "Ordenar por nome do comando"
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr "Ordenar por atalhos (agrupado)"
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr "Ordenar por atalhos (um por linha)"
#: tfrmoptionshotkeys.lbfilter.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
msgid "&Filter"
msgstr "&Filtro"
#: tfrmoptionshotkeys.lblcategories.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION"
msgid "C&ategories:"
msgstr "C&ategorias:"
#: tfrmoptionshotkeys.lblcommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION"
msgid "Co&mmands:"
msgstr "Co&mandos:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
msgid "&Shortcut files:"
msgstr "Ficheiro&s de atalho:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr "O&rdem:"
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr "Categorias"
#: tfrmoptionshotkeys.micommands.caption
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Comando"
#: tfrmoptionshotkeys.miseparator1.caption
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr "Ordem"
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Para os seguintes caminhos e sub-&pastas:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Mostrar ícones para ações nos &menus"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr "Mostrar ícones nos botões"
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
msgid "Show o&verlay icons, e.g. for links"
msgstr "M&ostrar ícones sobrepostos, i.e. para ligações"
#: tfrmoptionsicons.chkshowhiddendimmed.caption
msgid "&Dimmed hidden files (slower)"
msgstr ""
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Desactivar ícones especiais"
#: tfrmoptionsicons.gbiconssize.caption
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
msgid " Icon size "
msgstr "Tamanho do ícone"
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr "Tema de ícones"
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr "Mostrar ícones"
#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
msgid " Show icons to the left of the filename "
msgstr "Mostrar ícones à esquerda do nome de ficheiro"
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr "Painel de discos:"
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr "Painel de ficheiros:"
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
msgid "A&ll"
msgstr "T&udo"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
msgid "All associated + &EXE/LNK (slow)"
msgstr "Todos os associados + &EXE/LNK (lento)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
msgid "&No icons"
msgstr "Sem íco&nes"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
msgid "Only &standard icons"
msgstr "Só ícone&s padrão"
#: tfrmoptionsignorelist.btnaddsel.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
msgid "A&dd selected names"
msgstr "A&dicionar nomes seleccionados"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
msgid "Add selected names with &full path"
msgstr "Adicionar n&omes seleccionados com caminho completo"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr "Algumas funções para escolher o caminho apropriado"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignorar (não mostrar) os ficheiros e pastas seguintes:"
#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
msgid "&Save in:"
msgstr "&Gravar em:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Setas es&querda e direita mudam a pasta (movimento tipo Lynx)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Dactilografia"
#: tfrmoptionskeyboard.lblalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
msgid "Alt+L&etters:"
msgstr "Alt+L&etras:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+Le&tras:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
msgid "&Letters:"
msgstr "&Letras:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
msgid "&Flat buttons"
msgstr "Botões p&lanos"
#: tfrmoptionslayout.cbflatinterface.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
msgid "Flat i&nterface"
msgstr "Ambiente pla&no"
#: tfrmoptionslayout.cbflattoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
msgid "Flat b&uttons"
msgstr "B&otões planos"
#: tfrmoptionslayout.cbfreespaceind.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
msgid "Show fr&ee space indicator on drive label"
msgstr "Mostrar &espaço livre no rótulo da unidade"
#: tfrmoptionslayout.cblogwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
msgid "Show lo&g window"
msgstr "Mostrar &janela de diário"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
msgid "Show panel of operation in background"
msgstr "Mostrar painel de operações em 2º plano"
#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
msgid "Show common progress in menu bar"
msgstr "Mostrar progresso comum na barra de menu"
#: tfrmoptionslayout.cbshowcmdline.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
msgid "Show command l&ine"
msgstr "Mostrar l&inha de comandos"
#: tfrmoptionslayout.cbshowcurdir.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
msgid "Show current director&y"
msgstr "Mostrar pasta act&ual"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
msgid "Show &drive buttons"
msgstr "Mostrar botões de uni&dade"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
msgid "Show free s&pace label"
msgstr "Mostrar rótulo de es&paço livre"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Mostrar bo&tão da lista de unidades"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
msgid "Show function &key buttons"
msgstr "Mostrar botões de teclas de função"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
msgid "Show &main menu"
msgstr "Mostrar &menu principal"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
msgid "Show tool&bar"
msgstr "Mostrar &barra de ferramentas"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Mostrar rótulo curto de espaço &livre"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
msgid "Show &status bar"
msgstr "Mostrar barra de e&stado"
#: tfrmoptionslayout.cbshowtabheader.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
msgid "S&how tabstop header"
msgstr "Mostrar cabeçalho de tabulação"
#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
msgid "Sho&w folder tabs"
msgstr "M&ostrar separadores de pasta"
#: tfrmoptionslayout.cbtermwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
msgid "Show te&rminal window"
msgstr "Mostrar janela de te&rminal"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Mostrar duas barras de botões de unidade (largura fi&xa, acima das janelas de ficheiros)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
msgid " Screen layout "
msgstr "Disposição do ecrã"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr "Algumas funções para escolher o caminho apropriado"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Ver conteúdo do diário"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Incluir data no nome do diário"
#: tfrmoptionslog.cblogarcop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
msgid "&Pack/Unpack"
msgstr "Com&primir/Descomprimir"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Execução externa da linha de comandos"
#: tfrmoptionslog.cblogcpmvln.caption
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
msgid "Cop&y/Move/Create link/symlink"
msgstr "Cop&iar/Mover/Criar ligação/Ligação simbólica"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "&Eliminar"
#: tfrmoptionslog.cblogdirop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
msgid "Crea&te/Delete directories"
msgstr "Criar/Eliminar pas&tas"
#: tfrmoptionslog.cblogerrors.caption
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
msgid "Log &errors"
msgstr "Diário de &erros"
#: tfrmoptionslog.cblogfile.caption
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
msgid "C&reate a log file:"
msgstr "C&riar um ficheiro de diário:"
#: tfrmoptionslog.cbloginfo.caption
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
msgid "Log &information messages"
msgstr "Diário de mensagens &informativas"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Iniciar/Encerrar"
#: tfrmoptionslog.cblogsuccess.caption
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
msgid "Log &successful operations"
msgstr "Registar operações com &sucesso"
#: tfrmoptionslog.cblogvfs.caption
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
msgid "&File system plugins"
msgstr "Extensões do sistema de &ficheiros"
#: tfrmoptionslog.gblogfile.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
msgid "File operation log file"
msgstr "Diário de operações de ficheiros"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Registar operações"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Estado da operação"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr "Algumas funções para escolher o caminho apropriado"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr "Algumas funções para escolher o caminho apropriado"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr "Algumas funções para escolher o caminho apropriado"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Remover miniaturas de ficheiros que já não existem"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr "Ver conteúdo do diário"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgid "Create new with the encoding:"
msgstr "Criar novo com codificação:"
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Ir sempre para a rai&z da unidade ao mudar de unidades"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION"
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Mostrar mensagens de a&viso (só botão \"Aceitar\")"
#: tfrmoptionsmisc.chkthumbsave.caption
msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION"
msgid "&Save thumbnails in cache"
msgstr "&Gravar miniaturas em memória"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Miniaturas"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr "Comentários (descript.ion)"
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "De exportação/importação TC:"
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgid "Default encoding:"
msgstr "Codificação predefinida:"
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Ficheiro de configuração:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "Executável TC:"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Caminho de saída da barra:"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "pixels"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Tamanho da miniatura:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Selecção com o rato"
#: tfrmoptionsmouse.chkcursornofollow.caption
msgid "The text cursor no longer follows the mouse cursor"
msgstr ""
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
msgid "By clic&king on icon"
msgstr ""
#: tfrmoptionsmouse.gbopenwith.caption
msgctxt "tfrmoptionsmouse.gbopenwith.caption"
msgid "Open with"
msgstr "Abrir com"
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Rolar"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Selecção"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Modo:"
#: tfrmoptionsmouse.rbdoubleclick.caption
msgid "Double click"
msgstr ""
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "&Linha a linha"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Linha a linha com mo&vimento do cursor"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Página a página"
#: tfrmoptionsmouse.rbsingleclickboth.caption
msgid "Single click (opens files and folders)"
msgstr ""
#: tfrmoptionsmouse.rbsingleclickfolders.caption
msgid "Single click (opens folders, double click for files)"
msgstr ""
#: tfrmoptionspluginsbase.btnaddplugin.caption
msgctxt "tfrmoptionspluginsbase.btnaddplugin.caption"
msgid "A&dd"
msgstr "A&dicionar"
#: tfrmoptionspluginsbase.btnconfigplugin.caption
msgctxt "tfrmoptionspluginsbase.btnconfigplugin.caption"
msgid "Con&figure"
msgstr "Con&figurar"
#: tfrmoptionspluginsbase.btnenableplugin.caption
msgctxt "tfrmoptionspluginsbase.btnenableplugin.caption"
msgid "E&nable"
msgstr "Ac&tivar"
#: tfrmoptionspluginsbase.btnremoveplugin.caption
msgctxt "tfrmoptionspluginsbase.btnremoveplugin.caption"
msgid "&Remove"
msgstr "&Remover"
#: tfrmoptionspluginsbase.btntweakplugin.caption
msgctxt "tfrmoptionspluginsbase.btntweakplugin.caption"
msgid "&Tweak"
msgstr "A&finar"
#: tfrmoptionspluginsbase.lblplugindescription.caption
msgctxt "tfrmoptionspluginsbase.lblplugindescription.caption"
msgid "Description"
msgstr "Descrição"
#: tfrmoptionspluginsbase.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Activo"
#: tfrmoptionspluginsbase.stgplugins.columns[1].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Extensão"
#: tfrmoptionspluginsbase.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Registado para"
#: tfrmoptionspluginsbase.stgplugins.columns[3].title.caption
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Nome de ficheiro"
#: tfrmoptionspluginsdsx.lblplugindescription.caption
msgctxt "tfrmoptionspluginsdsx.lblplugindescription.caption"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "E&xtensões de procura permitem usar algoritmos alternativos ou ferramentas externas (como \"locate\", etc.)"
#: tfrmoptionspluginsgroup.btnpathtoberelativetoall.caption
msgid "Apply current settings to all current configured plugins"
msgstr ""
#: tfrmoptionspluginsgroup.ckbautotweak.caption
msgid "When adding a new plugin, automatically go in tweak window"
msgstr ""
#: tfrmoptionspluginsgroup.gbconfiguration.caption
msgid "Configuration:"
msgstr ""
#: tfrmoptionspluginsgroup.lbpathtoberelativeto.caption
msgid "Path to be relative to:"
msgstr ""
#: tfrmoptionspluginsgroup.lbpluginfilenamestyle.caption
msgid "Plugin filename style when adding a new plugin:"
msgstr ""
#: tfrmoptionspluginswcx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswcx.lblplugindescription.caption"
msgid "Pack&er plugins are used to work with archives"
msgstr "&Extensões de compressão são usadas para trabalhar com arquivos"
#: tfrmoptionspluginswcx.stgplugins.columns[0].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Activo"
#: tfrmoptionspluginswcx.stgplugins.columns[1].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Extensão"
#: tfrmoptionspluginswcx.stgplugins.columns[2].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Registado para"
#: tfrmoptionspluginswcx.stgplugins.columns[3].title.caption
#, fuzzy
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Nome de ficheiro"
#: tfrmoptionspluginswdx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswdx.lblplugindescription.caption"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Extensões de conteúdo permitem mostrar detalhes do ficheiro, como etiquetas mp3 ou atributos de imagens na lista de ficheiros ou usá-los nas ferramentas Procura e Multi-renomear"
#: tfrmoptionspluginswfx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswfx.lblplugindescription.caption"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Extensões do sistema de ficheiros permitem gerir unidades inacessíveis pelo sistema operativo ou a dispositivos externos como o Palm/PocketPC."
#: tfrmoptionspluginswlx.lblplugindescription.caption
msgctxt "tfrmoptionspluginswlx.lblplugindescription.caption"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Extensões de &visualização permitem mostrar formatos de ficheiros como imagens, folhas de cálculo, bases de dados, etc. no visualizador (F3, Ctrl+Q)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
msgid "&Beginning (name must start with first typed character)"
msgstr "&Iniciar (o nome tem de começar com o primeiro carácter digitado)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "&Finalizar (o último carácter antes do ponto tem de coincidir)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Opções"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Correspondência exacta do nome"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Sensível a maiúsculas"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Procurar por estes itens"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Manter novo nome ao desbloquear separador"
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Activar &painel destino ao clicar num dos seus separadores"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
msgid "&Show tab header also when there is only one tab"
msgstr "Mo&strar cabeçalho do separador mesmo que só haja um"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Fechar separadores duplicados ao sair do programa"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
msgid "Con&firm close all tabs"
msgstr "Con&firmar fecho de todos os separadores"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Con&firmar fecho de separadores bloqueados"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
msgid "&Limit tab title length to"
msgstr "&Limitar comprimento do nome do separador a "
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
msgid "Show locked tabs &with an asterisk *"
msgstr "Mostrar separadores blo&queados com um asterisco *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
msgid "&Tabs on multiple lines"
msgstr "Separadores em múl&tiplas linhas"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&Acima abre o novo separador em 1º plano"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
msgid "Open &new tabs near current tab"
msgstr "Abrir &novos separadores ao lado do separador actual"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Reutilizar separador existente"
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
msgid "Show ta&b close button"
msgstr "Mostrar &botão de fecho do separador"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Mostrar sempre letra da unidade no título"
#: tfrmoptionstabs.gbtabs.caption
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
msgid "Folder tabs headers"
msgstr "Cabeçalhos dos separadores de pastas"
#: tfrmoptionstabs.lblchar.caption
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
msgid "characters"
msgstr "caracteres"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Acção do duplo clique num separador:"
#: tfrmoptionstabs.lbltabsposition.caption
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
msgid "Ta&bs position"
msgstr "Posição dos s&eparadores"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr "Nada"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Não"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr "Esquerda"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr "Direita"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr "Abrir configuração de separadores favorita após gravar"
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr "Abrir configuração de separadores favorita após gravar uma nova"
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr "Activar opções extra nos separadores favoritos (escolher lado ao restaurar, etc.)"
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr "Definições extra predefinidas ao gravar novos favoritos:"
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr "Pasta de separadores"
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr "Ao restaurar, separadores existentes a manter:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr "Separadores gravados à esquerda restauram-se para:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr "Separadores gravados à direita restauram-se para:"
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Manter histórico de pastas com separadores favoritos:"
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr "Posição no menu ao gravar novos separadores favoritos:"
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{comando} deveria estar aqui presente para reflectir o comando a executar no terminal"
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{comando} deveria estar aqui presente para reflectir o comando a executar no terminal"
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{comando} deveria estar aqui presente para reflectir o comando a executar no terminal"
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Comando para executar no terminal:"
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Comando para executar um comando no terminal e fechar a seguir:"
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Comando para executar um comando no terminal e ficar aberto:"
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Parâmetros:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Parâmetros:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Parâmetros:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "C&lonar botão"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "&Eliminar"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION"
msgid "Edit hot&key"
msgstr "Editar atal&ho"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION"
msgid "&Insert new button"
msgstr "&Inserir novo botão"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Seleccionar"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Outro..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION"
msgid "Remove hotke&y"
msgstr "Remo&ver atalho"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Sugerir"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr "Deixar o DC sugerir a dica baseado no tipo de botão, comando e parâmetros"
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "Botões p&lanos"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Reportar erros com comandos"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Inserir parâmetros de comandos, cada um em sua linha. Prima F1 para ajuda dos parâmetros"
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Aparência"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "Tamanho da &barra:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION"
msgid "Comman&d:"
msgstr "Coman&do:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parâmetro&s:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr "Ajuda"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Atalho:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Íco&ne"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Tamanho do í&cone:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "Co&mando:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "&Parâmetros:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Camin&ho inicial:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "Su&gestão:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "Adicionar barra com TODOS os comandos"
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "para um comando externo"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "para um comando interno"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "para um separador"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "para uma sub-barra"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr "Seguranças..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr "Exportar..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Barra actual..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "para um ficheiro de barra (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "para um ficheiro .BAR do TC (manter existente)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "para um ficheiro .BAR do TC (eliminar existente)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "para um \"wincmd.ini\" do TC (manter existente)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "para um \"wincmd.ini\" do TC (eliminar existente)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Barra de topo..."
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Gravar segurança da barra"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "para um ficheiro de barra (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "para um ficheiro .BAR do TC (manter existente)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "para um ficheiro .BAR do TC (eliminar existente)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "para um \"wincmd.ini\" do TC (manter existente)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "para um \"wincmd.ini\" do TC (eliminar existente)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "logo após a selecção actual"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr "como 1º elemento"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr "como último elemento"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "logo antes da selecção actual"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr "Importar..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Restaurar uma segurança da barra"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "para adicionar à barra actual"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "para adicionar a uma nova barra da barra actual"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "para adicionar a uma nova barra da barra de topo"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr "para adicionar à barra de topo"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr "para substituir a barra de topo"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "de um ficheiro de barra (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "para adicionar à barra actual"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "para adicionar a uma nova barra da barra actual"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "para adicionar a uma nova barra da barra de topo"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "para adicionar à barra de topo"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "para substituir a barra de topo"
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "de um ficheiro TC .BAR único"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "para adicionar à barra actual"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "para adicionar a uma nova barra da barra actual"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "para adicionar a uma nova barra da barra de topo"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "para adicionar à barra de topo"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "para substituir a barra de topo"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "de \"wincmd.ini\" do TC..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "para adicionar à barra actual"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "para adicionar a uma nova barra da barra actual"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "para adicionar a uma nova barra da barra de topo"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr "para adicionar à barra de topo"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr "para substituir a barra de topo"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "logo após a selecção actual"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr "como 1º elemento"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr "como último elemento"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "logo antes da selecção actual"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr "Procurar e substituir..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "logo após a selecção actual"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "como 1º elemento"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "como último elemento"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "logo antes da selecção actual"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "em todos dos acima..."
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "em todos os comandos..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "em todos os nomes de ícones..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "em odos os parâmetros..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "em todos os caminhos iniciais..."
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr "logo após a selecção actual"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr "como 1º elemento"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr "como último elemento"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr "logo antes da selecção actual"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Tipo de botão"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr "Algumas funções para escolher o caminho apropriado"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "Manter a janela do terminal aberta após executar o programa"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "&Executar no terminal"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "&Usar programa externo"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "Parâmetros a&dicionais"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "Caminho do &programa a executar"
#: tfrmoptionstooltips.btnaddtooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnaddtooltipsfiletype.caption"
msgid "A&dd"
msgstr "A&dicionar"
#: tfrmoptionstooltips.btnapplytooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnapplytooltipsfiletype.caption"
msgid "A&pply"
msgstr "A&plicar"
#: tfrmoptionstooltips.btncopytooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btncopytooltipsfiletype.caption"
msgid "Cop&y"
msgstr "Copiar"
#: tfrmoptionstooltips.btndeletetooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btndeletetooltipsfiletype.caption"
msgid "Delete"
msgstr "&Eliminar"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Modelo..."
#: tfrmoptionstooltips.btnrenametooltipsfiletype.caption
msgctxt "tfrmoptionstooltips.btnrenametooltipsfiletype.caption"
msgid "&Rename"
msgstr "&Renomear"
#: tfrmoptionstooltips.btntooltipother.caption
msgctxt "tfrmoptionstooltips.btntooltipother.caption"
msgid "Oth&er..."
msgstr "Outro..."
#: tfrmoptionstooltips.bvltooltips1.caption
msgid "Tooltip configuration for selected file type:"
msgstr ""
#: tfrmoptionstooltips.bvltooltips2.caption
msgid "General options about tooltips:"
msgstr ""
#: tfrmoptionstooltips.chkshowtooltip.caption
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
msgid "&Show tooltip for files in the file panel"
msgstr "Mostrar sugestão para ficheiros no painel"
#: tfrmoptionstooltips.lblfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Dica da cate&goria:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "&Máscara da categoria:"
#: tfrmoptionstooltips.lbltooltiphidingdelay.caption
msgid "Tooltip hiding delay:"
msgstr ""
#: tfrmoptionstooltips.lbltooltipshowingmode.caption
msgid "Tooltip showing mode:"
msgstr ""
#: tfrmoptionstooltips.lbltooltipslistbox.caption
msgid "&File types:"
msgstr ""
#: tfrmoptionstooltips.mitooltipsfiletypediscardmodification.caption
msgid "Discard Modifications"
msgstr ""
#: tfrmoptionstooltips.mitooltipsfiletypeexport.caption
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeexport.caption"
msgid "Export..."
msgstr "Exportar..."
#: tfrmoptionstooltips.mitooltipsfiletypeimport.caption
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeimport.caption"
msgid "Import..."
msgstr "Importar..."
#: tfrmoptionstooltips.mitooltipsfiletypesortfiletype.caption
msgid "Sort Tooltip File Types"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr "Com duplo clique na barra ao cimo do painel de ficheiros"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "Com o menu e comando interno"
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr "Duplo clique na árvore selecciona e sai"
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "Com o menu e comando interno"
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr "Com duplo clique num separador (se configurado para tal)"
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr "Ao usar o atalho de teclado, sai da janela devolvendo a escolha actual"
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr "Clique único na árvore selecciona e sai"
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr "Usar para histórico da linha de comandos"
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr "Usar para histórico de Dir"
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr "Usar para histórico de vistas (caminhos visitados na vista actual)"
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr "Comportamento relativo à selecção:"
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr "Opções relativas a menus da árvore:"
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr "Onde usar menus da árvore:"
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr "*NOTA: em relação a opções como a sensibilidade a maiúsculas, ignorar ou não os acentos, estas são gravadas e restauradas individualmente para cada contexto de uma utilização e sessão para outra."
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr "Com a lista de pastas quentes:"
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr "Com separadores favoritos:"
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr "Com histórico:"
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr "Usar e mostrar atalho de teclado para escolher itens"
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr "Opções de disposição e cores:"
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Cor de fundo:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Cor do cursor:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Cor do texto encontrado:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Texto encontrado sob o cursor:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Cor do texto normal:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Texto normal sob o cursor:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Antevisão do menu da árvore:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr "Cor de texto secundário:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr "Texto secundário sob o cursor:"
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Cor do atalho:"
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr "Atalho sob o cursor:"
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr "Cor de texto não seleccionável:"
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr "Texto não seleccionável sob o cursor:"
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr "Altere uma cor à esquerda e verá uma antevisão dos menus de árvore neste exemplo."
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Modo Livro de visualização"
#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
msgid "Example"
msgstr "Exemplo"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "Cor de &fundo do livro"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "Cor de te&xto do livro"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "&Nº de colunas do livro"
#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "Con&figurar"
#: tfrmpackdlg.caption
msgctxt "TFRMPACKDLG.CAPTION"
msgid "Pack files"
msgstr "Comprimir ficheiros"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Criar arquivos separados, um por cada ficheiro/pasta seleccionado"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Criar arquivo de extracção automática"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "Encr&iptar"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Mo&ver para arquivo"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "Arquivo de discos &múltiplos"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "Pôr no arq&uivo TAR primeiro"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Com&primir também nomes de caminhos (só recursivo)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Comprimir ficheiro(s) no ficheiro:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Compressor"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Fe&char"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Descomprimir todos e execut&ar"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "Descomprimir e exec&utar"
#: tfrmpackinfodlg.caption
msgctxt "TFRMPACKINFODLG.CAPTION"
msgid "Properties of packed file"
msgstr "Propriedades do ficheiro comprimido"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Atributos:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Taxa de compressão:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Data:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Método:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Tamanho original:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Ficheiro:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Tamanho comprimido:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Compressor:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Hora:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Fechar painel de filtragem"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Insira o texto de filtragem ou filtre por"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Sensível a maiúsculas"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "P"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Pastas"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Ficheiros"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Comparar início"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Comparar final"
#: tfrmquicksearch.tglfilter.caption
msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION"
msgid "Filter"
msgstr "Filtro"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Alternar entre procurar e filtrar"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "&Mais regras"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "M&enos regras"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Usar extensões de &conteúdo, combinar com:"
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Extensão"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Campo"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Operador"
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Valor"
#: tfrmsearchplugin.headercontrol.sections[4].text
msgid "Unit"
msgstr ""
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&E (tudo verdadeiro)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&OU (qualquer verdadeiro)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "Fe&char"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "A&juda"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "&Seleccionar os caracteres a inserir:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmsetfileproperties.caption
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
msgid "Change attributes"
msgstr "Alterar atributos"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Pegajoso"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "Arquivo"
#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Criado:"
#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "Oculto"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Acedido:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Modificado:"
#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "Só de leitura"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Incluindo sub-pastas"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "Sistema"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Propriedades do carimbo"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributos"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributos"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grupo"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(campo cinzento significa valor inalterado)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Outro"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Proprietário"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Texto:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Executar"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(campo cinzento significa valor inalterado)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Octal:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Ler"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Escrever"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr "Algumas funções para escolher o caminho apropriado"
#: tfrmsplitter.caption
msgctxt "TFRMSPLITTER.CAPTION"
msgid "Splitter"
msgstr "Divisor"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Requerer um ficheiro de verificação CRC32"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Nome de ficheiro"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Tamanho e nº. de partes"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "Pas&ta destino"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Ficheiro &origem"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "&Número de partes"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Bytes"
#: tfrmsplitter.rbtngigab.caption
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr "&Gigabytes"
#: tfrmsplitter.rbtnkilob.caption
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr "&Kilobytes"
#: tfrmsplitter.rbtnmegab.caption
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr "&Megabytes"
#: tfrmstartingsplash.caption
msgctxt "tfrmstartingsplash.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "tfrmstartingsplash.lblbuild.caption"
msgid "Build"
msgstr "Compilação"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Sistema operativo"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Plataforma"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "tfrmstartingsplash.lblrevision.caption"
msgid "Revision"
msgstr "Revisão"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "tfrmstartingsplash.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "tfrmstartingsplash.lblversion.caption"
msgid "Version"
msgstr "Versão"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr "WidgetsetVer"
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Criar ligação simbólica"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Destino para o qual a ligação aponta"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Nome da &ligação"
#: tfrmsyncdirsdlg.actselectclear.caption
msgid "Remove selection"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopydefault.caption
msgid "Select for copying (default direction)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
msgid "Select for copying -> (left to right)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
msgid "Reverse copy direction"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
msgid "Select for copying <- (right to left)"
msgstr ""
#: tfrmsyncdirsdlg.actselectdeleteright.caption
msgid "Select for deleting -> (right)"
msgstr ""
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
msgid "Close"
msgstr "Fechar"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
msgid "Compare"
msgstr "Comparar"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Sincronizar"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Sincronizar pastas"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "assimétrico"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "por conteúdo"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "ignorar data"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "só seleccionados"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Sub-pastas"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Mostrar:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Nome"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Tamanho"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Data"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Data"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Tamanho"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Nome"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(na janela principal)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Comparar"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Ver esquerdo"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Ver direito"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "duplicados"
#: tfrmsyncdirsdlg.sbequal.caption
msgctxt "tfrmsyncdirsdlg.sbequal.caption"
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgctxt "tfrmsyncdirsdlg.sbnotequal.caption"
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "únicos"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Clique em \"Comparar\" para iniciar"
#: tfrmsyncdirsperformdlg.caption
msgctxt "tfrmsyncdirsperformdlg.caption"
msgid "Synchronize"
msgstr "Sincronizar"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Confirmar sobrescrição"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Menu de árvore"
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr "Seleccione a sua pasta quente:"
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr "Procurar por maiúsculas"
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr "Colapso total"
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr "Expansão total"
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr "Procura ignorando acentos e ligações"
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr "Procura ignorando maiúsculas"
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr "Procurar exactamente por acentos e ligações"
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr "Não mostrar conteúdo do ramo \"só\" porque a cadeia procurada se encontra no nome do ramo"
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr "Se a cadeia procurada se encontrar num nome de ramo, mostrar todo o ramo, mesmo que os elementos não correspondam"
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr "Fechar menu da árvore"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr "Configuração do menu da árvore"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr "Configuração das cores do menu da árvore"
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "A&dicionar novo "
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "Al&terar"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Prede&finição"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceitar"
#: tfrmtweakplugin.btnrelativeplugin1.hint
msgctxt "tfrmtweakplugin.btnrelativeplugin1.hint"
msgid "Some functions to select appropriate path"
msgstr "Funções para seleccionar o caminho correcto"
#: tfrmtweakplugin.btnrelativeplugin2.hint
msgctxt "tfrmtweakplugin.btnrelativeplugin2.hint"
msgid "Some functions to select appropriate path"
msgstr "Funções para seleccionar o caminho correcto"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "&Remover"
#: tfrmtweakplugin.caption
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
msgid "Tweak plugin"
msgstr "Extensão de afinação"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "De&tectar tipo de arquivo por conteúdo"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Pode eliminar fi&cheiros"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Suporta e&ncriptação"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Mo&strar como ficheiros normais (ocultar ícone do compressor)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Suporta co&mpressão em memória"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Pode modificar arquivos existentes"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "O &arquivo pode conter múltiplos ficheiros"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Pode criar novos arqui&vos"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "S&uporta diálogo de opções"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Permitir procurar texto nos ar&quivos"
#: tfrmtweakplugin.lbldescription.caption
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "&Descrição:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "D&etectar cadeia:"
#: tfrmtweakplugin.lblextension.caption
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "&Extensão:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Bandeiras:"
#: tfrmtweakplugin.lblname.caption
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "&Nome:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "E&xtensão:"
#: tfrmtweakplugin.lblplugin2.caption
msgctxt "tfrmtweakplugin.lblplugin2.caption"
msgid "&Plugin:"
msgstr "Ex&tensão:"
#: tfrmviewer.actabout.caption
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
msgid "About Viewer..."
msgstr "Acerca do visualizador..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Mostra a mensagem Sobre"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr "Alterar codificação"
#: tfrmviewer.actcopyfile.caption
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
msgid "Copy File"
msgstr "Copiar ficheiro"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Copiar ficheiro"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Copiar para a memória"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr "Copiar formatado para a memória"
#: tfrmviewer.actdeletefile.caption
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
msgid "Delete File"
msgstr "Eliminar ficheiro"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Eliminar ficheiro"
#: tfrmviewer.actexitviewer.caption
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "&Sair"
#: tfrmviewer.actfind.caption
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Localizar"
#: tfrmviewer.actfindnext.caption
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Localizar seguinte"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr "Localizar anterior"
#: tfrmviewer.actfullscreen.caption
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Ecrã completo"
#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr "Centrar"
#: tfrmviewer.actloadnextfile.caption
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
msgid "&Next"
msgstr "Segui&nte"
#: tfrmviewer.actloadnextfile.hint
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT"
msgid "Load Next File"
msgstr "Carregar o ficheiro seguinte"
#: tfrmviewer.actloadprevfile.caption
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
msgid "&Previous"
msgstr "A&nterior"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Carregar o ficheiro anterior"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr "Espelhar na horizontal"
#: tfrmviewer.actmirrorhorz.hint
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr "Espelhar"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr "Espelhar na vertical"
#: tfrmviewer.actmovefile.caption
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
msgid "Move File"
msgstr "Mover ficheiro"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Mover ficheiro"
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Antever"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Recarregar"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Recarregar o ficheiro actual"
#: tfrmviewer.actrotate180.caption
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
msgid "+ 180"
msgstr "+ 180"
#: tfrmviewer.actrotate180.hint
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
msgid "Rotate 180 degrees"
msgstr "Rodar 180 graus"
#: tfrmviewer.actrotate270.caption
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
msgid "- 90"
msgstr "- 90"
#: tfrmviewer.actrotate270.hint
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
msgid "Rotate -90 degrees"
msgstr "Rodar -90 graus"
#: tfrmviewer.actrotate90.caption
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
msgid "+ 90"
msgstr "+ 90"
#: tfrmviewer.actrotate90.hint
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
msgid "Rotate +90 degrees"
msgstr "Rodar 90 graus"
#: tfrmviewer.actsave.caption
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Gravar"
#: tfrmviewer.actsaveas.caption
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
msgid "Save As..."
msgstr "Gravar como..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Gravar ficheiro como..."
#: tfrmviewer.actscreenshot.caption
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Captura de ecrã"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "Atrasar 3 seg"
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "Atrasar 5 seg"
#: tfrmviewer.actselectall.caption
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Seleccionar tudo"
#: tfrmviewer.actshowasbin.caption
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "Mostrar como &bin"
#: tfrmviewer.actshowasbook.caption
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "Mostrar como livr&o"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr "Mostrar como &dec"
#: tfrmviewer.actshowashex.caption
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "Mostrar como &hex"
#: tfrmviewer.actshowastext.caption
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "Mostrar como &texto"
#: tfrmviewer.actshowaswraptext.caption
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "Mostrar como texto aj&ustado"
#: tfrmviewer.actshowgraphics.caption
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Gráficos"
#: tfrmviewer.actshowplugins.caption
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Extensões"
#: tfrmviewer.actstretchimage.caption
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
msgid "Stretch"
msgstr "Esticar"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Esticar a imagem"
#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr "Esticar só grandes"
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Ampliação"
#: tfrmviewer.actzoomin.caption
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Ampliar"
#: tfrmviewer.actzoomout.caption
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Reduzir"
#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Recortar"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Ecrã completo"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Realçar"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Pintar"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Olhos vermelhos"
#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Redimensionar"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Desfazer"
#: tfrmviewer.caption
msgctxt "TFRMVIEWER.CAPTION"
msgid "Viewer"
msgstr "Visualizador"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Diaporama"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Caneta"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Realçar"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Pintar"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Diaporama"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Ver"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "Sobre"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codificar"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Ficheiro"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Imagem"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Imprimir..."
#: tfrmviewer.mirotate.caption
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
msgid "Rotate"
msgstr "Rodar"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Captura de ecrã"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Ver"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Seleccionar tudo"
#: tfrmviewoperations.btnstartpause.caption
#, fuzzy
msgctxt "tfrmviewoperations.btnstartpause.caption"
msgid "&Start"
msgstr "&Iniciar"
#: tfrmviewoperations.btnstop.caption
msgid "S&top"
msgstr ""
#: tfrmviewoperations.caption
#, fuzzy
msgctxt "tfrmviewoperations.caption"
msgid "File operations"
msgstr "Operações de ficheiros"
#: tfrmviewoperations.cbalwaysontop.caption
msgid "Always on top"
msgstr ""
#: tfrmviewoperations.lblusedragdrop.caption
msgid "&Use \"drag && drop\" to move operations between queues"
msgstr ""
#: tfrmviewoperations.mnucanceloperation.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmviewoperations.mnucancelqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmviewoperations.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnunewqueue.caption"
msgid "New queue"
msgstr "Nova fila"
#: tfrmviewoperations.mnuoperationshowdetached.caption
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.mnuputfirstinqueue.caption
msgid "Put first in queue"
msgstr ""
#: tfrmviewoperations.mnuputlastinqueue.caption
msgid "Put last in queue"
msgstr ""
#: tfrmviewoperations.mnuqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue.caption"
msgid "Queue"
msgstr "Fila"
#: tfrmviewoperations.mnuqueue0.caption
msgid "Out of queue"
msgstr ""
#: tfrmviewoperations.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Fila 1"
#: tfrmviewoperations.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Fila 2"
#: tfrmviewoperations.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Fila 3"
#: tfrmviewoperations.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Fila 4"
#: tfrmviewoperations.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Fila 5"
#: tfrmviewoperations.mnuqueueshowdetached.caption
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.tbpauseall.caption
msgid "&Pause all"
msgstr ""
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Quando o ficheiro existir"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Quando o ficheiro existir"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Copiar d&ata/hora"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Trabalhar em 2º plano (ligação separada)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Quando o ficheiro existir"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr "Data"
#: uexifreader.rsimageheight
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Altura"
#: uexifreader.rsimagewidth
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Largura"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr "Fabricante"
#: uexifreader.rsmodel
msgid "Camera model"
msgstr "Modelo da câmara"
#: uexifreader.rsorientation
msgid "Orientation"
msgstr "Orientação"
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
"Impossível encontrar o ficheiro que poderia ajudar a validar a combinação final:\n"
"%s\n"
"\n"
"Pode disponibilizá-lo e clicar em \"Aceitar\", por favor?\n"
"Ou clique em \"Cancelar\" para continuar.\n"
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Cancelar filtro rápido"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Cancelar operação actual"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Insira o nome do ficheiro com extensão, para texto largado"
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Formato de teto a importar"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Qebrado:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Geral:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Em falta:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Erro de leitura:"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Sucesso:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Insira a checksum e escolha o algoritmo:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Verificar checksum"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Total:"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr "Quer limpar os filtros para esta nova procura?"
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Área de transferência sem dados de barra de ferramentas válidos."
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr "Tudo;Painel activo;Painel esquerdo;Painel direito;Operações de ficheiro;Configuração;Rede;Diversos;Porta paralela;Imprimir;Marcar;Segurança;Área de transferência;FTP;Navegação;Ajuda;Janela;Linha de comandos;Ferramentas;Ver;Utilizador;Separadores;Ordenar;Diário"
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr "Ordem antiga;A -> Z"
#: ulng.rscolattr
msgid "Attr"
msgstr "Atr"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Data"
#: ulng.rscolext
msgid "Ext"
msgstr "Ext"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Nome"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Tamanho"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Alinhar"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Legenda"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Eliminar"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Conteúdo do campo"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Mover"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Largura"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Personalizar coluna"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Configurar associação de ficheiro"
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "A comfirmar comando e parâmetros"
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Copiar (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Barra DC importada"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Barra TC importada"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "_TextoLargado"
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "_TextoHTMLLargado"
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "_RichTextLargado"
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "_TextoSimplesLargado"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "_TextoUTF16Largado"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "_TextoUTF8Largado"
#: ulng.rsdiffadds
msgid " Adds: "
msgstr "Adiciona: "
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr "Elimina: "
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "Os ficheiros são idênticos!"
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr "Compara: "
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr "Modifica: "
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Ab&ortar"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "T&udo"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "Jun&tar"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "A&uto-renomear ficheiros fonte"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Cancelar"
#: ulng.rsdlgbuttoncompare
msgid "Compare &by content"
msgstr ""
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Continuar"
#: ulng.rsdlgbuttoncopyinto
msgid "&Merge"
msgstr "&Unir"
#: ulng.rsdlgbuttoncopyintoall
msgid "Mer&ge All"
msgstr "U&nir todos"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "&Sair do programa"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr "Ig&norar"
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "I&gnorar todos"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Não"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "N&enhum"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&Aceitar"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "&Outro"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "S&obrescrever"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "&Sobrescrever todos"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Sobrescrever os &maiores"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Sobrescrever mais an&tigos"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Sobrescrever m&enores"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "R&enomear"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Recomeçar"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Repe&tir"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr "Como ad&ministrador"
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Saltar"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Sa&ltar todos"
#: ulng.rsdlgbuttonunlock
msgid "&Unlock"
msgstr ""
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "S&im"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Copiar ficheiro(s)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Mover ficheiro(s)"
#: ulng.rsdlgoppause
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "Pau&sa"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&Iniciar"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Fila"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Velocidade %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Velocidade %s/s, falta %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr "Rich Text Format;Formato HTML;Formato Unicode;Formato de texto simples"
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<sem rótulo>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<sem suporte>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Editor interno do Double Commander."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Ir para linha:"
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr "Ir para linha"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "novo.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Nome de ficheiro:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Abrir ficheiro"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Recuar"
#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Procurar"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "&Avançar"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Substituir"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "com editor externo"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "com editor interno"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Executar via shell"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Executar via terminal e fechar"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Executar via terminal e manter aberto"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Esquerdo;Direito;Activo;Inactivo;Ambos;Nenhum"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Não;Sim"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Exportado_Do_DC"
#: ulng.rsfileopcopymovefileexistsoptions
msgid "Ask;Overwrite;Skip"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
msgid "Ask;Merge;Skip"
msgstr "Perguntar;Unir;Saltar"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Perguntar;Sobrescrever;Sobrescrever mais antigos;Saltar"
#: ulng.rsfileopsetpropertyerroroptions
msgctxt "ulng.rsfileopsetpropertyerroroptions"
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Perguntar;Não definir mais;Ignorar erros"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "FILTRO"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Definir modelo"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s nível(is)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "todos (profundidade ilimitada)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "só pasta actual"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "A pasta %s não existe!"
#: ulng.rsfindfound
msgctxt "ulng.rsfindfound"
msgid "Found: %d"
msgstr "Encontrados: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Gravar modelo de procura"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Nome do modelo:"
#: ulng.rsfindscanned
msgctxt "ulng.rsfindscanned"
msgid "Scanned: %d"
msgstr "Pesquisado: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "A pesquisar"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Localizar ficheiros"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Hora da digitalização: "
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Iniciar em"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Livres %s de %s bytes"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s bytes livres"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Aceder a data/hora"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Atributos"
#: ulng.rsfunccomment
msgctxt "ulng.rsfunccomment"
msgid "Comment"
msgstr "Comentário"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Tamanho comprimido"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Data/hora de criação"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Extensão"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Grupo"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Alterar data/hora"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Ligar a"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Data/hora de modificação"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Nome"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Nome sem extensão"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Proprietário"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Caminho"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Tamanho"
#: ulng.rsfunctype
msgid "Type"
msgstr "Tipo"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Erro ao criar ligação física"
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "Nenhuma;Nome, a-z;Nome, z-a;Ext, a-z;Ext, z-a;Tam 9-0;Tam 0-9;Data 9-0;Data 0-9"
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"Aviso! Ao restaurar uma segurança .hotlist, a lista existente será apagada pela importada.\n"
"\n"
"Tem a certeza que quer continuar?\n"
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Diálogo Copiar/Mover"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Diferenciar"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Diálogo Editar comentário"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Localizar ficheiros"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Principal"
#: ulng.rshotkeycategorysyncdirs
msgid "Synchronize Directories"
msgstr ""
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Visualizador"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
"Já existe uma configuração com esse nome.\n"
"Deseja sobrescrevê-la?\n"
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr "Tem a certeza de que deseja repor a predefinição?"
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr "Tem a certeza de que deseja apagar a configuração \"%s\"?"
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr "Cópia de %s"
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr "Insira o seu novo nome"
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr "Tem de ter pelo menos um ficheiro de atalhos."
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr "Novo nome"
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
"A configuração \"%s\" foi modificada.\n"
"Deseja gravá-la agora?\n"
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr "Sem atalho com \"ENTER\""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr "Por nome de comando;Por tecla de atalho (agrupado);Por tecla de atalho (um por linha)"
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "Impossível encontrar referências ao ficheiro predefinido"
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr "Lista de janelas \"Localizar ficheiros\""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Desseleccionar máscara"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Seleccionar máscara"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Máscara de entrada:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Já existe uma vista em colunas com esse nome."
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr "Para alterar edição da vista em colunas actual, GRAVE, COPIE ou ELIMINE a edição actual"
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Configurar colunas personalizadas"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Insira o novo nome das colunas"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Acções"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr "Copiar nomes com caminho UNC"
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Desligar unidade de rede..."
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Editar"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Ejectar"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Extrair aqui..."
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Mapear unidade de rede..."
#: ulng.rsmnumount
msgid "Mount"
msgstr "Montar"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Novo"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Sem suporte disponível"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Abrir"
#: ulng.rsmnuopenwith
msgctxt "ulng.rsmnuopenwith"
msgid "Open with"
msgstr "Abrir com"
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Outro..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Comprimir aqui..."
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Ordenar por"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Desmontar"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Ver"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Conta:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr "Todos os comandos internos do Double Commander"
#: ulng.rsmsgapplicationname
msgid "Description: %s"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Parâmetros adicionais da linha de comandos do arquivador:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr "Deseja pôr entre aspas?"
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"CRC32 errado no ficheiro resultante:\n"
"\"%s\"\n"
"\n"
"Quer manter o ficheiro resultante corrompido?\n"
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Não pode copiar/mover um ficheiro \"%s\" para si próprio!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Impossível eliminar a pasta %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr "Impossível sobrescrever a pasta \"%s\" com a não-pasta \"%s\""
#: ulng.rsmsgchdirfailed
msgid "Change current directory to \"%s\" failed!"
msgstr "ChDir para [%s] falhou!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Remover os separadores inactivos?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Este separador (%s) está bloqueado! Fechar mesmo assim?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr "Confirmação do parâmetro"
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Tem a certeza que quer sair?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "O ficheiro %s foi alterado. Quer repor a cópia anterior?"
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "Impossível repor a cópia anterior - quer manter o ficheiro alterado?"
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Copiar %d ficheiros/pastas seleccionados?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Copiar \"%s\" seleccionados?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Criar novo tipo de ficheiro \"ficheiros %s\" >"
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Insira caminho e nome do ficheiro para gravar a barra do DC"
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Acção personalizada"
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Eliminar o ficheiro parcialmente copiado?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Eliminar %d ficheiros/pastas seleccionados?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Eliminar %d ficheiros/pastas seleccionados para o lixo?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Eliminar \"%s\" seleccionado?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Eliminar \"%s\" seleccionados para o lixo?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Impossível mover \"%s\" para o lixo! Eliminar directamente?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "O disco não está disponível"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr "Insira o nome da acção:"
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Insira a extensão do ficheiro:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Insira o nome:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Insira o nome do novo tipo de ficheiro para a extensão \"%s\""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Erro CRC nos dados arquivados"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Os dados estão mal"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Impossível ligar ao servidor: \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Impossível copiar o ficheiro %s para %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Já existe uma pasta chamada \"%s\"."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Data %s não é suportada"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "A pasta %s já existe!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Função abortada pelo utilizador"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Erro ao fechar o ficheiro"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Impossível criar o ficheiro"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Não há mais ficheiros no arquivo"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Impossível abrir ficheiro existente"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Erro ao ler o ficheiro"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Erro ao escrever o ficheiro"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Impossível criar a pasta %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Ligação inválida"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Ficheiros não encontrados"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Memória insuficiente"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Função não suportada!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Erro no comando do menu contextual"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Erro ao carregar a configuração"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Erro de sintaxe na expressão regular!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Impossível renomear o ficheiro %s para %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Impossível gravar associação!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Impossível gravar o ficheiro"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Impossível definir atributos para \"%s\""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Impossível definir data/hora para \"%s\""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Impossível definir proprietário/grupo para \"%s\""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "Impossível definir permissões para \"%s\""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Buffer demasiado pequeno"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Demasiados ficheiros para empacotar"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Formato de arquivo desconhecido"
#: ulng.rsmsgexecutablepath
msgid "Executable: %s"
msgstr ""
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "Tem a certeza qie quer remover todas as entradas dos seus separadores favoritos? Não poderá desfazer a acção!"
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Arraste para aqui outras entradas"
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name for this new Favorite Tabs entry:"
msgstr "Insira um nome para esta entrada"
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "A gravar a nova entrada nos favoritos"
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Nº de separadores favoritos exportados com êxito: %d de %d"
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr "Predefinição extra para gravar histórico nos novos separadores favoritos:"
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Número de ficheiros importados com êxito: %d de %d"
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Separadores antigos importados"
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr "Escolha o ficheiro .tab a importar (podem ser vários em simultâneo)!"
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr "A última modificação aos favoritos ainda não foi gravada. Quer gravá-la antes de continuar?"
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Continuar a gravar o histórico com os favoritos:"
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Nome do sub-menu"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "Assim vai carregar o favorito: \"%s\""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr "Gravar separadores actuais sobre uma entrada de favoritos existente"
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "O ficheiro %s foi alterado! Gravar?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s bytes, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Sobrescrever:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "O ficheiro %s já existe! Sobrescrever?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Pelo ficheiro:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Ficheiro \"%s\" não encontrado"
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Operações de ficheiro activas"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Há algumas operações de ficheiro por terminar. Fechar o Double Commander pode resultar em perda de dados."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
"O tamanho no nome destino (%d) tem mais de %d caracteres!\n"
"%s\n"
"A maioria dos programas não poderá aceder a ficheiros/pastas com nomes tao grandes!\n"
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "O ficheiro %s é só de leitura(oculto/de sistema. Eliminá-lo?"
#: ulng.rsmsgfilereloadwarning
msgid "Are you sure you want to reload the current file and lose the changes?"
msgstr ""
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "O tamanho de \"%s\" é demasiado grande para o sistema de ficheiros destino!"
#: ulng.rsmsgfolderexistsrwrt
msgid "Folder %s exists, merge?"
msgstr "A pasta %s já existe! Unir?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Seguir ligação simbólica \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Seleccione o formato de texto a importar"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Adicionar %d pastas seleccionadas"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Adicionar pasta seleccionada: "
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Adicionar pasta atual: "
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Comando"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_algo"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Configuração da lista de pastas"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Tem a certeza que quer remover todas as entradas da sua lista de pastas? Não poderá desfazer a acção!"
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Assim vai executar o seguinte comando:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "Esta é a pasta chamada "
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Assim vai alterar o painel activo para o seguinte caminho:"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "E o painel inactivo mudará para o seguinte caminho:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Erro na segurança das entradas..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Erro ao exportar entradas..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Exportar tudo!"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Exportar lista de pastas - escolha as entradas que quer exportar"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Exportar escolhidas"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Importar tudo!"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Importar lista de pastas - escolha as entradas que quer importar"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Importar escolhidas"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Caminho"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Localizar ficheiro .hotlist a importar"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Noma da lista"
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Nº de novas entradas : %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "Nada escolhido para exportar!"
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Caminho da lista"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Adicionar de novo a pasta escolhida: "
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Adicionar de novo a pasta actual: "
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Insira a localização e nome da lista de pastas a restaurar"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Comando:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(fim do sub-menu)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Nome do menu:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Nome:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(separador)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Nome do sub-menu"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Alvo da lista de pastas"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Determine se quer que o painel activo seja ordenado de forma especificada após alterar a pasta"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Determine se quer que o painel inactivo seja ordenado de forma especificada após alterar a pasta"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Algumas funções para seleccionar caminho relativo, absoluto, pastas especiais, etc."
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Nº de entradas gravadas: %d\n"
"\n"
"Nome da segurança: %s\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Nº de entradas exportadas: "
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"Quer eliminar todos os elementos do sub-menu [%s]?\n"
"Responder NÃO elimina só os delimitadores de menu e mantém os elementos no sub-menu.\n"
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Insira a localização e nome da lista de pastas a gravar"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Tamanho do ficheiro \"%s\" resultante incorrecto"
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Por favor, insira o volume seguinte.\n"
"\n"
"É para permitir escrever este ficheiro:\n"
"\"%s\"\n"
"\n"
"Nº de bytes ainda por escrever: %d\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Erro na linha de comandos"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Nome de ficheiro inválido"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Formato do ficheiro de configuração inválido"
#: ulng.rsmsginvalidhexnumber
msgid "Invalid hexadecimal number: \"%s\""
msgstr ""
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Caminho inválido"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "O caminho %s contém caracteres proibidos."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Esta não é uma extensão válida!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Esta extensão é feita para o Double Commander para %s.%s, não pode trabalhar com o Double Commander para %s!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Aspas inválidas"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Selecção inválida."
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "A carregar lista de ficheiros..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr "Localizar ficheiro do TC (wincmd.ini)"
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "Localizar executável do TC (totalcmd.exe ou totalcmd64.exe)"
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Copiar ficheiro %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Eliminar ficheiro %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Erro: "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr "Iniciar externo"
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr "Resultado externo"
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Extrair ficheiro %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Informação:"
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Criar ligação %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Criar pasta %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Mover ficheiro %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Comprimir para ficheiro %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Remover pasta %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Feito:"
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Criar ligação simbólica %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Testar integridade do ficheiro %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Limpar ficheiro %s"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Limpar pasta %s"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Senha mestra"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Por favor insira a senha mestra:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Novo ficheiro"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "O próximo volume será descomprimido"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Sem ficheiros"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Sem ficheiros seleccionados"
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Não há espaço suficiente no destino! Continuar?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Não há espaço suficiente no destino! Tentar novamente?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Impossível eliminar o ficheiro %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Não implementado."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr "O objecto não existe!"
#: ulng.rsmsgopeninanotherprogram
msgid "The action cannot be completed because the file is open in another program:"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Abaixo está uma antevisão. Mova o cursor e seleccione ficheiros para ver imediatament o aspecto das várias definições."
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Senha:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "As senhas são diferentes!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Por favor, insira a senha:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Senha (Firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Por favor reinsira a senha para verificação:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Eliminar %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Predefinição \"%s\" já existe! Substituir?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Problema ao executar o comando (%s)"
#: ulng.rsmsgprocessid
msgid "PID: %d"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Nome de ficheiro para o texto:"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Por favor, disponibilize este ficheiro. Tentar novamente?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Insira novo nome amigável para estes favoritos"
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Insira novo nome para este menu"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Renomear/Mover %d ficheiros/pastas seleccionados?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Renomear/Mover \"%s\" seleccionados?"
#: ulng.rsmsgreplacethistext
msgid "Do you want to replace this text?"
msgstr ""
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Por favor, reinicie o Double Commander para aplicar as alterações"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Seleccione a que tipo de ficheiro adicionar a extensão \"%s\""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Seleccionados: %s de %s, ficheiros: %d de %d, pastas: %d de %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Seleccione executável para"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Por favor, seleccione só ficheiros checksum"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Por favor, seleccione a localização do próximo volume"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Definir rótulo do volume"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Pastas especiais"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Adicionar caminho do painel activo"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Adicionar caminho do painel inactivo"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Procurar e usar caminho seleccionado"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Usar variável de ambiente..."
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Ir para caminho especial do Double Commander..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Ir para variável de ambiente..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Ir para outra pasta especial do Windows..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Ir para pasta especial do Windows (TC)..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Tornar relativa ao caminho da lista"
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Tornar caminho absoluto"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Tornar relativo ao caminho especial do Double Commander..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Tornar relativo a variável de ambiente..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Tornar relativo a pasta especial do Windows (TC)..."
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Tornar relativo a outra pasta especial do Windows..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Usar caminho especial do Double Commander..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr "Usar caminho da lista"
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Usar outra pasta especial do Windows..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Usar pasta especial do Windows (TC)..."
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr "Este separador (%s) está bloqueado! Abrir pasta noutro separador?"
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Renomear separador"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Novo nome do separador:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Caminho destino:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Erro! impossível modificar a pasta de configuração do TC:\n"
"%s\n"
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Erro! impossível encontrar o executável de configuração do TC:\n"
"%s\n"
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Erro! O TC ainda está em execução mas tem de ser fechado para esta operação.\n"
"Feche-o e clique em Aceitar ou clique em Cancelar.\n"
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Erro! impossível encontrar a pasta de saída da barra do TC:\n"
"%s\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Insira localização e nome do ficheiro onde gravar a barra do TC"
#: ulng.rsmsgterminateprocess
msgid "WARNING: Terminating a process can cause undesired results including loss of data and system instability. The process will not be given the chance to save its state or data before it is terminated. Are you sure you want to terminate the process?"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr "\"%s\" está agora na área de transferência"
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr "A extensão do ficheiro seleccionado não é de tipo reconhecido"
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Localize o ficheiro \".toolbar\" a importar"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Localize o ficheiro \".BAR\" a importar"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Insira localização e nome do ficheiro a restaurar"
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Gravado!\n"
"Nome do ficheiro: %s\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Demasiados ficheiros seleccionados."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Indeterminado"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr "ERRO: utilização de menu de árvore inesperada!"
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "<SEM EXT>"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr ">SEM NOME>"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Utilizador:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Utilizador (Firewall):"
#: ulng.rsmsgverify
msgid "VERIFICATION:"
msgstr ""
#: ulng.rsmsgverifychecksum
msgid "Do you want to verify selected checksums?"
msgstr ""
#: ulng.rsmsgverifywrong
msgid "The target file is corrupted, checksum mismatch!"
msgstr ""
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Rótulo do volume:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Por favor, insira o tamanho do volume:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Limpar %d ficheiros/pastas seleccionados?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Limpar \"%s\" seleccionados?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "com"
#: ulng.rsmsgwrongpasswordtryagain
msgid ""
"Wrong password!\n"
"Please try again!\n"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr "Renomear automaticamente \"nome (1).ext\", \"nome (2).ext\" etc.?"
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Sem alteração;MAIÚSCULAS;minúsculas;Primeira maiúscula;Primeira De Todas As Palavras Maiúscula;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr "Aviso, nomes duplicados!"
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr "Nº de linhas errado no ficheiro: %d, deveria ser %d!"
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr "Manter;Limpar;Perguntar"
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr "Sem comando interno equivalente"
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr "Desculpe, ainda não há \"Localizar ficheiros\"..."
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr "Desculpe, não há mais \"Localizar ficheiros\" para fechar e libertar memória..."
#: ulng.rsopenwithdevelopment
msgid "Development"
msgstr ""
#: ulng.rsopenwitheducation
msgid "Education"
msgstr ""
#: ulng.rsopenwithgames
msgid "Games"
msgstr ""
#: ulng.rsopenwithgraphics
#, fuzzy
msgctxt "ulng.rsopenwithgraphics"
msgid "Graphics"
msgstr "Gráficos"
#: ulng.rsopenwithmultimedia
msgid "Multimedia"
msgstr ""
#: ulng.rsopenwithnetwork
#, fuzzy
msgctxt "ulng.rsopenwithnetwork"
msgid "Network"
msgstr "Rede"
#: ulng.rsopenwithoffice
msgid "Office"
msgstr ""
#: ulng.rsopenwithother
#, fuzzy
msgctxt "ulng.rsopenwithother"
msgid "Other"
msgstr "Outro"
#: ulng.rsopenwithscience
msgid "Science"
msgstr ""
#: ulng.rsopenwithsettings
msgid "Settings"
msgstr ""
#: ulng.rsopenwithsystem
#, fuzzy
msgctxt "ulng.rsopenwithsystem"
msgid "System"
msgstr "Sistema"
#: ulng.rsopenwithutility
msgid "Accessories"
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Abortado"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "A calcular a checksum"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "A calcular a checksum em \"%s\""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "A calcular a checksum de \"%s\""
#: ulng.rsopercalculatingstatictics
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "A calcular"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "A calcular \"%s\""
#: ulng.rsopercombining
msgid "Joining"
msgstr "A juntar"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "A juntar ficheiros em \"%s\" para \"%s\""
#: ulng.rsopercopying
msgid "Copying"
msgstr "A copiar"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "A copiar de \"%s\" para \"%s\""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "copiar \"%s\" para \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "A criar pasta"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "A criar pasta \"%s\""
#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "A eliminar"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "A eliminar em \"%s\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Eliminar \"%s\""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "A executar"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "A executar \"%s\""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "A extrair"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "A extrair de \"%s\" para \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Terminado"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "A listar"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "A listar \"%s\""
#: ulng.rsopermoving
msgid "Moving"
msgstr "A mover"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "A mover de \"%s\" para \"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "A mover \"%s\" para \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Não iniciado"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "A comprimir"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "A comprimir de \"%s\" para \"%s\""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "A comprimir \"%s\" para \"%s\""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Pausado"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "A pausar"
#: ulng.rsoperrunning
msgid "Running"
msgstr "A executar"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Definir propriedade"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Definir propriedade em \"%s\""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Definir propriedade de \"%s\""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "A dividir"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "A dividir \"%s\" para \"%s\""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "A iniciar"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Parado"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "A parar"
#: ulng.rsopertesting
msgid "Testing"
msgstr "A testar"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "A testar em \"%s\""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "A testar \"%s\""
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "A verificar a checksum"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "A verificar a checksum em \"%s\""
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "A verificar a checksum de \"%s\""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "A aguardar acesso à origem do ficheiro"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "A aguardar resposta do utilizador"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "A limpar"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "A limpar em \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "A limpar \"%s\""
#: ulng.rsoperworking
msgid "Working"
msgstr "A trabalhar"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Adicionar no início;Adicionar no fim;Adicionar inteligente"
#: ulng.rsoptaddingtooltipfiletype
msgid "Adding new tooltip file type"
msgstr ""
#: ulng.rsoptarchiveconfiguresavetochange
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsoptarchiveradditonalcmd
msgid "Mode dependent, additional command"
msgstr ""
#: ulng.rsoptarchiveraddonlynotempty
msgid "Add if it is non-empty"
msgstr ""
#: ulng.rsoptarchiverarchivel
msgid "Archive File (long name)"
msgstr ""
#: ulng.rsoptarchiverarchiver
msgid "Select archiver executable"
msgstr ""
#: ulng.rsoptarchiverarchives
msgid "Archive file (short name)"
msgstr ""
#: ulng.rsoptarchiverchangeencoding
msgid "Change Archiver Listing Encoding"
msgstr ""
#: ulng.rsoptarchiverconfirmdelete
msgctxt "ulng.rsoptarchiverconfirmdelete"
msgid "Are you sure you want to delete: \"%s\"?"
msgstr ""
#: ulng.rsoptarchiverdefaultexportfilename
msgid "Exported Archiver Configuration"
msgstr ""
#: ulng.rsoptarchivererrorlevel
msgid "errorlevel"
msgstr ""
#: ulng.rsoptarchiverexportcaption
msgid "Export archiver configuration"
msgstr ""
#: ulng.rsoptarchiverexportdone
msgctxt "ulng.rsoptarchiverexportdone"
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverexportprompt
msgctxt "ulng.rsoptarchiverexportprompt"
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsoptarchiverfilelistl
msgid "Filelist (long names)"
msgstr ""
#: ulng.rsoptarchiverfilelists
msgid "Filelist (short names)"
msgstr ""
#: ulng.rsoptarchiverimportcaption
msgid "Import archiver configuration"
msgstr ""
#: ulng.rsoptarchiverimportdone
msgctxt "ulng.rsoptarchiverimportdone"
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverimportfile
msgid "Select the file to import archiver configuration(s)"
msgstr ""
#: ulng.rsoptarchiverimportprompt
msgctxt "ulng.rsoptarchiverimportprompt"
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsoptarchiverjustname
msgid "Use name only, without path"
msgstr ""
#: ulng.rsoptarchiverjustpath
msgid "Use path only, without name"
msgstr ""
#: ulng.rsoptarchiverprograml
msgid "Archive Program (long name)"
msgstr ""
#: ulng.rsoptarchiverprograms
msgid "Archive Program (short name)"
msgstr ""
#: ulng.rsoptarchiverquoteall
msgid "Quote all names"
msgstr ""
#: ulng.rsoptarchiverquotewithspace
msgid "Quote names with spaces"
msgstr ""
#: ulng.rsoptarchiversinglefprocess
msgid "Single filename to process"
msgstr ""
#: ulng.rsoptarchivertargetsubdir
msgid "Target subdirecory"
msgstr ""
#: ulng.rsoptarchiveruseansi
msgid "Use ANSI encoding"
msgstr ""
#: ulng.rsoptarchiveruseutf8
msgid "Use UTF8 encoding"
msgstr ""
#: ulng.rsoptarchiverwheretosave
msgid "Enter location and filename where to save archiver configuration"
msgstr ""
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Nome do tipo de arquivo:"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Associar suplemento \"%s\" com:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Primeiro;Último;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Clássica, ordem antiga;Ordem alfabética (idioma sempre primeiro)"
#: ulng.rsoptconfigtreestate
msgid "Full expand;Full collapse"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Painel activo à esquerda, inactivo à direita (antigo);Painel esquerdo à esquerda, direito à direita"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Insira extensão"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "Adicionar no início;Adicionar no fim;ordem alfabética"
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "Janela separada;Janela separada minimizada;Painel de operações"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "Flutuante;B;K;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Atalho %s para cm_Delete será registado, pelo que poderá ser usado para reverter esta definição."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Adicionar atalho para %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Adicionar atalho"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Impossível definir atalho"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Alterar atalho"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Comando"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides"
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Atalho %s para cm_Delete tem um parâmetro que se sobrepõe a esta definição. Quer alterar o parâmetro para usar a definição global?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists"
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Atalho %s para cm_Delete tem de ter um parâmetro alterado para corresponder ao atalho %s. Quer alterá-lo?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Descrição"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Editar atalho para %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Fixar parâmetro"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Atalho"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Atalhos"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<nenhum>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parâmetros"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Definir atalho para eliminar ficheiro"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Para esta definição funcionar com o atalho %s, o atalho %s tem de ser atribuído a cm_Delete, mas já está atribuído a %s. Quer alterá-lo?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Atalho %s para cm_Delete é uma sequência para a qual uma tecla de atalho com Shift revertido não pode ser atribuída. Esta definição pode não funcionar."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Atalho em uso"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "Atalho %s já está em uso."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Alterar para %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "usado para %s em %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "usado por este comando mas com parâmetros diferentes"
#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Arquivadores"
#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Actualizar automaticamente"
#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Comportamentos"
#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr "Breve"
#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Cores"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Colunas"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Configuração"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Personalizar colunas"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Lista de pastas"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Arrastar & Largar"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Botão da lista de unidades"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Separadores favoritos"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Associações extra de ficheiros"
#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Associações de ficheiros"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Novo"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Operações de ficheiros"
#: ulng.rsoptionseditorfilepanels
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Painéis de ficheiros"
#: ulng.rsoptionseditorfilesearch
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Procurar ficheiro"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Vistas de ficheiros"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Tipos de ficheiros"
#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Separadores de pastas"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Separadores extra de pastas"
#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Letras"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Realces"
#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Atalhos"
#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Ícones"
#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Lista Ignorar"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Teclas"
#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Idioma"
#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr "Disposição"
#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Diário"
#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Vários"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Rato"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
"As opções em \"%s\" foram alteradas.\n"
"\n"
"Deseja gravar as alterações?\n"
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Extensões"
#: ulng.rsoptionseditorquicksearch
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Procura/Filtragem rápida"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Barra de ferramentas"
#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Ferramentas"
#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Sugestões"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Menu de árvore"
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr "Cores do menu de árvore"
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Nenhuma;Linha de comandos;Procura rápida;Filtragem rápida"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Botão esquerdo;Botão direito;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "Ao cimo da lista de ficheiros;Após as pastas (se as pastas estão ordenadas antes dos ficheiros);Na posição ordenada;No final da lista de ficheiros"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "A extensão %s já está atribuída às seguintes extensões:"
#: ulng.rsoptplugindisable
msgid "D&isable"
msgstr "Desactivar"
#: ulng.rsoptpluginenable
msgctxt "ulng.rsoptpluginenable"
msgid "E&nable"
msgstr "Ac&tivar"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Activo"
#: ulng.rsoptpluginsdescription
msgctxt "ulng.rsoptpluginsdescription"
msgid "Description"
msgstr "Descrição"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Nome de ficheiro"
#: ulng.rsoptpluginshowbyextension
msgid "By extension"
msgstr ""
#: ulng.rsoptpluginshowbyplugin
msgid "By Plugin"
msgstr ""
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Nome"
#: ulng.rsoptpluginsortonlywhenbyextension
msgid "Sorting WCX plugins is only possible when showing plugins by extension!"
msgstr ""
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Registado para"
#: ulng.rsoptrenamingtooltipfiletype
msgid "Renaming tooltip file type"
msgstr ""
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Sensível;&Insensível"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Ficheiros;Pa&stas;Ficheiros e &pastas"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "Ocultar painel de filtra&gem quando sem foco;Manter modificações de definições para a sessão seguinte"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "Não sensível a maiúsculas;De acordo com definições regionais (aAbBcC);Primeiro maiúsculas, depois minúsculas (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "Ordenar por nome e mostrar o primeiro;Ordenar como ficheiros e mostrar o primeiro;Ordenar como ficheiros"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Alfabética, considerando acentos;Ordem natural;Alfabética e números"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Cimo;Fundo;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "S&eparador;Comando inte&rno;Comando e&xterno;Men&u"
#: ulng.rsopttooltipconfiguresavetochange
msgid "To change file type tooltip configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsopttooltipfiletype
msgid "Tooltip file type name:"
msgstr "&Nome da categoria:"
#: ulng.rsopttooltipfiletypealreadyexists
msgid "\"%s\" already exists!"
msgstr ""
#: ulng.rsopttooltipfiletypeconfirmdelete
msgctxt "ulng.rsopttooltipfiletypeconfirmdelete"
msgid "Are you sure you want to delete: \"%s\"?"
msgstr ""
#: ulng.rsopttooltipfiletypedefaultexportfilename
msgid "Exported tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeexportcaption
msgid "Export tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeexportdone
msgctxt "ulng.rsopttooltipfiletypeexportdone"
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsopttooltipfiletypeexportprompt
msgctxt "ulng.rsopttooltipfiletypeexportprompt"
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsopttooltipfiletypeimportcaption
msgid "Import tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipfiletypeimportdone
msgctxt "ulng.rsopttooltipfiletypeimportdone"
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsopttooltipfiletypeimportfile
msgid "Select the file to import tooltip file type configuration(s)"
msgstr ""
#: ulng.rsopttooltipfiletypeimportprompt
msgctxt "ulng.rsopttooltipfiletypeimportprompt"
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsopttooltipfiletypewheretosave
msgid "Enter location and filename where to save tooltip file type configuration"
msgstr ""
#: ulng.rsopttooltipsfiletypename
msgid "Tooltip file type name"
msgstr ""
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "DC clássico - Copiar (x) nome_fich.ext;Windows - nome_fich (x).ext;Outros - nome_fich(x).ext"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "Não alterar posição;Usar a definição para novos ficheiros;Para a posição ordenada"
#: ulng.rspluginfilenamestylelist
msgid "With complete absolute path;Path relative to %COMMANDER_PATH%;Relative to the following"
msgstr ""
#: ulng.rspluginsearchcontainscasesenstive
msgid "contains(case)"
msgstr ""
#: ulng.rspluginsearchcontainsnotcase
msgid "contains"
msgstr ""
#: ulng.rspluginsearchequalcasesensitive
msgid "=(case)"
msgstr ""
#: ulng.rspluginsearchequalnotcase
msgctxt "ulng.rspluginsearchequalnotcase"
msgid "="
msgstr "="
#: ulng.rspluginsearchfieldnotfound
msgid "Field \"%s\" not found!"
msgstr ""
#: ulng.rspluginsearchnotcontainscasesenstive
msgid "!contains(case)"
msgstr ""
#: ulng.rspluginsearchnotcontainsnotcase
msgid "!contains"
msgstr ""
#: ulng.rspluginsearchnotequacasesensitive
msgid "!=(case)"
msgstr ""
#: ulng.rspluginsearchnotequalnotcase
msgctxt "ulng.rspluginsearchnotequalnotcase"
msgid "!="
msgstr "!="
#: ulng.rspluginsearchpluginnotfound
msgid "Plugin \"%s\" not found!"
msgstr ""
#: ulng.rspluginsearchunitnotfound
msgid "Unit \"%s\" not found!"
msgstr ""
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Ficheiros: %d, pastas: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Impossível alterar direitos de acesso a \"%s\""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Impossível alterar proprietário de \"%s\""
#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "Ficheiro"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Pasta"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Linha nomeada"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Socket"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Dispositivo de bloqueio especial"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Dispositivo de carácter especial"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Ligação simbólica"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Tipo desconhecido"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Resultado da procura"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "PROCURAR"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<modelo sem nome>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Já está em curso uma procura de ficheiro com a extensão DSX.\n"
"Temos de deixar terminar essa antes de iniciar outra nova.\n"
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Já está em curso uma procura de ficheiro com a extensão WDX.\n"
"Temos de deixar terminar essa antes de iniciar outra nova.\n"
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Seleccione uma pasta"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr "Seleccione a sua janela"
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "Mo&strar ajuda para %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Tudo"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Categoria"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Coluna"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Comando"
#: ulng.rssimplewordfalse
msgid "False"
msgstr ""
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Nome de ficheiro"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "ficheiros"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr "Carta"
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Param"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Resultado"
#: ulng.rssimplewordtrue
msgid "True"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "Pasta"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bytes"
#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr "Gigabytes"
#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr "Kilobytes"
#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr "Megabytes"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabytes"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Ficheiros: %d, pastas: %d, tamanho: %s (%s bytes)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Impossível criar pasta destino!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Formato de tamanho de ficheiro incorrecto!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Impossível dividir o ficheiro!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "O número de partes é superior a 100! Continuar?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr "Automático;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Pasta seleccionada:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr "Só antevisão"
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr "Outros"
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr "OU"
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr "Nota lateral"
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr "Plano"
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr "Limitado"
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr "Simples"
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr "Fabuloso"
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr "Maravilhoso"
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr "Tremendo"
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr "Escolha a sua pasta do histórico de pastas"
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr "Escolha os seus separadores favoritos:"
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr "Escolha o seu comando do histórico de comandos"
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr "Escolha a sua acção do menu principal"
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr "Escolha a sua acção da barra de ferramentas"
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr "Escolha a sua pasta da pasta quente:"
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr "Escolha a sua pasta do histórico de ficheiros"
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr "Escolha o seu ficheiro ou pasta"
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Erro ao criar ligação simbólica"
#: ulng.rssyndefaulttext
msgctxt "ulng.rssyndefaulttext"
msgid "Default text"
msgstr "Texto predefinido"
#: ulng.rssynlangplaintext
msgctxt "ulng.rssynlangplaintext"
msgid "Plain text"
msgstr "Texto simples"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "Não fazer nada;Fechar separador;Aceder aos favoritos;Menu contextual"
#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Dia(s)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Hora(s)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minuto(s)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Mês(es)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Segundo(s)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Semana(s)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Ano(s)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Renomear favoritos"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Sub-menu Renomear favoritos"
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Diferenciar"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Erro ao abrir Diferenciar"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Erro ao abrir o editor"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Erro ao abrir o terminal"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Erro ao abrir o visualizador"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rstooltiphidetimeoutlist
msgid "System default;1 sec;2 sec;3 sec;5 sec;10 sec;30 sec;1 min;Never hide"
msgstr ""
#: ulng.rstooltipmodelist
msgid "Combine DC and system tooltip, DC first (legacy);Combine DC and system tooltip, system first;Show DC tooltip when possible and system when not;Show DC tooltip only;Show system tooltip only"
msgstr ""
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Visualizador"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Por favor reporte este erro no rastreio de erros com uma descrição do que estava a fazer e o ficheiro seguinte: %sPrima %s para continuar ou %s para abortar o programa."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "Ambos os painéis, activo -> inactivo"
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "Ambos os painéis, esquerda -> direita"
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Caminho do painel"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "Cada nome entre parênteses ou o que quiser"
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Só nome, sem extensão"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "Nome completo (caminho e nome)"
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr "Ajuda com variáveis \"%\""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr "Pede ao utilizador que insira um parâmetro com um valor predefinido sugerido"
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Painel esquerdo"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "Nome ou lista de nomes de ficheiro temporários"
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "Nome ou lista de nomes completos de ficheiro temporários (caminho+nome)"
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr "Ficheiros na lista em UTF-16 com BOM"
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr "Ficheiros na lista em UTF-16 com BOM, entre aspas"
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr "Ficheiros na lista em UTF-8"
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr "Ficheiros na lista em UTF-8, entre aspas"
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "Nome ou lista de nomes de ficheiro temporários com caminho relativo"
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Só extensão de ficheiro"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Só nome de ficheiro"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Outro exemplo do que é possível"
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr "Caminho, com delimitador final"
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr "Daqui até ao fim da linha, o indicador de variável percentagem é o sinal \"#\""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr "Devolver o sinal percentagem"
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr "Daqui até ao fim da linha, o indicador de variável percentagem é de novo o sinal \"%\""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "Prefixar cada nome com \"-a\" ou o que quiser"
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "%[Pedir parâmetro;Valor predefinido proposto]"
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "Nome de ficheiro com caminho relativo"
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Painel direito"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "Caminho completo do 2º ficheiro seleccionado no painel direito"
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "Mostrar comando antes de executar"
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "%[Mensagem simples]"
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "Mostra uma mensagem simples"
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Painel activo (fonte)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Painel inactivo (destino)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr "Nomes de ficheiros entre aspas (predefinição)"
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "Comando executado no terminal, fica aberto quando terminar"
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr "Caminhos terão delimitador final"
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "Nomes de ficheiro sem aspas a partir daqui"
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "Comando executado no terminal, fechado quando terminar"
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr "Caminhos não terão delimitador final (predefinição)"
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Rede"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Visualizador interno do Double Commander."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Má qualidade"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Codificação"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Tipo de imagem"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Novo tamanho"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s não encontrado!"
#: ulng.rsviewpainttoolslist
msgid "Pen;Rect;Ellipse"
msgstr ""
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "com visualizador externo"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "com visualizador interno"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Nº de substituição: %d"
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "Não houve substituição."