mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-21 09:58:13 +00:00
12943 lines
409 KiB
Text
12943 lines
409 KiB
Text
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: Double Commander 0.9.0 alpha\n"
|
||
"POT-Creation-Date: \n"
|
||
"PO-Revision-Date: 2018-11-14 10:14+0300\n"
|
||
"Last-Translator: Alexander Koblov <alexx2000@mail.ru>\n"
|
||
"Language-Team: \n"
|
||
"Language: ru\n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=utf-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Native-Language: Русский\n"
|
||
|
||
#: fsyncdirsdlg.rscomparingpercent
|
||
msgid "Comparing... %d%% (ESC to cancel)"
|
||
msgstr "Сравнение... %d%% (ESC для отмены)"
|
||
|
||
#: fsyncdirsdlg.rsdeleteright
|
||
msgid "Right: Delete %d file(s)"
|
||
msgstr "Справа: Удалить файлы (%d шт.)"
|
||
|
||
#: fsyncdirsdlg.rsfilesfound
|
||
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
||
msgstr "Найдено файлов: %d (Одинаковых: %d, Различных: %d, Уникальных слева: %d, Уникальных справа: %d)"
|
||
|
||
#: fsyncdirsdlg.rslefttorightcopy
|
||
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
||
msgstr "Слева направо: Копируется файлов: %d, общий размер: %d байт"
|
||
|
||
#: fsyncdirsdlg.rsrighttoleftcopy
|
||
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
||
msgstr "Справа налево: Копируется файлов: %d, общий размер: %d байт"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
||
msgid "Choose template..."
|
||
msgstr "Выбрать шаблон..."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
||
msgid "C&heck free space"
|
||
msgstr "Проверять свобо&дное место"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
||
msgid "Cop&y attributes"
|
||
msgstr "&Копировать атрибуты"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
||
msgid "Copy o&wnership"
|
||
msgstr "К&опировать владельца"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
||
msgid "Copy &permissions"
|
||
msgstr "Копировать права доступа"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Копировать дат&у/время"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
||
msgid "Correct lin&ks"
|
||
msgstr "Исп&равлять ссылки"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "Drop readonly fla&g"
|
||
msgstr "С&бросить флаг \"Только для чтения\""
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
||
msgid "E&xclude empty directories"
|
||
msgstr "&Исключить пустые каталоги"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
||
msgid "Fo&llow links"
|
||
msgstr "С&ледовать ссылкам"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
||
msgid "&Reserve space"
|
||
msgstr "Р&езервировать место"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
||
msgid "&Verify"
|
||
msgstr "Проверить после &завершения"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
||
msgctxt "tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint"
|
||
msgid "What to do when cannot set file time, attributes, etc."
|
||
msgstr "Что делать, когда не удаётся установить время файла, его атрибуты и т.д."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
||
msgid "Use file template"
|
||
msgstr "Использовать шаблон"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
||
msgid "When dir&ectory exists"
|
||
msgstr "Если к&аталог существует"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When &file exists"
|
||
msgstr "Если &файл существует"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
||
msgid "When ca&nnot set property"
|
||
msgstr "Если &нельзя устан. свойство"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
||
msgid "<no template>"
|
||
msgstr "<нет шаблона>"
|
||
|
||
#: tfrmabout.btnclose.caption
|
||
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmabout.btncopytoclipboard.caption
|
||
msgid "Copy to clipboard"
|
||
msgstr "Копировать"
|
||
|
||
#: tfrmabout.caption
|
||
msgctxt "TFRMABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "О программе..."
|
||
|
||
#: tfrmabout.lblbuild.caption
|
||
msgctxt "tfrmabout.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Сборка"
|
||
|
||
#: tfrmabout.lblfreepascalver.caption
|
||
msgctxt "tfrmabout.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmabout.lblhomepage.caption
|
||
msgid "Home Page:"
|
||
msgstr "Домашняя страница:"
|
||
|
||
#: tfrmabout.lblhomepageaddress.caption
|
||
msgid "http://doublecmd.sourceforge.net"
|
||
msgstr "http://doublecmd.sourceforge.net"
|
||
|
||
#: tfrmabout.lbllazarusver.caption
|
||
msgctxt "tfrmabout.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmabout.lblrevision.caption
|
||
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
|
||
msgid "Revision"
|
||
msgstr "Ревизия"
|
||
|
||
#: tfrmabout.lbltitle.caption
|
||
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmabout.lblversion.caption
|
||
msgctxt "tfrmabout.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Версия"
|
||
|
||
#: tfrmattributesedit.btncancel.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmattributesedit.btnok.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmattributesedit.btnreset.caption
|
||
msgid "&Reset"
|
||
msgstr "&Сбросить"
|
||
|
||
#: tfrmattributesedit.caption
|
||
msgid "Choose attributes"
|
||
msgstr "Выбрать атрибуты"
|
||
|
||
#: tfrmattributesedit.cbarchive.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
|
||
msgid "&Archive"
|
||
msgstr "&Архивный"
|
||
|
||
#: tfrmattributesedit.cbcompressed.caption
|
||
msgid "Co&mpressed"
|
||
msgstr "С&жатый"
|
||
|
||
#: tfrmattributesedit.cbdirectory.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
|
||
msgid "&Directory"
|
||
msgstr "&Каталог"
|
||
|
||
#: tfrmattributesedit.cbencrypted.caption
|
||
msgid "&Encrypted"
|
||
msgstr "&Зашифрованный"
|
||
|
||
#: tfrmattributesedit.cbhidden.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
|
||
msgid "&Hidden"
|
||
msgstr "Ск&рытый"
|
||
|
||
#: tfrmattributesedit.cbreadonly.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
|
||
msgid "Read o&nly"
|
||
msgstr "&Только для чтения"
|
||
|
||
#: tfrmattributesedit.cbsgid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmattributesedit.cbsparse.caption
|
||
msgid "S&parse"
|
||
msgstr "Разрежённ&ый"
|
||
|
||
#: tfrmattributesedit.cbsticky.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Закре&пляющий бит"
|
||
|
||
#: tfrmattributesedit.cbsuid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmattributesedit.cbsymlink.caption
|
||
msgid "&Symlink"
|
||
msgstr "Ссы&лка"
|
||
|
||
#: tfrmattributesedit.cbsystem.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
|
||
msgid "S&ystem"
|
||
msgstr "С&истемный"
|
||
|
||
#: tfrmattributesedit.cbtemporary.caption
|
||
msgid "&Temporary"
|
||
msgstr "Временны&й"
|
||
|
||
#: tfrmattributesedit.gbntfsattributes.caption
|
||
msgid "NTFS attributes"
|
||
msgstr "Атрибуты NTFS"
|
||
|
||
#: tfrmattributesedit.gbwingeneral.caption
|
||
msgid "General attributes"
|
||
msgstr "Основные атрибуты"
|
||
|
||
#: tfrmattributesedit.lblattrbitsstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Биты:"
|
||
|
||
#: tfrmattributesedit.lblattrgroupstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Группа"
|
||
|
||
#: tfrmattributesedit.lblattrotherstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Другие"
|
||
|
||
#: tfrmattributesedit.lblattrownerstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Владелец"
|
||
|
||
#: tfrmattributesedit.lblexec.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Выполнение"
|
||
|
||
#: tfrmattributesedit.lblread.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Чтение"
|
||
|
||
#: tfrmattributesedit.lbltextattrs.caption
|
||
msgid "As te&xt:"
|
||
msgstr "Как т&екст:"
|
||
|
||
#: tfrmattributesedit.lblwrite.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Запись"
|
||
|
||
#: tfrmbenchmark.caption
|
||
msgid "Benchmark"
|
||
msgstr "Тест производительности"
|
||
|
||
#: tfrmbenchmark.lblbenchmarksize.caption
|
||
msgid "Benchmark data size: %d MB"
|
||
msgstr "Объём данных теста: %d Мб"
|
||
|
||
#: tfrmbenchmark.stgresult.columns[0].title.caption
|
||
msgid "Hash"
|
||
msgstr "Хэш-функция"
|
||
|
||
#: tfrmbenchmark.stgresult.columns[1].title.caption
|
||
msgid "Time (ms)"
|
||
msgstr "Время (мс)"
|
||
|
||
#: tfrmbenchmark.stgresult.columns[2].title.caption
|
||
msgid "Speed (MB/s)"
|
||
msgstr "Скорость (Мб/с)"
|
||
|
||
#: tfrmchecksumcalc.caption
|
||
msgctxt "tfrmchecksumcalc.caption"
|
||
msgid "Calculate checksum..."
|
||
msgstr "Посчитать контрольные суммы..."
|
||
|
||
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
||
msgid "Open checksum file after job is completed"
|
||
msgstr "Открыть файл контрольной суммы после расчёта"
|
||
|
||
#: tfrmchecksumcalc.cbseparatefile.caption
|
||
msgid "C&reate separate checksum file for each file"
|
||
msgstr "Д&ля каждого файла создать отдельный файл контрольной суммы"
|
||
|
||
#: tfrmchecksumcalc.lblsaveto.caption
|
||
msgid "&Save checksum file(s) to:"
|
||
msgstr "&Сохранить файл(ы) контрольных сумм как:"
|
||
|
||
#: tfrmchecksumverify.btnclose.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmchecksumverify.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
|
||
msgid "Verify checksum..."
|
||
msgstr "Проверить контрольные суммы..."
|
||
|
||
#: tfrmconnectionmanager.btnadd.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmconnectionmanager.btncancel.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmconnectionmanager.btnconnect.caption
|
||
msgid "C&onnect"
|
||
msgstr "Со&единиться"
|
||
|
||
#: tfrmconnectionmanager.btndelete.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmconnectionmanager.btnedit.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Редактировать"
|
||
|
||
#: tfrmconnectionmanager.caption
|
||
msgid "Connection manager"
|
||
msgstr "Сетевые соединения"
|
||
|
||
#: tfrmconnectionmanager.gbconnectto.caption
|
||
msgid "Connect to:"
|
||
msgstr "Соединиться с:"
|
||
|
||
#: tfrmcopydlg.btnaddtoqueue.caption
|
||
msgid "A&dd To Queue"
|
||
msgstr "&В очередь"
|
||
|
||
#: tfrmcopydlg.btncancel.caption
|
||
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmcopydlg.btnoptions.caption
|
||
msgid "O&ptions"
|
||
msgstr "О&пции"
|
||
|
||
#: tfrmcopydlg.btnsaveoptions.caption
|
||
msgid "Sa&ve these options as default"
|
||
msgstr "Со&хранить по умолчанию"
|
||
|
||
#: tfrmcopydlg.caption
|
||
msgctxt "TFRMCOPYDLG.CAPTION"
|
||
msgid "Copy file(s)"
|
||
msgstr "Копировать файл(ы)"
|
||
|
||
#: tfrmcopydlg.mnunewqueue.caption
|
||
msgctxt "tfrmcopydlg.mnunewqueue.caption"
|
||
msgid "New queue"
|
||
msgstr "Новая очередь"
|
||
|
||
#: tfrmcopydlg.mnuqueue1.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue1.caption"
|
||
msgid "Queue 1"
|
||
msgstr "Очередь 1"
|
||
|
||
#: tfrmcopydlg.mnuqueue2.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue2.caption"
|
||
msgid "Queue 2"
|
||
msgstr "Очередь 2"
|
||
|
||
#: tfrmcopydlg.mnuqueue3.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue3.caption"
|
||
msgid "Queue 3"
|
||
msgstr "Очередь 3"
|
||
|
||
#: tfrmcopydlg.mnuqueue4.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue4.caption"
|
||
msgid "Queue 4"
|
||
msgstr "Очередь 4"
|
||
|
||
#: tfrmcopydlg.mnuqueue5.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue5.caption"
|
||
msgid "Queue 5"
|
||
msgstr "Очередь 5"
|
||
|
||
#: tfrmdescredit.actsavedescription.caption
|
||
msgid "Save Description"
|
||
msgstr "Сохранить описание"
|
||
|
||
#: tfrmdescredit.btncancel.caption
|
||
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmdescredit.btnok.caption
|
||
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmdescredit.caption
|
||
msgid "File/folder comment"
|
||
msgstr "Комментарий к файлу/папке"
|
||
|
||
#: tfrmdescredit.lbleditcommentfor.caption
|
||
msgid "E&dit comment for:"
|
||
msgstr "&Правка комментария к:"
|
||
|
||
#: tfrmdescredit.lblencoding.caption
|
||
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
|
||
msgid "&Encoding:"
|
||
msgstr "&Кодировка:"
|
||
|
||
#: tfrmdescredit.lblfilename.caption
|
||
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmdiffer.actabout.caption
|
||
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "О программе"
|
||
|
||
#: tfrmdiffer.actautocompare.caption
|
||
msgid "Auto Compare"
|
||
msgstr "Сравнить автоматически"
|
||
|
||
#: tfrmdiffer.actbinarycompare.caption
|
||
msgid "Binary Mode"
|
||
msgstr "Бинарный режим"
|
||
|
||
#: tfrmdiffer.actcancelcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Отмена"
|
||
|
||
#: tfrmdiffer.actcancelcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
||
msgid "Cancel"
|
||
msgstr "Отмена"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
|
||
msgid "Copy Block Right"
|
||
msgstr "Копировать блок направо"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
||
msgid "Copy Block Right"
|
||
msgstr "Копировать блок направо"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
|
||
msgid "Copy Block Left"
|
||
msgstr "Копировать блок налево"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
||
msgid "Copy Block Left"
|
||
msgstr "Копировать блок налево"
|
||
|
||
#: tfrmdiffer.acteditcopy.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "&Копировать"
|
||
|
||
#: tfrmdiffer.acteditcut.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "В&ырезать"
|
||
|
||
#: tfrmdiffer.acteditdelete.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: tfrmdiffer.acteditpaste.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "&Вставить"
|
||
|
||
#: tfrmdiffer.acteditredo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Повторить"
|
||
|
||
#: tfrmdiffer.acteditselectall.caption
|
||
msgid "Select &All"
|
||
msgstr "Выделить в&сё"
|
||
|
||
#: tfrmdiffer.acteditundo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Отменить"
|
||
|
||
#: tfrmdiffer.actexit.caption
|
||
msgctxt "tfrmdiffer.actexit.caption"
|
||
msgid "E&xit"
|
||
msgstr "Выход"
|
||
|
||
#: tfrmdiffer.actfirstdifference.caption
|
||
msgctxt "tfrmdiffer.actfirstdifference.caption"
|
||
msgid "First Difference"
|
||
msgstr "Первое отличие"
|
||
|
||
#: tfrmdiffer.actfirstdifference.hint
|
||
msgctxt "tfrmdiffer.actfirstdifference.hint"
|
||
msgid "First Difference"
|
||
msgstr "Первое отличие"
|
||
|
||
#: tfrmdiffer.actignorecase.caption
|
||
msgid "Ignore Case"
|
||
msgstr "Не учитывать регистр"
|
||
|
||
#: tfrmdiffer.actignorewhitespace.caption
|
||
msgid "Ignore Blanks"
|
||
msgstr "Не учитывать пробелы"
|
||
|
||
#: tfrmdiffer.actkeepscrolling.caption
|
||
msgid "Keep Scrolling"
|
||
msgstr "Синхронная прокрутка"
|
||
|
||
#: tfrmdiffer.actlastdifference.caption
|
||
msgctxt "tfrmdiffer.actlastdifference.caption"
|
||
msgid "Last Difference"
|
||
msgstr "Последнее отличие"
|
||
|
||
#: tfrmdiffer.actlastdifference.hint
|
||
msgctxt "tfrmdiffer.actlastdifference.hint"
|
||
msgid "Last Difference"
|
||
msgstr "Последнее отличие"
|
||
|
||
#: tfrmdiffer.actlinedifferences.caption
|
||
msgid "Line Differences"
|
||
msgstr "Разница строк"
|
||
|
||
#: tfrmdiffer.actnextdifference.caption
|
||
msgctxt "tfrmdiffer.actnextdifference.caption"
|
||
msgid "Next Difference"
|
||
msgstr "Следующее отличие"
|
||
|
||
#: tfrmdiffer.actnextdifference.hint
|
||
msgctxt "tfrmdiffer.actnextdifference.hint"
|
||
msgid "Next Difference"
|
||
msgstr "Следующее отличие"
|
||
|
||
#: tfrmdiffer.actopenleft.caption
|
||
msgid "Open Left..."
|
||
msgstr "Открыть слева..."
|
||
|
||
#: tfrmdiffer.actopenright.caption
|
||
msgid "Open Right..."
|
||
msgstr "Открыть справа..."
|
||
|
||
#: tfrmdiffer.actpaintbackground.caption
|
||
msgid "Paint Background"
|
||
msgstr "Подсвечивать фон"
|
||
|
||
#: tfrmdiffer.actprevdifference.caption
|
||
msgctxt "tfrmdiffer.actprevdifference.caption"
|
||
msgid "Previous Difference"
|
||
msgstr "Предыдущее отличие"
|
||
|
||
#: tfrmdiffer.actprevdifference.hint
|
||
msgctxt "tfrmdiffer.actprevdifference.hint"
|
||
msgid "Previous Difference"
|
||
msgstr "Предыдущее отличие"
|
||
|
||
#: tfrmdiffer.actreload.caption
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
|
||
msgid "&Reload"
|
||
msgstr "П&ерезагрузить"
|
||
|
||
#: tfrmdiffer.actreload.hint
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
|
||
msgid "Reload"
|
||
msgstr "Перезагрузить"
|
||
|
||
#: tfrmdiffer.actsave.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Сохранить"
|
||
|
||
#: tfrmdiffer.actsave.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Сохранить"
|
||
|
||
#: tfrmdiffer.actsaveas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
|
||
msgid "Save as..."
|
||
msgstr "Сохранить как..."
|
||
|
||
#: tfrmdiffer.actsaveas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
||
msgid "Save as..."
|
||
msgstr "Сохранить как..."
|
||
|
||
#: tfrmdiffer.actsaveleft.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
|
||
msgid "Save Left"
|
||
msgstr "Сохранить слева"
|
||
|
||
#: tfrmdiffer.actsaveleft.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
||
msgid "Save Left"
|
||
msgstr "Сохранить слева"
|
||
|
||
#: tfrmdiffer.actsaveleftas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
|
||
msgid "Save Left As..."
|
||
msgstr "Сохранить слева как..."
|
||
|
||
#: tfrmdiffer.actsaveleftas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
||
msgid "Save Left As..."
|
||
msgstr "Сохранить слева как..."
|
||
|
||
#: tfrmdiffer.actsaveright.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
|
||
msgid "Save Right"
|
||
msgstr "Сохранить справа"
|
||
|
||
#: tfrmdiffer.actsaveright.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
||
msgid "Save Right"
|
||
msgstr "Сохранить справа"
|
||
|
||
#: tfrmdiffer.actsaverightas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
|
||
msgid "Save Right As..."
|
||
msgstr "Сохранить справа как..."
|
||
|
||
#: tfrmdiffer.actsaverightas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
||
msgid "Save Right As..."
|
||
msgstr "Сохранить справа как..."
|
||
|
||
#: tfrmdiffer.actstartcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Сравнить"
|
||
|
||
#: tfrmdiffer.actstartcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
||
msgid "Compare"
|
||
msgstr "Сравнить"
|
||
|
||
#: tfrmdiffer.btnleftencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Кодировка"
|
||
|
||
#: tfrmdiffer.btnrightencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Кодировка"
|
||
|
||
#: tfrmdiffer.caption
|
||
msgctxt "TFRMDIFFER.CAPTION"
|
||
msgid "Compare files"
|
||
msgstr "Сравнить файлы"
|
||
|
||
#: tfrmdiffer.midivider1.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider10.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider2.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider3.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider4.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider5.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider6.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider7.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider8.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider9.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miencodingleft.caption
|
||
msgid "&Left"
|
||
msgstr "С&лева"
|
||
|
||
#: tfrmdiffer.miencodingright.caption
|
||
msgid "&Right"
|
||
msgstr "С&права"
|
||
|
||
#: tfrmdiffer.miseparator1.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miseparator2.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.mnuactions.caption
|
||
msgid "&Actions"
|
||
msgstr "Действия"
|
||
|
||
#: tfrmdiffer.mnuedit.caption
|
||
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Правка"
|
||
|
||
#: tfrmdiffer.mnuencoding.caption
|
||
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "&Кодировка"
|
||
|
||
#: tfrmdiffer.mnufile.caption
|
||
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmdiffer.mnuoptions.caption
|
||
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
|
||
msgid "&Options"
|
||
msgstr "&Настройки"
|
||
|
||
#: tfrmedithotkey.btnaddshortcut.hint
|
||
msgid "Add new shortcut to sequence"
|
||
msgstr "Добавить новое сочетание клавиш"
|
||
|
||
#: tfrmedithotkey.btncancel.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmedithotkey.btnok.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmedithotkey.btnremoveshortcut.hint
|
||
msgid "Remove last shortcut from sequence"
|
||
msgstr "Удалить последнее сочетание клавиш из списка"
|
||
|
||
#: tfrmedithotkey.btnselectfromlist.hint
|
||
msgid "Select shortcut from list of remaining free available keys"
|
||
msgstr "Выберите из списка оставшихся свободных доступных клавиш"
|
||
|
||
#: tfrmedithotkey.cghkcontrols.caption
|
||
msgctxt "tfrmedithotkey.cghkcontrols.caption"
|
||
msgid "Only for these controls"
|
||
msgstr "Только для этих элементов"
|
||
|
||
#: tfrmedithotkey.lblparameters.caption
|
||
msgid "&Parameters (each in a separate line):"
|
||
msgstr "&Параметры (каждый в отдельной строке)"
|
||
|
||
#: tfrmedithotkey.lblshortcuts.caption
|
||
msgid "Shortcuts:"
|
||
msgstr "Сочетание клавиш:"
|
||
|
||
#: tfrmeditor.actabout.caption
|
||
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "О программе..."
|
||
|
||
#: tfrmeditor.actabout.hint
|
||
msgctxt "tfrmeditor.actabout.hint"
|
||
msgid "About"
|
||
msgstr "О программе..."
|
||
|
||
#: tfrmeditor.actconfhigh.caption
|
||
msgid "&Configuration"
|
||
msgstr "&Настройки"
|
||
|
||
#: tfrmeditor.actconfhigh.hint
|
||
msgctxt "tfrmeditor.actconfhigh.hint"
|
||
msgid "Configuration"
|
||
msgstr "Конфигурация"
|
||
|
||
#: tfrmeditor.acteditcopy.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "&Копировать"
|
||
|
||
#: tfrmeditor.acteditcopy.hint
|
||
msgctxt "tfrmeditor.acteditcopy.hint"
|
||
msgid "Copy"
|
||
msgstr "Копировать"
|
||
|
||
#: tfrmeditor.acteditcut.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "&Вырезать"
|
||
|
||
#: tfrmeditor.acteditcut.hint
|
||
msgctxt "tfrmeditor.acteditcut.hint"
|
||
msgid "Cut"
|
||
msgstr "Вырезать"
|
||
|
||
#: tfrmeditor.acteditdelete.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: tfrmeditor.acteditdelete.hint
|
||
msgctxt "tfrmeditor.acteditdelete.hint"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: tfrmeditor.acteditfind.caption
|
||
msgctxt "tfrmeditor.acteditfind.caption"
|
||
msgid "&Find"
|
||
msgstr "&Найти..."
|
||
|
||
#: tfrmeditor.acteditfind.hint
|
||
msgctxt "tfrmeditor.acteditfind.hint"
|
||
msgid "Find"
|
||
msgstr "Найти"
|
||
|
||
#: tfrmeditor.acteditfindnext.caption
|
||
msgctxt "tfrmeditor.acteditfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Найти далее"
|
||
|
||
#: tfrmeditor.acteditfindnext.hint
|
||
msgctxt "tfrmeditor.acteditfindnext.hint"
|
||
msgid "Find next"
|
||
msgstr "Найти далее"
|
||
|
||
#: tfrmeditor.acteditfindprevious.caption
|
||
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
||
msgid "Find previous"
|
||
msgstr "Найти предыдущее"
|
||
|
||
#: tfrmeditor.acteditgotoline.caption
|
||
msgctxt "tfrmeditor.acteditgotoline.caption"
|
||
msgid "Goto Line..."
|
||
msgstr "Перейти к строке..."
|
||
|
||
#: tfrmeditor.acteditlineendcr.caption
|
||
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcr.hint
|
||
msgctxt "tfrmeditor.acteditlineendcr.hint"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.hint
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.hint
|
||
msgctxt "tfrmeditor.acteditlineendlf.hint"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditpaste.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Вст&авить"
|
||
|
||
#: tfrmeditor.acteditpaste.hint
|
||
msgctxt "tfrmeditor.acteditpaste.hint"
|
||
msgid "Paste"
|
||
msgstr "Вставить"
|
||
|
||
#: tfrmeditor.acteditredo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "&Повторить"
|
||
|
||
#: tfrmeditor.acteditredo.hint
|
||
msgctxt "tfrmeditor.acteditredo.hint"
|
||
msgid "Redo"
|
||
msgstr "Повторить"
|
||
|
||
#: tfrmeditor.acteditrplc.caption
|
||
msgid "&Replace"
|
||
msgstr "&Заменить..."
|
||
|
||
#: tfrmeditor.acteditrplc.hint
|
||
msgctxt "tfrmeditor.acteditrplc.hint"
|
||
msgid "Replace"
|
||
msgstr "Заменить"
|
||
|
||
#: tfrmeditor.acteditselectall.caption
|
||
msgid "Select&All"
|
||
msgstr "В&ыделить всё"
|
||
|
||
#: tfrmeditor.acteditselectall.hint
|
||
msgctxt "tfrmeditor.acteditselectall.hint"
|
||
msgid "Select All"
|
||
msgstr "Выделить всё"
|
||
|
||
#: tfrmeditor.acteditundo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "&Отменить"
|
||
|
||
#: tfrmeditor.acteditundo.hint
|
||
msgctxt "tfrmeditor.acteditundo.hint"
|
||
msgid "Undo"
|
||
msgstr "Отменить"
|
||
|
||
#: tfrmeditor.actfileclose.caption
|
||
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmeditor.actfileclose.hint
|
||
msgctxt "tfrmeditor.actfileclose.hint"
|
||
msgid "Close"
|
||
msgstr "Закрыть"
|
||
|
||
#: tfrmeditor.actfileexit.caption
|
||
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "В&ыход"
|
||
|
||
#: tfrmeditor.actfileexit.hint
|
||
msgctxt "tfrmeditor.actfileexit.hint"
|
||
msgid "Exit"
|
||
msgstr "Выход"
|
||
|
||
#: tfrmeditor.actfilenew.caption
|
||
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
|
||
msgid "&New"
|
||
msgstr "&Создать"
|
||
|
||
#: tfrmeditor.actfilenew.hint
|
||
msgctxt "tfrmeditor.actfilenew.hint"
|
||
msgid "New"
|
||
msgstr "Создать"
|
||
|
||
#: tfrmeditor.actfileopen.caption
|
||
msgid "&Open"
|
||
msgstr "&Открыть"
|
||
|
||
#: tfrmeditor.actfileopen.hint
|
||
msgctxt "tfrmeditor.actfileopen.hint"
|
||
msgid "Open"
|
||
msgstr "Открыть"
|
||
|
||
#: tfrmeditor.actfilereload.caption
|
||
msgctxt "tfrmeditor.actfilereload.caption"
|
||
msgid "Reload"
|
||
msgstr "Перезагрузить"
|
||
|
||
#: tfrmeditor.actfilesave.caption
|
||
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Со&хранить"
|
||
|
||
#: tfrmeditor.actfilesave.hint
|
||
msgctxt "tfrmeditor.actfilesave.hint"
|
||
msgid "Save"
|
||
msgstr "Сохранить"
|
||
|
||
#: tfrmeditor.actfilesaveas.caption
|
||
msgid "Save &As..."
|
||
msgstr "Сохранить &как..."
|
||
|
||
#: tfrmeditor.actfilesaveas.hint
|
||
msgid "Save As"
|
||
msgstr "Сохранить как..."
|
||
|
||
#: tfrmeditor.actsaveall.caption
|
||
msgid "Sa&ve All"
|
||
msgstr "Сохранить &все"
|
||
|
||
#: tfrmeditor.actsaveall.hint
|
||
msgid "Save All"
|
||
msgstr "Сохранить все"
|
||
|
||
#: tfrmeditor.caption
|
||
msgctxt "tfrmeditor.caption"
|
||
msgid "Editor"
|
||
msgstr "Редактор"
|
||
|
||
#: tfrmeditor.help1.caption
|
||
msgctxt "TFRMEDITOR.HELP1.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Помощ&ь"
|
||
|
||
#: tfrmeditor.miedit.caption
|
||
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Правка"
|
||
|
||
#: tfrmeditor.miencoding.caption
|
||
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "&Кодировка"
|
||
|
||
#: tfrmeditor.miencodingin.caption
|
||
msgid "Open as"
|
||
msgstr "Открыть как"
|
||
|
||
#: tfrmeditor.miencodingout.caption
|
||
msgctxt "tfrmeditor.miencodingout.caption"
|
||
msgid "Save as"
|
||
msgstr "Сохранить как"
|
||
|
||
#: tfrmeditor.mifile.caption
|
||
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmeditor.mihighlight.caption
|
||
msgid "Syntax highlight"
|
||
msgstr "Подсветка &синтаксиса"
|
||
|
||
#: tfrmeditor.milineendtype.caption
|
||
msgid "End Of Line"
|
||
msgstr "Конец строки"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
|
||
msgid "C&ase sensitivity"
|
||
msgstr "&Учитывать регистр"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
|
||
msgid "S&earch from caret"
|
||
msgstr "Искать от &курсора"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
|
||
msgid "&Regular expressions"
|
||
msgstr "&Регулярные выражения"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
|
||
msgid "Selected &text only"
|
||
msgstr "В в&ыделенном тексте"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
|
||
msgid "&Whole words only"
|
||
msgstr "Только слово &целиком"
|
||
|
||
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
|
||
msgid "Option"
|
||
msgstr "Опции"
|
||
|
||
#: tfrmeditsearchreplace.lblreplacewith.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
|
||
msgid "&Replace with:"
|
||
msgstr "&Заменить:"
|
||
|
||
#: tfrmeditsearchreplace.lblsearchfor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
|
||
msgid "&Search for:"
|
||
msgstr "Н&айти:"
|
||
|
||
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
|
||
msgid "Direction"
|
||
msgstr "Направление"
|
||
|
||
#: tfrmextractdlg.caption
|
||
msgctxt "TFRMEXTRACTDLG.CAPTION"
|
||
msgid "Unpack files"
|
||
msgstr "Распаковать файлы"
|
||
|
||
#: tfrmextractdlg.cbextractpath.caption
|
||
msgid "&Unpack path names if stored with files"
|
||
msgstr "&Учитывать подкаталоги"
|
||
|
||
#: tfrmextractdlg.cbfilemask.text
|
||
msgctxt "tfrmextractdlg.cbfilemask.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmextractdlg.cbinseparatefolder.caption
|
||
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
||
msgstr "Распаковать каждый &архив в отдельный каталог (с именем архива)"
|
||
|
||
#: tfrmextractdlg.cboverwrite.caption
|
||
msgid "O&verwrite existing files"
|
||
msgstr "&Заменять существующие файлы"
|
||
|
||
#: tfrmextractdlg.lblextractto.caption
|
||
msgid "To the &directory:"
|
||
msgstr "В &каталог:"
|
||
|
||
#: tfrmextractdlg.lblfilemask.caption
|
||
msgid "&Extract files matching file mask:"
|
||
msgstr "&Распаковать файлы по маске:"
|
||
|
||
#: tfrmextractdlg.lblpassword.caption
|
||
msgid "&Password for encrypted files:"
|
||
msgstr "&Пароль (для зашифрованных файлов):"
|
||
|
||
#: tfrmfileexecuteyourself.btnclose.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmfileexecuteyourself.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
|
||
msgid "Wait..."
|
||
msgstr "Подождите..."
|
||
|
||
#: tfrmfileexecuteyourself.lblfilename.caption
|
||
msgid "File name:"
|
||
msgstr "Имя файла:"
|
||
|
||
#: tfrmfileexecuteyourself.lblfrompath.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
|
||
msgid "From:"
|
||
msgstr "Из:"
|
||
|
||
#: tfrmfileexecuteyourself.lblprompt.caption
|
||
msgid "Click on Close when the temporary file can be deleted!"
|
||
msgstr "Нажмите \"Закрыть\", когда временный файл можно будет удалить!"
|
||
|
||
#: tfrmfileop.btncancel.caption
|
||
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmfileop.btnminimizetopanel.caption
|
||
msgid "&To panel"
|
||
msgstr "&На панель"
|
||
|
||
#: tfrmfileop.btnviewoperations.caption
|
||
msgid "&View all"
|
||
msgstr "&Показать все"
|
||
|
||
#: tfrmfileop.lblcurrentoperation.caption
|
||
msgid "Current operation:"
|
||
msgstr "Текущая операция:"
|
||
|
||
#: tfrmfileop.lblfrom.caption
|
||
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
||
msgid "From:"
|
||
msgstr "Из:"
|
||
|
||
#: tfrmfileop.lblto.caption
|
||
msgid "To:"
|
||
msgstr "в:"
|
||
|
||
#: tfrmfileproperties.btnclose.caption
|
||
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmfileproperties.btnsetproperties.caption
|
||
msgid "&Set properties"
|
||
msgstr "&Установить"
|
||
|
||
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
||
msgid "Set to &all selected files"
|
||
msgstr "У&становить для всех"
|
||
|
||
#: tfrmfileproperties.btnskipfile.caption
|
||
msgid "Ski&p this file"
|
||
msgstr "&Пропустить"
|
||
|
||
#: tfrmfileproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Свойства"
|
||
|
||
#: tfrmfileproperties.cbsgid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmfileproperties.cbsticky.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Закрепляющий бит"
|
||
|
||
#: tfrmfileproperties.cbsuid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmfileproperties.chkexecutable.caption
|
||
msgid "Allow &executing file as program"
|
||
msgstr "&Разрешить исполнять как программу"
|
||
|
||
#: tfrmfileproperties.gbowner.caption
|
||
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Владелец"
|
||
|
||
#: tfrmfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Биты:"
|
||
|
||
#: tfrmfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Группа"
|
||
|
||
#: tfrmfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Другие"
|
||
|
||
#: tfrmfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Владелец"
|
||
|
||
#: tfrmfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Текст:"
|
||
|
||
#: tfrmfileproperties.lblcontains.caption
|
||
msgctxt "tfrmfileproperties.lblcontains.caption"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblcontainsstr.caption
|
||
msgid "Contains:"
|
||
msgstr "Содержит:"
|
||
|
||
#: tfrmfileproperties.lblexec.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Выполнение"
|
||
|
||
#: tfrmfileproperties.lblexecutable.caption
|
||
msgid "Execute:"
|
||
msgstr "Запуск:"
|
||
|
||
#: tfrmfileproperties.lblfile.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Имя файла"
|
||
|
||
#: tfrmfileproperties.lblfilename.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfilestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Имя файла"
|
||
|
||
#: tfrmfileproperties.lblfolder.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfolderstr.caption
|
||
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
||
msgid "Path:"
|
||
msgstr "Путь:"
|
||
|
||
#: tfrmfileproperties.lblgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
|
||
msgid "&Group"
|
||
msgstr "&Группа"
|
||
|
||
#: tfrmfileproperties.lbllastaccess.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastaccessstr.caption
|
||
msgid "Last access:"
|
||
msgstr "Последний доступ:"
|
||
|
||
#: tfrmfileproperties.lbllastmodif.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastmodifstr.caption
|
||
msgid "Last modification:"
|
||
msgstr "Последнее изменение:"
|
||
|
||
#: tfrmfileproperties.lbllaststchange.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllaststchangestr.caption
|
||
msgid "Last status change:"
|
||
msgstr "Последнее изменение статуса:"
|
||
|
||
#: tfrmfileproperties.lbloctal.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Восьмеричный:"
|
||
|
||
#: tfrmfileproperties.lblownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
|
||
msgid "O&wner"
|
||
msgstr "&Владелец"
|
||
|
||
#: tfrmfileproperties.lblread.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Чтение"
|
||
|
||
#: tfrmfileproperties.lblsize.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsizestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
|
||
msgid "Size:"
|
||
msgstr "Размер:"
|
||
|
||
#: tfrmfileproperties.lblsymlink.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsymlinkstr.caption
|
||
msgid "Symlink to:"
|
||
msgstr "Симв. ссылка"
|
||
|
||
#: tfrmfileproperties.lbltype.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbltypestr.caption
|
||
msgid "Type:"
|
||
msgstr "Тип:"
|
||
|
||
#: tfrmfileproperties.lblwrite.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Запись"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
||
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Имя"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
||
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
||
msgid "Value"
|
||
msgstr "Значение"
|
||
|
||
#: tfrmfileproperties.tsattributes.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Атрибуты"
|
||
|
||
#: tfrmfileproperties.tsplugins.caption
|
||
msgctxt "tfrmfileproperties.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Плагины"
|
||
|
||
#: tfrmfileproperties.tsproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Свойства"
|
||
|
||
#: tfrmfileunlock.btnclose.caption
|
||
msgctxt "tfrmfileunlock.btnclose.caption"
|
||
msgid "Close"
|
||
msgstr "Закрыть"
|
||
|
||
#: tfrmfileunlock.btnterminate.caption
|
||
msgid "Terminate"
|
||
msgstr "Завершить"
|
||
|
||
#: tfrmfileunlock.btnunlock.caption
|
||
msgctxt "tfrmfileunlock.btnunlock.caption"
|
||
msgid "Unlock"
|
||
msgstr "Разблокировать"
|
||
|
||
#: tfrmfileunlock.btnunlockall.caption
|
||
msgid "Unlock All"
|
||
msgstr "Разблокировать все"
|
||
|
||
#: tfrmfileunlock.caption
|
||
msgctxt "tfrmfileunlock.caption"
|
||
msgid "Unlock"
|
||
msgstr "Разблокировать"
|
||
|
||
#: tfrmfileunlock.stgfilehandles.columns[0].title.caption
|
||
msgid "File Handle"
|
||
msgstr "Дескриптор файла"
|
||
|
||
#: tfrmfileunlock.stgfilehandles.columns[1].title.caption
|
||
msgid "Process ID"
|
||
msgstr "ИД процесса"
|
||
|
||
#: tfrmfileunlock.stgfilehandles.columns[2].title.caption
|
||
msgid "Executable Path"
|
||
msgstr "Исполняемый файл"
|
||
|
||
#: tfrmfinddlg.actcancel.caption
|
||
msgctxt "tfrmfinddlg.actcancel.caption"
|
||
msgid "C&ancel"
|
||
msgstr "&Отмена"
|
||
|
||
#: tfrmfinddlg.actcancelclose.caption
|
||
msgid "Cancel search and close window"
|
||
msgstr "Остановить поиск или закрыть окно"
|
||
|
||
#: tfrmfinddlg.actclose.caption
|
||
msgctxt "tfrmfinddlg.actclose.caption"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
||
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Настройка горячих клавиш"
|
||
|
||
#: tfrmfinddlg.actedit.caption
|
||
msgctxt "tfrmfinddlg.actedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Пр&авка"
|
||
|
||
#: tfrmfinddlg.actfeedtolistbox.caption
|
||
msgid "Feed to &listbox"
|
||
msgstr "Фай&лы на панель"
|
||
|
||
#: tfrmfinddlg.actfreefrommem.caption
|
||
msgid "Cancel search, close and free from memory"
|
||
msgstr "Остановить поиск и закрыть окно"
|
||
|
||
#: tfrmfinddlg.actfreefrommemallothers.caption
|
||
msgid "For all other \"Find files\", cancel, close and free from memory"
|
||
msgstr "Остановить и закрыть все другие окна \"Поиск файлов\""
|
||
|
||
#: tfrmfinddlg.actgotofile.caption
|
||
msgid "&Go to file"
|
||
msgstr "Пере&йти к файлу"
|
||
|
||
#: tfrmfinddlg.actintellifocus.caption
|
||
msgctxt "tfrmfinddlg.actintellifocus.caption"
|
||
msgid "Find Data"
|
||
msgstr "С текстом"
|
||
|
||
#: tfrmfinddlg.actlastsearch.caption
|
||
msgid "&Last search"
|
||
msgstr "&Предыдущий поиск"
|
||
|
||
#: tfrmfinddlg.actnewsearch.caption
|
||
msgid "&New search"
|
||
msgstr "Н&овый поиск"
|
||
|
||
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
||
msgid "New search (clear filters)"
|
||
msgstr "Новый поиск (очистить фильтры)"
|
||
|
||
#: tfrmfinddlg.actpageadvanced.caption
|
||
msgid "Go to page \"Advanced\""
|
||
msgstr "Перейти к вкладке \"Расширенный\""
|
||
|
||
#: tfrmfinddlg.actpageloadsave.caption
|
||
msgid "Go to page \"Load/Save\""
|
||
msgstr "Перейти к вкладке \"Загрузить/Сохранить\""
|
||
|
||
#: tfrmfinddlg.actpagenext.caption
|
||
msgid "Switch to Nex&t Page"
|
||
msgstr "Перейти &на следующую вкладку"
|
||
|
||
#: tfrmfinddlg.actpageplugins.caption
|
||
msgid "Go to page \"Plugins\""
|
||
msgstr "Перейти к вкладке \"Плагины\""
|
||
|
||
#: tfrmfinddlg.actpageprev.caption
|
||
msgid "Switch to &Previous Page"
|
||
msgstr "Перейти н&а предыдущую вкладку"
|
||
|
||
#: tfrmfinddlg.actpageresults.caption
|
||
msgid "Go to page \"Results\""
|
||
msgstr "Перейти к вкладке \"Результаты\""
|
||
|
||
#: tfrmfinddlg.actpagestandard.caption
|
||
msgid "Go to page \"Standard\""
|
||
msgstr "Перейти к вкладке \"Стандартный\""
|
||
|
||
#: tfrmfinddlg.actstart.caption
|
||
msgctxt "tfrmfinddlg.actstart.caption"
|
||
msgid "&Start"
|
||
msgstr "&Старт"
|
||
|
||
#: tfrmfinddlg.actview.caption
|
||
msgctxt "tfrmfinddlg.actview.caption"
|
||
msgid "&View"
|
||
msgstr "П&росмотр"
|
||
|
||
#: tfrmfinddlg.btnaddattribute.caption
|
||
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmfinddlg.btnattrshelp.caption
|
||
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Помощ&ь"
|
||
|
||
#: tfrmfinddlg.btnsavetemplate.caption
|
||
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Сохранить"
|
||
|
||
#: tfrmfinddlg.btnsearchdelete.caption
|
||
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmfinddlg.btnsearchload.caption
|
||
msgid "L&oad"
|
||
msgstr "З&агрузить"
|
||
|
||
#: tfrmfinddlg.btnsearchsave.caption
|
||
msgid "S&ave"
|
||
msgstr "Со&хранить"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
||
msgid "Sa&ve with \"Start in directory\""
|
||
msgstr "Сох&ранить с \"Начинать с каталога\""
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
||
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
||
msgstr "При нажатии сохраняется значение \"Начинать с каталога\". Используйте, если хотите начинать поиск только с определенного каталога"
|
||
|
||
#: tfrmfinddlg.btnusetemplate.caption
|
||
msgid "Use template"
|
||
msgstr "Использовать шаблон"
|
||
|
||
#: tfrmfinddlg.caption
|
||
msgctxt "tfrmfinddlg.caption"
|
||
msgid "Find files"
|
||
msgstr "Поиск файлов"
|
||
|
||
#: tfrmfinddlg.cbcasesens.caption
|
||
msgid "Case sens&itive"
|
||
msgstr "С &учётом регистра"
|
||
|
||
#: tfrmfinddlg.cbdatefrom.caption
|
||
msgid "&Date from:"
|
||
msgstr "&Дата от:"
|
||
|
||
#: tfrmfinddlg.cbdateto.caption
|
||
msgid "Dat&e to:"
|
||
msgstr "Да&та до:"
|
||
|
||
#: tfrmfinddlg.cbfilesizefrom.caption
|
||
msgid "S&ize from:"
|
||
msgstr "Р&азмер от:"
|
||
|
||
#: tfrmfinddlg.cbfilesizeto.caption
|
||
msgid "Si&ze to:"
|
||
msgstr "Раз&мер до:"
|
||
|
||
#: tfrmfinddlg.cbfindinarchive.caption
|
||
msgid "Search in &archives"
|
||
msgstr "Искать в ар&хивах"
|
||
|
||
#: tfrmfinddlg.cbfindtext.caption
|
||
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
|
||
msgid "Find &text in file"
|
||
msgstr "Искать в файле &текст"
|
||
|
||
#: tfrmfinddlg.cbfollowsymlinks.caption
|
||
msgctxt "tfrmfinddlg.cbfollowsymlinks.caption"
|
||
msgid "Follow s&ymlinks"
|
||
msgstr "С&ледовать ссылкам"
|
||
|
||
#: tfrmfinddlg.cbnotcontainingtext.caption
|
||
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
|
||
msgid "Find files N&OT containing the text"
|
||
msgstr "Файлы, &НЕ содержащие этот текст"
|
||
|
||
#: tfrmfinddlg.cbnotolderthan.caption
|
||
msgid "N&ot older than:"
|
||
msgstr "Н&е старше:"
|
||
|
||
#: tfrmfinddlg.cbopenedtabs.caption
|
||
msgid "Opened tabs"
|
||
msgstr "В открытых вкладках"
|
||
|
||
#: tfrmfinddlg.cbpartialnamesearch.caption
|
||
msgid "Searc&h for part of file name"
|
||
msgstr "Поис&к по части имени"
|
||
|
||
#: tfrmfinddlg.cbregexp.caption
|
||
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
|
||
msgid "&Regular expression"
|
||
msgstr "&Регулярное выражение"
|
||
|
||
#: tfrmfinddlg.cbreplacetext.caption
|
||
msgid "Re&place by"
|
||
msgstr "З&аменить текст"
|
||
|
||
#: tfrmfinddlg.cbselectedfiles.caption
|
||
msgid "Selected directories and &files"
|
||
msgstr "&Выбранные файлы и каталоги"
|
||
|
||
#: tfrmfinddlg.cbtextregexp.caption
|
||
msgid "Regular &expression"
|
||
msgstr "Регулярное &выражение"
|
||
|
||
#: tfrmfinddlg.cbtimefrom.caption
|
||
msgid "&Time from:"
|
||
msgstr "&Время от:"
|
||
|
||
#: tfrmfinddlg.cbtimeto.caption
|
||
msgid "Ti&me to:"
|
||
msgstr "В&ремя до:"
|
||
|
||
#: tfrmfinddlg.cbuseplugin.caption
|
||
msgid "&Use search plugin:"
|
||
msgstr "&Использовать поисковый плагин:"
|
||
|
||
#: tfrmfinddlg.chkhex.caption
|
||
msgid "Hexadecimal"
|
||
msgstr "Шестнадцатеричное"
|
||
|
||
#: tfrmfinddlg.cmbexcludedirectories.hint
|
||
msgid "Enter directories names that should be excluded from search separated with \";\""
|
||
msgstr "Перечислите через \";\" имена каталогов, которые должны быть исключены из поиска"
|
||
|
||
#: tfrmfinddlg.cmbexcludefiles.hint
|
||
msgid "Enter files names that should be excluded from search separated with \";\""
|
||
msgstr "Перечислите через \";\" имена файлов, которые должны быть исключены из поиска"
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.hint
|
||
msgid "Enter files names separated with \";\""
|
||
msgstr "Введите имя файла или несколько имён, разделяя символом \";\""
|
||
|
||
#: tfrmfinddlg.gbdirectories.caption
|
||
msgctxt "tfrmfinddlg.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Каталоги"
|
||
|
||
#: tfrmfinddlg.gbfiles.caption
|
||
msgctxt "tfrmfinddlg.gbfiles.caption"
|
||
msgid "Files"
|
||
msgstr "Файлы"
|
||
|
||
#: tfrmfinddlg.gbfinddata.caption
|
||
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
||
msgid "Find Data"
|
||
msgstr "С текстом"
|
||
|
||
#: tfrmfinddlg.lblattributes.caption
|
||
msgctxt "tfrmfinddlg.lblattributes.caption"
|
||
msgid "Attri&butes"
|
||
msgstr "Атри&буты"
|
||
|
||
#: tfrmfinddlg.lblencoding.caption
|
||
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
|
||
msgid "Encodin&g:"
|
||
msgstr "Ко&дировка:"
|
||
|
||
#: tfrmfinddlg.lblexcludedirectories.caption
|
||
msgid "E&xclude subdirectories"
|
||
msgstr "Искл&ючить подкаталоги"
|
||
|
||
#: tfrmfinddlg.lblexcludefiles.caption
|
||
msgid "&Exclude files"
|
||
msgstr "&Исключить файлы:"
|
||
|
||
#: tfrmfinddlg.lblfindfilemask.caption
|
||
msgid "&File mask"
|
||
msgstr "Искать &файлы:"
|
||
|
||
#: tfrmfinddlg.lblfindpathstart.caption
|
||
msgid "Start in &directory"
|
||
msgstr "Н&ачинать с каталога:"
|
||
|
||
#: tfrmfinddlg.lblsearchdepth.caption
|
||
msgid "Search su&bdirectories:"
|
||
msgstr "Глубина вло&женности подкаталогов:"
|
||
|
||
#: tfrmfinddlg.lbltemplateheader.caption
|
||
msgid "&Previous searches:"
|
||
msgstr "Сохранённые &шаблоны поиска:"
|
||
|
||
#: tfrmfinddlg.miaction.caption
|
||
msgid "&Action"
|
||
msgstr "&Действие"
|
||
|
||
#: tfrmfinddlg.mifreefrommemallothers.caption
|
||
msgid "For all others, cancel, close and free from memory"
|
||
msgstr "Остановить и закрыть все другие окна"
|
||
|
||
#: tfrmfinddlg.miopeninnewtab.caption
|
||
msgid "Open In New Tab(s)"
|
||
msgstr "Открыть в новой вкладке(ах)"
|
||
|
||
#: tfrmfinddlg.mioptions.caption
|
||
msgctxt "tfrmfinddlg.mioptions.caption"
|
||
msgid "Options"
|
||
msgstr "Настройки"
|
||
|
||
#: tfrmfinddlg.miremovefromllist.caption
|
||
msgid "Remove from list"
|
||
msgstr "Убрать из списка"
|
||
|
||
#: tfrmfinddlg.miresult.caption
|
||
msgid "&Result"
|
||
msgstr "&Результат"
|
||
|
||
#: tfrmfinddlg.mishowallfound.caption
|
||
msgid "Show all found items"
|
||
msgstr "Показать все найденные элементы"
|
||
|
||
#: tfrmfinddlg.mishowineditor.caption
|
||
msgid "Show In Editor"
|
||
msgstr "Показать в редакторе"
|
||
|
||
#: tfrmfinddlg.mishowinviewer.caption
|
||
msgid "Show In Viewer"
|
||
msgstr "Просмотр"
|
||
|
||
#: tfrmfinddlg.miviewtab.caption
|
||
msgctxt "tfrmfinddlg.miviewtab.caption"
|
||
msgid "&View"
|
||
msgstr "&Вид"
|
||
|
||
#: tfrmfinddlg.tsadvanced.caption
|
||
msgid "Advanced"
|
||
msgstr "Расширенный"
|
||
|
||
#: tfrmfinddlg.tsloadsave.caption
|
||
msgid "Load/Save"
|
||
msgstr "Шаблоны поиска"
|
||
|
||
#: tfrmfinddlg.tsplugins.caption
|
||
msgctxt "tfrmfinddlg.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Плагины"
|
||
|
||
#: tfrmfinddlg.tsresults.caption
|
||
msgid "Results"
|
||
msgstr "Результаты"
|
||
|
||
#: tfrmfinddlg.tsstandard.caption
|
||
msgid "Standard"
|
||
msgstr "Стандартный"
|
||
|
||
#: tfrmfindview.btnclose.caption
|
||
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmfindview.btnfind.caption
|
||
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
||
msgid "&Find"
|
||
msgstr "&Найти"
|
||
|
||
#: tfrmfindview.caption
|
||
msgctxt "TFRMFINDVIEW.CAPTION"
|
||
msgid "Find"
|
||
msgstr "Найти"
|
||
|
||
#: tfrmfindview.cbcasesens.caption
|
||
msgid "C&ase sensitive"
|
||
msgstr "С учётом &регистра"
|
||
|
||
#: tfrmhardlink.btncancel.caption
|
||
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmhardlink.btnok.caption
|
||
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmhardlink.caption
|
||
msgid "Create hard link"
|
||
msgstr "Создать жёсткую ссылку"
|
||
|
||
#: tfrmhardlink.lblexistingfile.caption
|
||
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "На &что указывает"
|
||
|
||
#: tfrmhardlink.lbllinktocreate.caption
|
||
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "&Имя ссылки"
|
||
|
||
#: tfrmhotdirexportimport.btnselectall.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
|
||
msgid "Import all!"
|
||
msgstr "Импортировать все"
|
||
|
||
#: tfrmhotdirexportimport.btnselectiondone.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
|
||
msgid "Import selected"
|
||
msgstr "Импортировать выделенный"
|
||
|
||
#: tfrmhotdirexportimport.caption
|
||
msgctxt "tfrmhotdirexportimport.caption"
|
||
msgid "Select the entries your want to import"
|
||
msgstr "Выделите элементы для импорта"
|
||
|
||
#: tfrmhotdirexportimport.lbhint.caption
|
||
msgctxt "tfrmhotdirexportimport.lbhint.caption"
|
||
msgid "When clicking a sub-menu, it will select the whole menu"
|
||
msgstr "При выборе подменю будет выделено всё подменю"
|
||
|
||
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
||
msgid "Hold CTRL and click entries to select multiple ones"
|
||
msgstr "Зажав клавишу Ctrl можно выделить сразу несколько записей"
|
||
|
||
#: tfrmlinker.btnsave.caption
|
||
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmlinker.caption
|
||
msgctxt "TFRMLINKER.CAPTION"
|
||
msgid "Linker"
|
||
msgstr "Сборка"
|
||
|
||
#: tfrmlinker.gbsaveto.caption
|
||
msgid "Save to..."
|
||
msgstr "Сохранить как..."
|
||
|
||
#: tfrmlinker.grbxcontrol.caption
|
||
msgid "Item"
|
||
msgstr "Элемент"
|
||
|
||
#: tfrmlinker.lblfilename.caption
|
||
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
|
||
msgid "&File name"
|
||
msgstr "Имя &файла"
|
||
|
||
#: tfrmlinker.spbtndown.caption
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
|
||
msgid "Do&wn"
|
||
msgstr "&Вниз"
|
||
|
||
#: tfrmlinker.spbtndown.hint
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
|
||
msgid "Down"
|
||
msgstr "Вниз"
|
||
|
||
#: tfrmlinker.spbtnrem.caption
|
||
msgctxt "tfrmlinker.spbtnrem.caption"
|
||
msgid "&Remove"
|
||
msgstr "Уда&лить"
|
||
|
||
#: tfrmlinker.spbtnrem.hint
|
||
msgctxt "tfrmlinker.spbtnrem.hint"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: tfrmlinker.spbtnup.caption
|
||
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
|
||
msgid "&Up"
|
||
msgstr "Вв&ерх"
|
||
|
||
#: tfrmlinker.spbtnup.hint
|
||
msgctxt "TFRMLINKER.SPBTNUP.HINT"
|
||
msgid "Up"
|
||
msgstr "Вверх"
|
||
|
||
#: tfrmmain.actabout.caption
|
||
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
|
||
msgid "&About"
|
||
msgstr "&О программе..."
|
||
|
||
#: tfrmmain.actactivatetabbyindex.caption
|
||
msgid "Activate Tab By Index"
|
||
msgstr "Активировать вкладку по индексу"
|
||
|
||
#: tfrmmain.actaddfilenametocmdline.caption
|
||
msgid "Add file name to command line"
|
||
msgstr "Добавить имя файла в командную строку"
|
||
|
||
#: tfrmmain.actaddnewsearch.caption
|
||
msgid "New search instance..."
|
||
msgstr "Новый экземпляр поиска..."
|
||
|
||
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
||
msgid "Add path and file name to command line"
|
||
msgstr "Добавить путь и имя файла в командную строку"
|
||
|
||
#: tfrmmain.actaddpathtocmdline.caption
|
||
msgid "Copy path to command line"
|
||
msgstr "Копировать путь в командную строку"
|
||
|
||
#: tfrmmain.actbenchmark.caption
|
||
msgid "&Benchmark"
|
||
msgstr "&Тест производительности"
|
||
|
||
#: tfrmmain.actbriefview.caption
|
||
msgctxt "tfrmmain.actbriefview.caption"
|
||
msgid "Brief view"
|
||
msgstr "Краткий"
|
||
|
||
#: tfrmmain.actbriefview.hint
|
||
msgid "Brief View"
|
||
msgstr "Краткий вид"
|
||
|
||
#: tfrmmain.actcalculatespace.caption
|
||
msgid "Calculate &Occupied Space"
|
||
msgstr "Подсчитать &занимаемое место..."
|
||
|
||
#: tfrmmain.actchangedir.caption
|
||
msgid "Change directory"
|
||
msgstr "Сменить каталог"
|
||
|
||
#: tfrmmain.actchangedirtohome.caption
|
||
msgid "Change directory to home"
|
||
msgstr "Перейти в домашний каталог"
|
||
|
||
#: tfrmmain.actchangedirtoparent.caption
|
||
msgid "Change Directory To Parent"
|
||
msgstr "Перейти в родительский каталог"
|
||
|
||
#: tfrmmain.actchangedirtoroot.caption
|
||
msgid "Change directory to root"
|
||
msgstr "Перейти в корневой каталог"
|
||
|
||
#: tfrmmain.actchecksumcalc.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
|
||
msgid "Calculate Check&sum..."
|
||
msgstr "Посчитать &контрольные суммы..."
|
||
|
||
#: tfrmmain.actchecksumverify.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
|
||
msgid "&Verify Checksum..."
|
||
msgstr "Проверить ко&нтрольные суммы..."
|
||
|
||
#: tfrmmain.actclearlogfile.caption
|
||
msgid "Clear log file"
|
||
msgstr "Очистить файл протокола"
|
||
|
||
#: tfrmmain.actclearlogwindow.caption
|
||
msgid "Clear log window"
|
||
msgstr "Очистить окно протокола"
|
||
|
||
#: tfrmmain.actclosealltabs.caption
|
||
msgctxt "tfrmmain.actclosealltabs.caption"
|
||
msgid "Close &All Tabs"
|
||
msgstr "Закрыть &все вкладки"
|
||
|
||
#: tfrmmain.actcloseduplicatetabs.caption
|
||
msgid "Close Duplicate Tabs"
|
||
msgstr "Закрыть &дубликаты вкладок"
|
||
|
||
#: tfrmmain.actclosetab.caption
|
||
msgctxt "tfrmmain.actclosetab.caption"
|
||
msgid "&Close Tab"
|
||
msgstr "&Закрыть вкладку"
|
||
|
||
#: tfrmmain.actcmdlinenext.caption
|
||
msgid "Next Command Line"
|
||
msgstr "Следующая командная строка"
|
||
|
||
#: tfrmmain.actcmdlinenext.hint
|
||
msgid "Set command line to next command in history"
|
||
msgstr "Выбрать следующую команду в истории командной строки"
|
||
|
||
#: tfrmmain.actcmdlineprev.caption
|
||
msgid "Previous Command Line"
|
||
msgstr "Предыдущая командная строка"
|
||
|
||
#: tfrmmain.actcmdlineprev.hint
|
||
msgid "Set command line to previous command in history"
|
||
msgstr "Выбрать предыдущую команду в истории командной строки"
|
||
|
||
#: tfrmmain.actcolumnsview.caption
|
||
msgid "Full"
|
||
msgstr "Подробный"
|
||
|
||
#: tfrmmain.actcolumnsview.hint
|
||
msgid "Columns View"
|
||
msgstr "Подробный вид"
|
||
|
||
#: tfrmmain.actcomparecontents.caption
|
||
msgid "Compare by &Contents"
|
||
msgstr "Сравнить п&о содержимому"
|
||
|
||
#: tfrmmain.actcomparedirectories.caption
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
|
||
msgid "Compare Directories"
|
||
msgstr "Сравнить &каталоги"
|
||
|
||
#: tfrmmain.actcomparedirectories.hint
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
||
msgid "Compare Directories"
|
||
msgstr "Сравнить каталоги"
|
||
|
||
#: tfrmmain.actconfigarchivers.caption
|
||
msgid "Configuration of Archivers"
|
||
msgstr "Настройка архиваторов"
|
||
|
||
#: tfrmmain.actconfigdirhotlist.caption
|
||
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Настройка избранных каталогов"
|
||
|
||
#: tfrmmain.actconfigfavoritetabs.caption
|
||
msgid "Configuration of Favorite Tabs"
|
||
msgstr "Настройка избранных вкладок"
|
||
|
||
#: tfrmmain.actconfigfoldertabs.caption
|
||
msgid "Configuration of folder tabs"
|
||
msgstr "Настройка вкладок папок"
|
||
|
||
#: tfrmmain.actconfighotkeys.caption
|
||
msgctxt "tfrmmain.actconfighotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Настройка горячих клавиш"
|
||
|
||
#: tfrmmain.actconfigplugins.caption
|
||
msgid "Configuration of Plugins"
|
||
msgstr "Настройка плагинов"
|
||
|
||
#: tfrmmain.actconfigsavesettings.caption
|
||
msgid "Save Settings"
|
||
msgstr "Со&хранить настройки"
|
||
|
||
#: tfrmmain.actconfigsearches.caption
|
||
msgid "Configuration of searches"
|
||
msgstr "Настройка поиска"
|
||
|
||
#: tfrmmain.actconfigtoolbars.caption
|
||
msgid "Toolbar..."
|
||
msgstr "Панель инструментов..."
|
||
|
||
#: tfrmmain.actconfigtooltips.caption
|
||
msgid "Configuration of tooltips"
|
||
msgstr "Настройка всплывающих подсказок"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenus.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Настройка древовидного меню"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Настройка цветов древовидного меню"
|
||
|
||
#: tfrmmain.actcontextmenu.caption
|
||
msgid "Show context menu"
|
||
msgstr "Показать контекстное меню"
|
||
|
||
#: tfrmmain.actcopy.caption
|
||
msgctxt "tfrmmain.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Копировать"
|
||
|
||
#: tfrmmain.actcopyalltabstoopposite.caption
|
||
msgid "Copy all tabs to opposite side"
|
||
msgstr "Скопировать все вкладки на противоположную панель"
|
||
|
||
#: tfrmmain.actcopyfiledetailstoclip.caption
|
||
msgid "Copy all shown &columns"
|
||
msgstr "Копировать &содержимое всех колонок"
|
||
|
||
#: tfrmmain.actcopyfullnamestoclip.caption
|
||
msgid "Copy Filename(s) with Full &Path"
|
||
msgstr "Копировать по&лные имена файлов"
|
||
|
||
#: tfrmmain.actcopynamestoclip.caption
|
||
msgid "Copy &Filename(s) to Clipboard"
|
||
msgstr "Копировать имена фа&йлов в буфер"
|
||
|
||
#: tfrmmain.actcopynoask.caption
|
||
msgid "Copy files without asking for confirmation"
|
||
msgstr "Копировать файлы без запроса подтверждения"
|
||
|
||
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
||
msgstr "Копировать полный путь выделенного файла(ов) без конечного разделителя каталогов"
|
||
|
||
#: tfrmmain.actcopypathoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s)"
|
||
msgstr "Копировать полный путь выделенного файла(ов)"
|
||
|
||
#: tfrmmain.actcopysamepanel.caption
|
||
msgid "Copy to same panel"
|
||
msgstr "Копировать в ту же панель"
|
||
|
||
#: tfrmmain.actcopytoclipboard.caption
|
||
msgid "&Copy"
|
||
msgstr "&Копировать"
|
||
|
||
#: tfrmmain.actcountdircontent.caption
|
||
msgid "Sho&w Occupied Space"
|
||
msgstr "Показать размеры все&х папок"
|
||
|
||
#: tfrmmain.actcuttoclipboard.caption
|
||
msgid "Cu&t"
|
||
msgstr "&Вырезать"
|
||
|
||
#: tfrmmain.actdebugshowcommandparameters.caption
|
||
msgid "Show Command Parameters"
|
||
msgstr "Показать параметры команды"
|
||
|
||
#: tfrmmain.actdelete.caption
|
||
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: tfrmmain.actdeletesearches.caption
|
||
msgid "For all searches, cancel, close and free memory"
|
||
msgstr "Остановить и закрыть все окна"
|
||
|
||
#: tfrmmain.actdirhistory.caption
|
||
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
|
||
msgid "Directory history"
|
||
msgstr "История каталогов"
|
||
|
||
#: tfrmmain.actdirhotlist.caption
|
||
msgid "Directory &Hotlist"
|
||
msgstr "&Избранные каталоги"
|
||
|
||
#: tfrmmain.actdoanycmcommand.caption
|
||
msgid "Select any command and execute it"
|
||
msgstr "Выбрать любую команду и выполнить её"
|
||
|
||
#: tfrmmain.actedit.caption
|
||
msgctxt "tfrmmain.actedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Правка"
|
||
|
||
#: tfrmmain.acteditcomment.caption
|
||
msgid "Edit Co&mment..."
|
||
msgstr "Редактировать ко&мментарий..."
|
||
|
||
#: tfrmmain.acteditnew.caption
|
||
msgid "Edit new file"
|
||
msgstr "Редактировать новый"
|
||
|
||
#: tfrmmain.acteditpath.caption
|
||
msgid "Edit path field above file list"
|
||
msgstr "Редактировать путь в заголовке панели"
|
||
|
||
#: tfrmmain.actexchange.caption
|
||
msgid "Swap &Panels"
|
||
msgstr "П&оменять панели местами"
|
||
|
||
#: tfrmmain.actexecutescript.caption
|
||
msgid "Execute Script"
|
||
msgstr "Выполнить скрипт"
|
||
|
||
#: tfrmmain.actexit.caption
|
||
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "В&ыход"
|
||
|
||
#: tfrmmain.actextractfiles.caption
|
||
msgid "&Extract Files..."
|
||
msgstr "Р&аспаковать..."
|
||
|
||
#: tfrmmain.actfileassoc.caption
|
||
msgid "Configuration of File &Associations"
|
||
msgstr "Настройка файловых &ассоциаций"
|
||
|
||
#: tfrmmain.actfilelinker.caption
|
||
msgid "Com&bine Files..."
|
||
msgstr "Объединить &файлы..."
|
||
|
||
#: tfrmmain.actfileproperties.caption
|
||
msgid "Show &File Properties"
|
||
msgstr "С&войства..."
|
||
|
||
#: tfrmmain.actfilespliter.caption
|
||
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
|
||
msgid "Spl&it File..."
|
||
msgstr "&Разрезать файл..."
|
||
|
||
#: tfrmmain.actflatview.caption
|
||
msgid "&Flat view"
|
||
msgstr "Показать все фа&йлы без подкаталогов"
|
||
|
||
#: tfrmmain.actfocuscmdline.caption
|
||
msgid "Focus command line"
|
||
msgstr "Перейти к командной строке"
|
||
|
||
#: tfrmmain.actfocusswap.caption
|
||
msgid "Swap focus"
|
||
msgstr "Сменить фокус"
|
||
|
||
#: tfrmmain.actfocusswap.hint
|
||
msgid "Switch between left and right file list"
|
||
msgstr "Переключиться на другую файловую панель"
|
||
|
||
#: tfrmmain.actfocustreeview.caption
|
||
msgid "Focus on tree view"
|
||
msgstr "Перейти в дерево каталогов"
|
||
|
||
#: tfrmmain.actfocustreeview.hint
|
||
msgid "Switch between current file list and tree view (if enabled)"
|
||
msgstr "Переключиться между списком файлов и деревом (если включено)"
|
||
|
||
#: tfrmmain.actgotofirstfile.caption
|
||
msgid "Place cursor on first file in list"
|
||
msgstr "Поместить курсор на первый файл в списке"
|
||
|
||
#: tfrmmain.actgotolastfile.caption
|
||
msgid "Place cursor on last file in list"
|
||
msgstr "Поместить курсор на последний файл в списке"
|
||
|
||
#: tfrmmain.acthardlink.caption
|
||
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
|
||
msgid "Create &Hard Link..."
|
||
msgstr "Создать &жёсткую ссылку..."
|
||
|
||
#: tfrmmain.acthelpindex.caption
|
||
msgid "&Contents"
|
||
msgstr "&Содержание"
|
||
|
||
#: tfrmmain.acthorizontalfilepanels.caption
|
||
msgid "&Horizontal Panels Mode"
|
||
msgstr "&Панели одна над другой"
|
||
|
||
#: tfrmmain.actkeyboard.caption
|
||
msgid "&Keyboard"
|
||
msgstr "&Горячие клавиши"
|
||
|
||
#: tfrmmain.actleftbriefview.caption
|
||
msgid "Brief view on left panel"
|
||
msgstr "Краткий вид в левой панели"
|
||
|
||
#: tfrmmain.actleftcolumnsview.caption
|
||
msgid "Columns view on left panel"
|
||
msgstr "Подробный вид в левой панели"
|
||
|
||
#: tfrmmain.actleftequalright.caption
|
||
msgid "Left &= Right"
|
||
msgstr "Левая &= Правая"
|
||
|
||
#: tfrmmain.actleftflatview.caption
|
||
msgid "&Flat view on left panel"
|
||
msgstr "Показать все фа&йлы без подкаталогов в левой панели"
|
||
|
||
#: tfrmmain.actleftopendrives.caption
|
||
msgid "Open left drive list"
|
||
msgstr "Открыть список дисков слева"
|
||
|
||
#: tfrmmain.actleftreverseorder.caption
|
||
msgid "Re&verse order on left panel"
|
||
msgstr "Обра&тить порядок в левой панели"
|
||
|
||
#: tfrmmain.actleftsortbyattr.caption
|
||
msgid "Sort left panel by &Attributes"
|
||
msgstr "Сортировать по &атрибутам в левой панели"
|
||
|
||
#: tfrmmain.actleftsortbydate.caption
|
||
msgid "Sort left panel by &Date"
|
||
msgstr "Сортировать по &дате в левой панели"
|
||
|
||
#: tfrmmain.actleftsortbyext.caption
|
||
msgid "Sort left panel by &Extension"
|
||
msgstr "Сортировать по &расширению в левой панели"
|
||
|
||
#: tfrmmain.actleftsortbyname.caption
|
||
msgid "Sort left panel by &Name"
|
||
msgstr "Сортировать по &имени в левой панели"
|
||
|
||
#: tfrmmain.actleftsortbysize.caption
|
||
msgid "Sort left panel by &Size"
|
||
msgstr "Сортировать по &размеру в левой панели"
|
||
|
||
#: tfrmmain.actleftthumbview.caption
|
||
msgid "Thumbnails view on left panel"
|
||
msgstr "Просмотр эскизов в левой панели"
|
||
|
||
#: tfrmmain.actloadfavoritetabs.caption
|
||
msgid "Load tabs from Favorite Tabs"
|
||
msgstr "Загрузить вкладки из избранных вкладок"
|
||
|
||
#: tfrmmain.actloadselectionfromclip.caption
|
||
msgid "Load Selection from Clip&board"
|
||
msgstr "Загрузить выделение из &буфера"
|
||
|
||
#: tfrmmain.actloadselectionfromfile.caption
|
||
msgid "&Load Selection from File..."
|
||
msgstr "Загрузить выделение из &файла..."
|
||
|
||
#: tfrmmain.actloadtabs.caption
|
||
msgid "&Load Tabs from File"
|
||
msgstr "Загрузить вкладки из файла"
|
||
|
||
#: tfrmmain.actmakedir.caption
|
||
msgid "Create &Directory"
|
||
msgstr "Создать &каталог"
|
||
|
||
#: tfrmmain.actmarkcurrentextension.caption
|
||
msgid "Select All with the Same E&xtension"
|
||
msgstr "Выделить файлы по рас&ширению"
|
||
|
||
#: tfrmmain.actmarkcurrentname.caption
|
||
msgid "Select all files with same name"
|
||
msgstr "Выделить все файлы по текущему имени"
|
||
|
||
#: tfrmmain.actmarkcurrentnameext.caption
|
||
msgid "Select all files with same name and extension"
|
||
msgstr "Выделить все файлы по текущему имени и расширению"
|
||
|
||
#: tfrmmain.actmarkcurrentpath.caption
|
||
msgid "Select all in same path"
|
||
msgstr "Выделить все с этим путём"
|
||
|
||
#: tfrmmain.actmarkinvert.caption
|
||
msgid "&Invert Selection"
|
||
msgstr "&Инвертировать выделение"
|
||
|
||
#: tfrmmain.actmarkmarkall.caption
|
||
msgid "&Select All"
|
||
msgstr "&Выделить все"
|
||
|
||
#: tfrmmain.actmarkminus.caption
|
||
msgid "Unselect a Gro&up..."
|
||
msgstr "&Снять выделение с группы..."
|
||
|
||
#: tfrmmain.actmarkplus.caption
|
||
msgid "Select a &Group..."
|
||
msgstr "Выделить &группу..."
|
||
|
||
#: tfrmmain.actmarkunmarkall.caption
|
||
msgid "&Unselect All"
|
||
msgstr "С&нять выделение со всех"
|
||
|
||
#: tfrmmain.actminimize.caption
|
||
msgid "Minimize window"
|
||
msgstr "Свернуть"
|
||
|
||
#: tfrmmain.actmultirename.caption
|
||
msgid "Multi &Rename Tool"
|
||
msgstr "Групповое &переименование"
|
||
|
||
#: tfrmmain.actnetworkconnect.caption
|
||
msgid "Network &Connect..."
|
||
msgstr "&Соединиться с сервером..."
|
||
|
||
#: tfrmmain.actnetworkdisconnect.caption
|
||
msgid "Network &Disconnect"
|
||
msgstr "Ра&зорвать соединение"
|
||
|
||
#: tfrmmain.actnetworkquickconnect.caption
|
||
msgid "Network &Quick Connect..."
|
||
msgstr "&Новое соединение..."
|
||
|
||
#: tfrmmain.actnewtab.caption
|
||
msgid "&New Tab"
|
||
msgstr "Н&овая вкладка"
|
||
|
||
#: tfrmmain.actnextfavoritetabs.caption
|
||
msgid "Load the Next Favorite Tabs in the list"
|
||
msgstr "Загрузить следующие в списке избранные вкладки"
|
||
|
||
#: tfrmmain.actnexttab.caption
|
||
msgid "Switch to Nex&t Tab"
|
||
msgstr "Переключиться на &следующую вкладку"
|
||
|
||
#: tfrmmain.actopen.caption
|
||
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Открыть"
|
||
|
||
#: tfrmmain.actopenarchive.caption
|
||
msgid "Try open archive"
|
||
msgstr "Попробовать открыть архив"
|
||
|
||
#: tfrmmain.actopenbar.caption
|
||
msgid "Open bar file"
|
||
msgstr "Открыть BAR-файл"
|
||
|
||
#: tfrmmain.actopendirinnewtab.caption
|
||
msgid "Open &Folder in a New Tab"
|
||
msgstr "Открыть пап&ку в новой вкладке"
|
||
|
||
#: tfrmmain.actopendrivebyindex.caption
|
||
msgid "Open Drive by Index"
|
||
msgstr "Открыть диск по индексу"
|
||
|
||
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
||
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
|
||
msgid "Open &VFS List"
|
||
msgstr "Откр&ыть список VFS"
|
||
|
||
#: tfrmmain.actoperationsviewer.caption
|
||
msgid "Operations &Viewer"
|
||
msgstr "Фа&йловые операции"
|
||
|
||
#: tfrmmain.actoptions.caption
|
||
msgid "&Options..."
|
||
msgstr "&Параметры..."
|
||
|
||
#: tfrmmain.actpackfiles.caption
|
||
msgid "&Pack Files..."
|
||
msgstr "&Упаковать..."
|
||
|
||
#: tfrmmain.actpanelssplitterperpos.caption
|
||
msgid "Set splitter position"
|
||
msgstr "Установить позицию разделителя"
|
||
|
||
#: tfrmmain.actpastefromclipboard.caption
|
||
msgid "&Paste"
|
||
msgstr "&Вставить"
|
||
|
||
#: tfrmmain.actpreviousfavoritetabs.caption
|
||
msgid "Load the Previous Favorite Tabs in the list"
|
||
msgstr "Загрузить предыдущие в списке избранные вкладки"
|
||
|
||
#: tfrmmain.actprevtab.caption
|
||
msgid "Switch to &Previous Tab"
|
||
msgstr "Переключиться на &предыдущую вкладку"
|
||
|
||
#: tfrmmain.actquickfilter.caption
|
||
msgid "Quick filter"
|
||
msgstr "Быстрый фильтр"
|
||
|
||
#: tfrmmain.actquicksearch.caption
|
||
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
|
||
msgid "Quick search"
|
||
msgstr "Быстрый поиск"
|
||
|
||
#: tfrmmain.actquickview.caption
|
||
msgid "&Quick View Panel"
|
||
msgstr "&Быстрый просмотр"
|
||
|
||
#: tfrmmain.actrefresh.caption
|
||
msgid "&Refresh"
|
||
msgstr "&Обновить"
|
||
|
||
#: tfrmmain.actreloadfavoritetabs.caption
|
||
msgid "Reload the last Favorite Tabs loaded"
|
||
msgstr "Перезагрузить последние загруженные избранные вкладки"
|
||
|
||
#: tfrmmain.actrename.caption
|
||
msgctxt "tfrmmain.actrename.caption"
|
||
msgid "Move"
|
||
msgstr "Переместить"
|
||
|
||
#: tfrmmain.actrenamenoask.caption
|
||
msgid "Move/Rename files without asking for confirmation"
|
||
msgstr "Переместить файлы без запроса подтверждения"
|
||
|
||
#: tfrmmain.actrenameonly.caption
|
||
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Переименовать"
|
||
|
||
#: tfrmmain.actrenametab.caption
|
||
msgid "&Rename Tab"
|
||
msgstr "Переи&меновать вкладку"
|
||
|
||
#: tfrmmain.actresavefavoritetabs.caption
|
||
msgid "Resave on the last Favorite Tabs loaded"
|
||
msgstr "Пересохранить последние загруженные избранные вкладки"
|
||
|
||
#: tfrmmain.actrestoreselection.caption
|
||
msgid "&Restore Selection"
|
||
msgstr "Восс&тановить выделение"
|
||
|
||
#: tfrmmain.actreverseorder.caption
|
||
msgid "Re&verse Order"
|
||
msgstr "Обра&тный п&орядок"
|
||
|
||
#: tfrmmain.actrightbriefview.caption
|
||
msgid "Brief view on right panel"
|
||
msgstr "Краткий вид в правой панели"
|
||
|
||
#: tfrmmain.actrightcolumnsview.caption
|
||
msgid "Columns view on right panel"
|
||
msgstr "Подробный вид в правой панели"
|
||
|
||
#: tfrmmain.actrightequalleft.caption
|
||
msgid "Right &= Left"
|
||
msgstr "Правая &= Левая"
|
||
|
||
#: tfrmmain.actrightflatview.caption
|
||
msgid "&Flat view on right panel"
|
||
msgstr "Показать все фа&йлы без подкаталогов в правой панели"
|
||
|
||
#: tfrmmain.actrightopendrives.caption
|
||
msgid "Open right drive list"
|
||
msgstr "Открыть список дисков справа"
|
||
|
||
#: tfrmmain.actrightreverseorder.caption
|
||
msgid "Re&verse order on right panel"
|
||
msgstr "Обра&тить порядок в правой панели"
|
||
|
||
#: tfrmmain.actrightsortbyattr.caption
|
||
msgid "Sort right panel by &Attributes"
|
||
msgstr "Сортировать по &атрибутам в правой панели"
|
||
|
||
#: tfrmmain.actrightsortbydate.caption
|
||
msgid "Sort right panel by &Date"
|
||
msgstr "Сортировать по &дате в правой панели"
|
||
|
||
#: tfrmmain.actrightsortbyext.caption
|
||
msgid "Sort right panel by &Extension"
|
||
msgstr "Сортировать по &расширению в правой панели"
|
||
|
||
#: tfrmmain.actrightsortbyname.caption
|
||
msgid "Sort right panel by &Name"
|
||
msgstr "Сортировать по &имени в правой панели"
|
||
|
||
#: tfrmmain.actrightsortbysize.caption
|
||
msgid "Sort right panel by &Size"
|
||
msgstr "Сортировать по &размеру в правой панели"
|
||
|
||
#: tfrmmain.actrightthumbview.caption
|
||
msgid "Thumbnails view on right panel"
|
||
msgstr "Просмотр эскизов в правой панели"
|
||
|
||
#: tfrmmain.actrunterm.caption
|
||
msgid "Run &Terminal"
|
||
msgstr "Пуск &терминала"
|
||
|
||
#: tfrmmain.actsavefavoritetabs.caption
|
||
msgid "Save current tabs to a New Favorite Tabs"
|
||
msgstr "Сохранить текущие как новые избранные вкладки"
|
||
|
||
#: tfrmmain.actsaveselection.caption
|
||
msgid "Sa&ve Selection"
|
||
msgstr "С&охранить выделение"
|
||
|
||
#: tfrmmain.actsaveselectiontofile.caption
|
||
msgid "Save S&election to File..."
|
||
msgstr "Со&хранить выделение в файл..."
|
||
|
||
#: tfrmmain.actsavetabs.caption
|
||
msgid "&Save Tabs to File"
|
||
msgstr "Сохранить вкладки в файл"
|
||
|
||
#: tfrmmain.actsearch.caption
|
||
msgid "&Search..."
|
||
msgstr "&Поиск..."
|
||
|
||
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
||
msgid "All tabs Locked with Dir Opened in New Tabs"
|
||
msgstr "Заблокировать все вкладки и открывать каталоги в новых"
|
||
|
||
#: tfrmmain.actsetalltabsoptionnormal.caption
|
||
msgid "Set all tabs to Normal"
|
||
msgstr "Сделать все вкладки обычными"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
||
msgid "Set all tabs to Locked"
|
||
msgstr "Заблокировать все вкладки"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
||
msgid "All tabs Locked with Dir Changes Allowed"
|
||
msgstr "Заблокировать все вкладки с возможностью смены каталога"
|
||
|
||
#: tfrmmain.actsetfileproperties.caption
|
||
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change &Attributes..."
|
||
msgstr "Изменить атри&буты"
|
||
|
||
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
||
msgid "Locked with Directories Opened in New &Tabs"
|
||
msgstr "Заблокировать и открывать каталоги в &новых вкладках"
|
||
|
||
#: tfrmmain.actsettaboptionnormal.caption
|
||
msgid "&Normal"
|
||
msgstr "&Обычная вкладка"
|
||
|
||
#: tfrmmain.actsettaboptionpathlocked.caption
|
||
msgid "&Locked"
|
||
msgstr "&Заблокировать вкладку"
|
||
|
||
#: tfrmmain.actsettaboptionpathresets.caption
|
||
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
|
||
msgid "Locked with &Directory Changes Allowed"
|
||
msgstr "Заблокировать с возможностью &смены каталога"
|
||
|
||
#: tfrmmain.actshellexecute.caption
|
||
msgctxt "tfrmmain.actshellexecute.caption"
|
||
msgid "Open"
|
||
msgstr "Открыть"
|
||
|
||
#: tfrmmain.actshellexecute.hint
|
||
msgid "Open using system associations"
|
||
msgstr "Открыть, используя системные ассоциации"
|
||
|
||
#: tfrmmain.actshowbuttonmenu.caption
|
||
msgid "Show button menu"
|
||
msgstr "Показать панель инструментов"
|
||
|
||
#: tfrmmain.actshowcmdlinehistory.caption
|
||
msgid "Show command line history"
|
||
msgstr "История командной строки"
|
||
|
||
#: tfrmmain.actshowmainmenu.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
|
||
msgid "Menu"
|
||
msgstr "Меню"
|
||
|
||
#: tfrmmain.actshowsysfiles.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
|
||
msgid "Show &Hidden/System Files"
|
||
msgstr "По&казать скрытые/системные файлы"
|
||
|
||
#: tfrmmain.actsortbyattr.caption
|
||
msgid "Sort by &Attributes"
|
||
msgstr "Сортировать по &атрибутам"
|
||
|
||
#: tfrmmain.actsortbydate.caption
|
||
msgid "Sort by &Date"
|
||
msgstr "Сортировать по &дате"
|
||
|
||
#: tfrmmain.actsortbyext.caption
|
||
msgid "Sort by &Extension"
|
||
msgstr "Сортировать по рас&ширению"
|
||
|
||
#: tfrmmain.actsortbyname.caption
|
||
msgid "Sort by &Name"
|
||
msgstr "Сортировать по &имени"
|
||
|
||
#: tfrmmain.actsortbysize.caption
|
||
msgid "Sort by &Size"
|
||
msgstr "Сортировать по &размеру"
|
||
|
||
#: tfrmmain.actsrcopendrives.caption
|
||
msgid "Open drive list"
|
||
msgstr "Открыть список дисков"
|
||
|
||
#: tfrmmain.actswitchignorelist.caption
|
||
msgid "Enable/disable ignore list file to not show file names"
|
||
msgstr "Функция исключения имён файлов: вкл/выкл"
|
||
|
||
#: tfrmmain.actsymlink.caption
|
||
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
|
||
msgid "Create Symbolic &Link..."
|
||
msgstr "Создать символ&ьную ссылку..."
|
||
|
||
#: tfrmmain.actsyncdirs.caption
|
||
msgid "Syn&chronize dirs..."
|
||
msgstr "&Синхронизировать каталоги..."
|
||
|
||
#: tfrmmain.acttargetequalsource.caption
|
||
msgid "Target &= Source"
|
||
msgstr "Получатель &= Источнику"
|
||
|
||
#: tfrmmain.acttestarchive.caption
|
||
msgid "&Test Archive(s)"
|
||
msgstr "Про&тестировать архив(ы)"
|
||
|
||
#: tfrmmain.actthumbnailsview.caption
|
||
msgctxt "tfrmmain.actthumbnailsview.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Эскизы"
|
||
|
||
#: tfrmmain.actthumbnailsview.hint
|
||
msgid "Thumbnails View"
|
||
msgstr "Просмотр эскизов"
|
||
|
||
#: tfrmmain.acttogglefullscreenconsole.caption
|
||
msgid "Toggle fullscreen mode console"
|
||
msgstr "Переключить окно консоли в режим полного экрана"
|
||
|
||
#: tfrmmain.acttransferleft.caption
|
||
msgid "Transfer dir under cursor to left window"
|
||
msgstr "Открыть каталог под курсором на левой панели"
|
||
|
||
#: tfrmmain.acttransferright.caption
|
||
msgid "Transfer dir under cursor to right window"
|
||
msgstr "Открыть каталог под курсором на правой панели"
|
||
|
||
#: tfrmmain.acttreeview.caption
|
||
msgid "&Tree View Panel"
|
||
msgstr "Дерево каталогов"
|
||
|
||
#: tfrmmain.actuniversalsingledirectsort.caption
|
||
msgid "Sort according to parameters"
|
||
msgstr "Сортировка по параметрам"
|
||
|
||
#: tfrmmain.actunmarkcurrentextension.caption
|
||
msgid "Unselect All with the Same Ex&tension"
|
||
msgstr "Снять выделение по расши&рению"
|
||
|
||
#: tfrmmain.actunmarkcurrentname.caption
|
||
msgid "Unselect all files with same name"
|
||
msgstr "Снять выделение по текущему имени"
|
||
|
||
#: tfrmmain.actunmarkcurrentnameext.caption
|
||
msgid "Unselect all files with same name and extension"
|
||
msgstr "Снять выделение по текущему имени и расширению"
|
||
|
||
#: tfrmmain.actunmarkcurrentpath.caption
|
||
msgid "Unselect all in same path"
|
||
msgstr "Снять всё выделение с этим путём"
|
||
|
||
#: tfrmmain.actview.caption
|
||
msgctxt "tfrmmain.actview.caption"
|
||
msgid "View"
|
||
msgstr "Просмотр"
|
||
|
||
#: tfrmmain.actviewhistory.caption
|
||
msgid "Show history of visited paths for active view"
|
||
msgstr "Показать историю каталогов для активной вкладки"
|
||
|
||
#: tfrmmain.actviewhistorynext.caption
|
||
msgid "Go to next entry in history"
|
||
msgstr "Перейти к следующей записи истории"
|
||
|
||
#: tfrmmain.actviewhistoryprev.caption
|
||
msgid "Go to previous entry in history"
|
||
msgstr "Перейти к предыдущей записи истории"
|
||
|
||
#: tfrmmain.actviewlogfile.caption
|
||
msgid "View log file"
|
||
msgstr "Просмотреть содержимое файла протокола"
|
||
|
||
#: tfrmmain.actviewsearches.caption
|
||
msgid "View current search instances"
|
||
msgstr "Список запущенных окон поиска"
|
||
|
||
#: tfrmmain.actvisithomepage.caption
|
||
msgid "&Visit Double Commander Website"
|
||
msgstr "&Посетить сайт Double Commander"
|
||
|
||
#: tfrmmain.actwipe.caption
|
||
msgid "Wipe"
|
||
msgstr "Стереть (Wipe)"
|
||
|
||
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
||
msgid "Work with Directory Hotlist and parameters"
|
||
msgstr "Работа с избранными каталогами и параметрами"
|
||
|
||
#: tfrmmain.btnf10.caption
|
||
msgctxt "tfrmmain.btnf10.caption"
|
||
msgid "Exit"
|
||
msgstr "Выход"
|
||
|
||
#: tfrmmain.btnf7.caption
|
||
msgctxt "tfrmmain.btnf7.caption"
|
||
msgid "Directory"
|
||
msgstr "Каталог"
|
||
|
||
#: tfrmmain.btnf8.caption
|
||
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: tfrmmain.btnf9.caption
|
||
msgctxt "tfrmmain.btnf9.caption"
|
||
msgid "Terminal"
|
||
msgstr "Терминал"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.hint
|
||
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Избранные каталоги"
|
||
|
||
#: tfrmmain.btnleftequalright.caption
|
||
msgctxt "tfrmmain.btnleftequalright.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmmain.btnleftequalright.hint
|
||
msgid "Show current directory of the right panel in the left panel"
|
||
msgstr "Открыть в левой панели текущий каталог правой"
|
||
|
||
#: tfrmmain.btnlefthome.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnlefthome.hint
|
||
msgid "Go to home directory"
|
||
msgstr "Перейти в домашний каталог"
|
||
|
||
#: tfrmmain.btnleftroot.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnleftroot.hint
|
||
msgid "Go to root directory"
|
||
msgstr "Перейти в корневой каталог"
|
||
|
||
#: tfrmmain.btnleftup.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.btnleftup.hint
|
||
msgid "Go to parent directory"
|
||
msgstr "Перейти в родительский каталог"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.hint
|
||
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Избранные каталоги"
|
||
|
||
#: tfrmmain.btnrightequalleft.caption
|
||
msgctxt "tfrmmain.btnrightequalleft.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmmain.btnrightequalleft.hint
|
||
msgid "Show current directory of the left panel in the right panel"
|
||
msgstr "Открыть в правой панели текущий каталог левой"
|
||
|
||
#: tfrmmain.btnrighthome.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnrightroot.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnrightup.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.caption
|
||
msgctxt "tfrmmain.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmain.lblcommandpath.caption
|
||
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
|
||
msgid "Path"
|
||
msgstr "Путь"
|
||
|
||
#: tfrmmain.mi2080.caption
|
||
msgid "&20/80"
|
||
msgstr "&20/80"
|
||
|
||
#: tfrmmain.mi3070.caption
|
||
msgid "&30/70"
|
||
msgstr "&30/70"
|
||
|
||
#: tfrmmain.mi4060.caption
|
||
msgid "&40/60"
|
||
msgstr "&40/60"
|
||
|
||
#: tfrmmain.mi5050.caption
|
||
msgid "&50/50"
|
||
msgstr "&50/50"
|
||
|
||
#: tfrmmain.mi6040.caption
|
||
msgid "&60/40"
|
||
msgstr "&60/40"
|
||
|
||
#: tfrmmain.mi7030.caption
|
||
msgid "&70/30"
|
||
msgstr "&70/30"
|
||
|
||
#: tfrmmain.mi8020.caption
|
||
msgid "&80/20"
|
||
msgstr "&80/20"
|
||
|
||
#: tfrmmain.micancel.caption
|
||
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Отмена"
|
||
|
||
#: tfrmmain.micopy.caption
|
||
msgid "Copy..."
|
||
msgstr "Копировать..."
|
||
|
||
#: tfrmmain.mihardlink.caption
|
||
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
|
||
msgid "Create link..."
|
||
msgstr "Создать &ссылку..."
|
||
|
||
#: tfrmmain.milogclear.caption
|
||
msgid "Clear"
|
||
msgstr "Очистить"
|
||
|
||
#: tfrmmain.milogcopy.caption
|
||
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "&Копировать"
|
||
|
||
#: tfrmmain.miloghide.caption
|
||
msgid "Hide"
|
||
msgstr "Скрыть"
|
||
|
||
#: tfrmmain.milogselectall.caption
|
||
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Выделить &всё"
|
||
|
||
#: tfrmmain.mimove.caption
|
||
msgid "Move..."
|
||
msgstr "Переместить..."
|
||
|
||
#: tfrmmain.misymlink.caption
|
||
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
|
||
msgid "Create symlink..."
|
||
msgstr "Создать символьную сс&ылку..."
|
||
|
||
#: tfrmmain.mitaboptions.caption
|
||
msgid "Tab options"
|
||
msgstr "Опции вкладки"
|
||
|
||
#: tfrmmain.mitrayiconexit.caption
|
||
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "В&ыход"
|
||
|
||
#: tfrmmain.mitrayiconrestore.caption
|
||
msgid "Restore"
|
||
msgstr "Восстановить"
|
||
|
||
#: tfrmmain.mnualloperpause.caption
|
||
msgctxt "tfrmmain.mnualloperpause.caption"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmmain.mnualloperstart.caption
|
||
msgctxt "tfrmmain.mnualloperstart.caption"
|
||
msgid "Start"
|
||
msgstr "Старт"
|
||
|
||
#: tfrmmain.mnualloperstop.caption
|
||
msgctxt "tfrmmain.mnualloperstop.caption"
|
||
msgid "Cancel"
|
||
msgstr "Отмена"
|
||
|
||
#: tfrmmain.mnucmd.caption
|
||
msgid "&Commands"
|
||
msgstr "&Команды"
|
||
|
||
#: tfrmmain.mnuconfig.caption
|
||
msgid "C&onfiguration"
|
||
msgstr "&Настройки"
|
||
|
||
#: tfrmmain.mnufavoritetabs.caption
|
||
msgid "Favorites"
|
||
msgstr "Избранное"
|
||
|
||
#: tfrmmain.mnufiles.caption
|
||
msgid "&Files"
|
||
msgstr "&Файлы"
|
||
|
||
#: tfrmmain.mnuhelp.caption
|
||
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Помощ&ь"
|
||
|
||
#: tfrmmain.mnumark.caption
|
||
msgid "&Mark"
|
||
msgstr "&Выделение"
|
||
|
||
#: tfrmmain.mnunetwork.caption
|
||
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
|
||
msgid "Network"
|
||
msgstr "Сеть"
|
||
|
||
#: tfrmmain.mnushow.caption
|
||
msgid "&Show"
|
||
msgstr "Ви&д"
|
||
|
||
#: tfrmmain.mnutaboptions.caption
|
||
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
|
||
msgid "Tab &Options"
|
||
msgstr "&Опции вкладки"
|
||
|
||
#: tfrmmain.mnutabs.caption
|
||
msgid "&Tabs"
|
||
msgstr "Вк&ладки"
|
||
|
||
#: tfrmmain.tbchangedir.caption
|
||
msgid "CD"
|
||
msgstr "cd"
|
||
|
||
#: tfrmmain.tbcopy.caption
|
||
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "&Копировать"
|
||
|
||
#: tfrmmain.tbcut.caption
|
||
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "В&ырезать"
|
||
|
||
#: tfrmmain.tbdelete.caption
|
||
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: tfrmmain.tbedit.caption
|
||
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Редактировать"
|
||
|
||
#: tfrmmain.tbpaste.caption
|
||
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "&Вставить"
|
||
|
||
#: tfrmmaincommandsdlg.btncancel.caption
|
||
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmmaincommandsdlg.btnok.caption
|
||
msgctxt "tfrmmaincommandsdlg.btnok.caption"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmmaincommandsdlg.caption
|
||
msgctxt "tfrmmaincommandsdlg.caption"
|
||
msgid "Select your internal command"
|
||
msgstr "Выберите внутреннюю команду"
|
||
|
||
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
||
msgid "Select all categories by default"
|
||
msgstr "Выбрать все категории по умолчанию"
|
||
|
||
#: tfrmmaincommandsdlg.gbselection.caption
|
||
msgid "Selection:"
|
||
msgstr "Выделенная:"
|
||
|
||
#: tfrmmaincommandsdlg.lblcategory.caption
|
||
msgid "&Categories:"
|
||
msgstr "&Категории:"
|
||
|
||
#: tfrmmaincommandsdlg.lblcommandname.caption
|
||
msgid "Command &name:"
|
||
msgstr "Кома&нда:"
|
||
|
||
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
||
msgid "&Filter:"
|
||
msgstr "&Фильтр:"
|
||
|
||
#: tfrmmaincommandsdlg.lblhint.caption
|
||
msgid "Hint:"
|
||
msgstr "Подсказка:"
|
||
|
||
#: tfrmmaincommandsdlg.lblhotkey.caption
|
||
msgid "Hotkey:"
|
||
msgstr "Горячая клавиша:"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
||
msgid "cm_name"
|
||
msgstr ""
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
||
msgid "Category"
|
||
msgstr "Категория"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
||
msgid "Help"
|
||
msgstr "Помощь"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
||
msgid "Hint"
|
||
msgstr "Подсказка"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
||
msgid "Hotkey"
|
||
msgstr "Горячая клавиша"
|
||
|
||
#: tfrmmaskinputdlg.btnaddattribute.caption
|
||
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmmaskinputdlg.btnattrshelp.caption
|
||
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Помощ&ь"
|
||
|
||
#: tfrmmaskinputdlg.btncancel.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
||
msgid "&Define..."
|
||
msgstr "&Шаблон..."
|
||
|
||
#: tfrmmaskinputdlg.btnok.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
||
msgid "Case sensitive"
|
||
msgstr "Учитывать регистр"
|
||
|
||
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
||
msgid "Ignore accents and ligatures"
|
||
msgstr "Игнорировать акценты и лигатуры"
|
||
|
||
#: tfrmmaskinputdlg.lblattributes.caption
|
||
msgid "Attri&butes:"
|
||
msgstr "Атри&буты:"
|
||
|
||
#: tfrmmaskinputdlg.lblprompt.caption
|
||
msgid "Input Mask:"
|
||
msgstr "Укажите маску файлов:"
|
||
|
||
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
||
msgid "O&r select predefined selection type:"
|
||
msgstr "&Или выберите тип файлов по шаблону:"
|
||
|
||
#: tfrmmkdir.btncancel.caption
|
||
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmmkdir.btnok.caption
|
||
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmmkdir.caption
|
||
msgid "Create new directory"
|
||
msgstr "Создать новый каталог"
|
||
|
||
#: tfrmmkdir.lblmakedir.caption
|
||
msgid "&Input new directory name:"
|
||
msgstr "&Введите имя каталога:"
|
||
|
||
#: tfrmmodview.btnpath1.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath2.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath3.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath4.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath5.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.caption
|
||
msgctxt "TFRMMODVIEW.CAPTION"
|
||
msgid "New Size"
|
||
msgstr "Новый размер"
|
||
|
||
#: tfrmmodview.lblheight.caption
|
||
msgid "Height :"
|
||
msgstr "Высота:"
|
||
|
||
#: tfrmmodview.lblpath1.caption
|
||
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmodview.lblpath2.caption
|
||
msgctxt "tfrmmodview.lblpath2.caption"
|
||
msgid "2"
|
||
msgstr "2"
|
||
|
||
#: tfrmmodview.lblpath3.caption
|
||
msgctxt "tfrmmodview.lblpath3.caption"
|
||
msgid "3"
|
||
msgstr "3"
|
||
|
||
#: tfrmmodview.lblpath4.caption
|
||
msgid "4"
|
||
msgstr "4"
|
||
|
||
#: tfrmmodview.lblpath5.caption
|
||
msgid "5"
|
||
msgstr "5"
|
||
|
||
#: tfrmmodview.lblquality.caption
|
||
msgid "Quality of compress to Jpg"
|
||
msgstr "Качество сжатия JPEG"
|
||
|
||
#: tfrmmodview.lblwidth.caption
|
||
msgid "Width :"
|
||
msgstr "Ширина:"
|
||
|
||
#: tfrmmodview.rbbmp.caption
|
||
msgid "BMP"
|
||
msgstr "BMP"
|
||
|
||
#: tfrmmodview.rbico.caption
|
||
msgid "ICO"
|
||
msgstr "ICO"
|
||
|
||
#: tfrmmodview.rbjpg.caption
|
||
msgid "JPG"
|
||
msgstr "JPG"
|
||
|
||
#: tfrmmodview.rbpng.caption
|
||
msgid "PNG"
|
||
msgstr "PNG"
|
||
|
||
#: tfrmmodview.rbpnm.caption
|
||
msgid "PNM"
|
||
msgstr "PNM"
|
||
|
||
#: tfrmmodview.teheight.text
|
||
msgctxt "tfrmmodview.teheight.text"
|
||
msgid "Height"
|
||
msgstr "Высота"
|
||
|
||
#: tfrmmodview.tequality.text
|
||
msgid "80"
|
||
msgstr "80"
|
||
|
||
#: tfrmmodview.tewidth.text
|
||
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
|
||
msgid "Width"
|
||
msgstr "Ширина"
|
||
|
||
#: tfrmmsg.lblmsg.caption
|
||
msgid "456456465465465"
|
||
msgstr "456456465465465"
|
||
|
||
#: tfrmmultirename.btnclose.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmmultirename.btndeletepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmmultirename.btnedit.caption
|
||
msgctxt "tfrmmultirename.btnedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Пр&авка"
|
||
|
||
#: tfrmmultirename.btnextmenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnloadpreset.caption
|
||
msgid "&Load"
|
||
msgstr "З&агрузить"
|
||
|
||
#: tfrmmultirename.btnnamemenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnrename.caption
|
||
msgctxt "tfrmmultirename.btnrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "&Переименовать"
|
||
|
||
#: tfrmmultirename.btnrestore.caption
|
||
msgid "Reset &all"
|
||
msgstr "&Восстановить всё"
|
||
|
||
#: tfrmmultirename.btnsavepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Сохранить"
|
||
|
||
#: tfrmmultirename.caption
|
||
msgctxt "tfrmmultirename.caption"
|
||
msgid "MultiRename"
|
||
msgstr "Групповое переименование"
|
||
|
||
#: tfrmmultirename.cblog.caption
|
||
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
|
||
msgid "Ena&ble"
|
||
msgstr "Вкл&ючить"
|
||
|
||
#: tfrmmultirename.cbregexp.caption
|
||
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
|
||
msgid "Regular e&xpressions"
|
||
msgstr "&Регулярные выражения"
|
||
|
||
#: tfrmmultirename.cbusesubs.caption
|
||
msgid "&Use substitution"
|
||
msgstr "Под&становка"
|
||
|
||
#: tfrmmultirename.cmbxwidth.text
|
||
msgid "01"
|
||
msgstr "01"
|
||
|
||
#: tfrmmultirename.edinterval.text
|
||
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.edpoc.text
|
||
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.extension.caption
|
||
msgid "[E] Extension"
|
||
msgstr "[E] Расширение"
|
||
|
||
#: tfrmmultirename.gbcounter.caption
|
||
msgid "Counter"
|
||
msgstr "Счётчик"
|
||
|
||
#: tfrmmultirename.gbfindreplace.caption
|
||
msgid "Find && Replace"
|
||
msgstr "Найти и заменить"
|
||
|
||
#: tfrmmultirename.gblog.caption
|
||
msgid "Log Result"
|
||
msgstr "Протокол"
|
||
|
||
#: tfrmmultirename.gbmaska.caption
|
||
msgid "Mask"
|
||
msgstr "Маска"
|
||
|
||
#: tfrmmultirename.gbpresets.caption
|
||
msgid "Presets"
|
||
msgstr "Шаблоны"
|
||
|
||
#: tfrmmultirename.lbext.caption
|
||
msgid "&Extension"
|
||
msgstr "Рас&ширение"
|
||
|
||
#: tfrmmultirename.lbfind.caption
|
||
msgid "&Find..."
|
||
msgstr "&Найти..."
|
||
|
||
#: tfrmmultirename.lbinterval.caption
|
||
msgid "&Interval"
|
||
msgstr "&Интервал"
|
||
|
||
#: tfrmmultirename.lbname.caption
|
||
msgid "File &Name"
|
||
msgstr "И&мя файла"
|
||
|
||
#: tfrmmultirename.lbreplace.caption
|
||
msgid "Re&place..."
|
||
msgstr "Заменит&ь..."
|
||
|
||
#: tfrmmultirename.lbstnb.caption
|
||
msgid "S&tart Number"
|
||
msgstr "На&ч. знач."
|
||
|
||
#: tfrmmultirename.lbwidth.caption
|
||
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
|
||
msgid "&Width"
|
||
msgstr "Ши&рина"
|
||
|
||
#: tfrmmultirename.micounter.caption
|
||
msgid "[C] Counter"
|
||
msgstr "[C] Счётчик"
|
||
|
||
#: tfrmmultirename.miday.caption
|
||
msgid "[D] Day"
|
||
msgstr "[D] День"
|
||
|
||
#: tfrmmultirename.miday1.caption
|
||
msgid "[DD] Day (2 digits)"
|
||
msgstr "[DD] День (2 цифры)"
|
||
|
||
#: tfrmmultirename.miday2.caption
|
||
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
||
msgstr "[DDD] День недели (краткий, т.е., \"Пн\")"
|
||
|
||
#: tfrmmultirename.miday3.caption
|
||
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
||
msgstr "[DDDD] День недели (полный, т.е., \"понедельник\")"
|
||
|
||
#: tfrmmultirename.miextensionx.caption
|
||
msgid "[Ex] Character at position x"
|
||
msgstr "[Ex] Символ с позиции x"
|
||
|
||
#: tfrmmultirename.miextensionxx.caption
|
||
msgid "[Ex:y] Characters from position x to y"
|
||
msgstr "[Ex:y] Символы с позиции x по y"
|
||
|
||
#: tfrmmultirename.mihour.caption
|
||
msgid "[h] Hour"
|
||
msgstr "[h] Час"
|
||
|
||
#: tfrmmultirename.mihour1.caption
|
||
msgid "[hh] Hour (2 digits)"
|
||
msgstr "[hh] Час (2 цифры)"
|
||
|
||
#: tfrmmultirename.miminute.caption
|
||
msgid "[n] Minute"
|
||
msgstr "[n] Минута"
|
||
|
||
#: tfrmmultirename.miminute1.caption
|
||
msgid "[nn] Minute (2 digits)"
|
||
msgstr "[nn] Минута (2 цифры)"
|
||
|
||
#: tfrmmultirename.mimonth.caption
|
||
msgid "[M] Month"
|
||
msgstr "[M] Месяц"
|
||
|
||
#: tfrmmultirename.mimonth1.caption
|
||
msgid "[MM] Month (2 digits)"
|
||
msgstr "[MM] Месяц (2 цифры)"
|
||
|
||
#: tfrmmultirename.mimonth2.caption
|
||
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
||
msgstr "[MMM] Название месяца (краткое, т.е., \"янв\")"
|
||
|
||
#: tfrmmultirename.mimonth3.caption
|
||
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
||
msgstr "[MMMM] Название месяца (полное, т.е., \"Январь\")"
|
||
|
||
#: tfrmmultirename.miname.caption
|
||
msgid "[N] Name"
|
||
msgstr "[N] Имя"
|
||
|
||
#: tfrmmultirename.minamex.caption
|
||
msgid "[Nx] Character at position x"
|
||
msgstr "[Nx] Символ с позиции x"
|
||
|
||
#: tfrmmultirename.minamexx.caption
|
||
msgid "[Nx:y] Characters from position x to y"
|
||
msgstr "[Nx:y] Символы с позиции x по y"
|
||
|
||
#: tfrmmultirename.minext.caption
|
||
msgid "Time..."
|
||
msgstr "Время..."
|
||
|
||
#: tfrmmultirename.minextextension.caption
|
||
msgid "Extension..."
|
||
msgstr "Расширение..."
|
||
|
||
#: tfrmmultirename.minextname.caption
|
||
msgid "Name..."
|
||
msgstr "Имя..."
|
||
|
||
#: tfrmmultirename.miplugin.caption
|
||
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "Плагин"
|
||
|
||
#: tfrmmultirename.misecond.caption
|
||
msgid "[s] Second"
|
||
msgstr "[s] Секунда"
|
||
|
||
#: tfrmmultirename.misecond1.caption
|
||
msgid "[ss] Second (2 digits)"
|
||
msgstr "[ss] Секунда (2 цифры)"
|
||
|
||
#: tfrmmultirename.miyear.caption
|
||
msgid "[Y] Year (2 digits)"
|
||
msgstr "[Y] Год (2 цифры)"
|
||
|
||
#: tfrmmultirename.miyear1.caption
|
||
msgid "[YYYY] Year (4 digits)"
|
||
msgstr "[YYYY] Год (4 цифры)"
|
||
|
||
#: tfrmmultirename.mnueditnames.caption
|
||
msgid "Edit names..."
|
||
msgstr "&Редактировать имена..."
|
||
|
||
#: tfrmmultirename.mnuloadfromfile.caption
|
||
msgid "Load names from file..."
|
||
msgstr "&Загрузить имена из файла..."
|
||
|
||
#: tfrmmultirename.n1.caption
|
||
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n2.caption
|
||
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n3.caption
|
||
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n4.caption
|
||
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n5.caption
|
||
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
|
||
msgid "Old File Name"
|
||
msgstr "Старое имя"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
|
||
msgid "New File Name"
|
||
msgstr "Новое имя"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
||
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
|
||
msgid "File Path"
|
||
msgstr "Путь файла"
|
||
|
||
#: tfrmmultirenamewait.caption
|
||
msgctxt "tfrmmultirenamewait.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmultirenamewait.lblmessage.caption
|
||
msgid "Click OK when you have closed the editor to load the changed names!"
|
||
msgstr "Нажмите \"OK\" по закрытии редактора, чтобы загрузить изменённые имена!"
|
||
|
||
#: tfrmopenwith.caption
|
||
msgid "Choose an application"
|
||
msgstr "Выбор приложения"
|
||
|
||
#: tfrmopenwith.chkcustomcommand.caption
|
||
msgid "Custom command"
|
||
msgstr "Пользовательская команда"
|
||
|
||
#: tfrmopenwith.chksaveassociation.caption
|
||
msgid "Save association"
|
||
msgstr "Сохранить ассоциацию"
|
||
|
||
#: tfrmopenwith.chkuseasdefault.caption
|
||
msgid "Set selected application as default action"
|
||
msgstr "Установить как приложение по умолчанию"
|
||
|
||
#: tfrmopenwith.lblmimetype.caption
|
||
msgid "File type to be opened: %s"
|
||
msgstr "Тип открываемого файла: %s"
|
||
|
||
#: tfrmopenwith.milistoffiles.caption
|
||
msgid "Multiple file names"
|
||
msgstr "Список файлов"
|
||
|
||
#: tfrmopenwith.milistoffiles.hint
|
||
msgid "%F"
|
||
msgstr "%F"
|
||
|
||
#: tfrmopenwith.milistofurls.caption
|
||
msgid "Multiple URIs"
|
||
msgstr "Список URI"
|
||
|
||
#: tfrmopenwith.milistofurls.hint
|
||
msgid "%U"
|
||
msgstr "%U"
|
||
|
||
#: tfrmopenwith.misinglefilename.caption
|
||
msgid "Single file name"
|
||
msgstr "Один файл"
|
||
|
||
#: tfrmopenwith.misinglefilename.hint
|
||
msgid "%f"
|
||
msgstr "%f"
|
||
|
||
#: tfrmopenwith.misingleurl.caption
|
||
msgid "Single URI"
|
||
msgstr "Один URI"
|
||
|
||
#: tfrmopenwith.misingleurl.hint
|
||
msgid "%u"
|
||
msgstr "%u"
|
||
|
||
#: tfrmoptions.btnapply.caption
|
||
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
|
||
msgid "&Apply"
|
||
msgstr "&Применить"
|
||
|
||
#: tfrmoptions.btncancel.caption
|
||
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmoptions.btnok.caption
|
||
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmoptions.caption
|
||
msgctxt "tfrmoptions.caption"
|
||
msgid "Options"
|
||
msgstr "Настройки"
|
||
|
||
#: tfrmoptions.lblemptyeditor.caption
|
||
msgid "Please select one of the subpages, this page does not contain any settings."
|
||
msgstr "Выберите одну из подстраниц, эта страница не содержит никаких настроек."
|
||
|
||
#: tfrmoptionsarchivers.btnarchiveradd.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverapply.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
|
||
msgid "A&pply"
|
||
msgstr "П&рименить"
|
||
|
||
#: tfrmoptionsarchivers.btnarchivercopy.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchivercopy.caption"
|
||
msgid "Cop&y"
|
||
msgstr "&Копировать"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverdelete.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverother.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverother.caption"
|
||
msgid "Oth&er..."
|
||
msgstr "Дру&гое..."
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverrename.caption
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "П&ереименовать"
|
||
|
||
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
|
||
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsarchivers.bvlarchiverids.caption
|
||
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
|
||
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
|
||
msgstr "ID, сигнатура, используется с cm_OpenArchive для распознавания архива без учёта расширения файла:"
|
||
|
||
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
|
||
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
|
||
msgid "Options:"
|
||
msgstr "Настройки:"
|
||
|
||
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
|
||
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
|
||
msgid "Format parsing mode:"
|
||
msgstr "Режим разбора формата:"
|
||
|
||
#: tfrmoptionsarchivers.chkarchiverenabled.caption
|
||
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
|
||
msgid "E&nabled"
|
||
msgstr "Вкл&ючить"
|
||
|
||
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
|
||
msgid "De&bug mode"
|
||
msgstr "Ре&жим отладки"
|
||
|
||
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
|
||
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
|
||
msgid "S&how console output"
|
||
msgstr "Показывать консольны&й вывод"
|
||
|
||
#: tfrmoptionsarchivers.chkfilenameonlylist.caption
|
||
msgid "Use archive name without extension as list"
|
||
msgstr "Использовать имя архива без расширения как список"
|
||
|
||
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
|
||
msgid "Uni&x file attributes"
|
||
msgstr "Unix-&атрибуты файлов"
|
||
|
||
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
|
||
msgid "&Unix path delimiter \"/\""
|
||
msgstr "Unix-разделитель пут&и \"/\""
|
||
|
||
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
|
||
msgid "Windows &file attributes"
|
||
msgstr "Windows-атри&буты файлов"
|
||
|
||
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
|
||
msgid "Windows path deli&miter \"\\\""
|
||
msgstr "Windows-разделител&ь пути \"\\\""
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveradd.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
|
||
msgid "Add&ing:"
|
||
msgstr "До&бавить:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
|
||
msgid "Arc&hiver:"
|
||
msgstr "Ар&хиватор:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverdelete.caption
|
||
msgid "De&lete:"
|
||
msgstr "Уда&лить:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverdescription.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
|
||
msgid "De&scription:"
|
||
msgstr "Оп&исание:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverextension.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
|
||
msgid "E&xtension:"
|
||
msgstr "Рас&ширение:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverextract.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
|
||
msgid "Ex&tract:"
|
||
msgstr "И&звлечь:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
|
||
msgid "Extract &without path:"
|
||
msgstr "Распаковать не у&читывая пути:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveridposition.caption
|
||
msgid "ID Po&sition:"
|
||
msgstr "Сме&щение ID:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverids.caption
|
||
msgid "&ID:"
|
||
msgstr "ID:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
|
||
msgid "ID See&k Range:"
|
||
msgstr "Диапа&зон поиска ID:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverlist.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
|
||
msgid "&List:"
|
||
msgstr "&Список:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
|
||
msgid "Archi&vers:"
|
||
msgstr "Архиватор&ы:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverlistend.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
|
||
msgid "Listing &finish (optional):"
|
||
msgstr "Коне&ц списка (необязательный):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
|
||
msgid "Listing for&mat:"
|
||
msgstr "Фор&мат списка:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverliststart.caption
|
||
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
|
||
msgid "Listin&g start (optional):"
|
||
msgstr "На&чало списка (необязательный):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
|
||
msgid "Password &query string:"
|
||
msgstr "Строка запроса парол&я:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
|
||
msgid "Create self extractin&g archive:"
|
||
msgstr "Создать са&мораспаковывающийся архив:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivertest.caption
|
||
msgid "Tes&t:"
|
||
msgstr "Про&верить:"
|
||
|
||
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
|
||
msgid "Auto Configure"
|
||
msgstr "&Автонастройка"
|
||
|
||
#: tfrmoptionsarchivers.miarchiverdisableall.caption
|
||
msgid "Disable all"
|
||
msgstr "Запретить все"
|
||
|
||
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
|
||
msgid "Discard modifications"
|
||
msgstr "Отменить изменения"
|
||
|
||
#: tfrmoptionsarchivers.miarchiverenableall.caption
|
||
msgid "Enable all"
|
||
msgstr "Разрешить все"
|
||
|
||
#: tfrmoptionsarchivers.miarchiverexport.caption
|
||
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Экспорт..."
|
||
|
||
#: tfrmoptionsarchivers.miarchiverimport.caption
|
||
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Импорт..."
|
||
|
||
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
|
||
msgid "Sort archivers"
|
||
msgstr "Сортировать архиваторы"
|
||
|
||
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
|
||
msgid "Additional"
|
||
msgstr "Дополнительные"
|
||
|
||
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
|
||
msgid "General"
|
||
msgstr "Основные"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
|
||
msgid "When &size, date or attributes change"
|
||
msgstr "При изменении &размера, даты или атрибутов"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "&Для следующих каталогов и их подкаталогов:"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
|
||
msgid "When &files are created, deleted or renamed"
|
||
msgstr "При &создании, удалении и переименовании файлов"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
|
||
msgid "When application is in the &background"
|
||
msgstr "Не реаг&ировать на изменения, если окно DC неактивно"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
|
||
msgid "Disable auto-refresh"
|
||
msgstr "Отключить автообновление"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
|
||
msgid "Refresh file list"
|
||
msgstr "Обновлять список файлов"
|
||
|
||
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
|
||
msgid "Al&ways show tray icon"
|
||
msgstr "Вс&егда показывать значок в трее"
|
||
|
||
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
||
msgid "Automatically &hide unmounted devices"
|
||
msgstr "С&крывать отмонтированные устройства"
|
||
|
||
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
|
||
msgid "Mo&ve icon to system tray when minimized"
|
||
msgstr "С&ворачивать в системный трей"
|
||
|
||
#: tfrmoptionsbehavior.cbonlyonce.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
|
||
msgid "A&llow only one copy of DC at a time"
|
||
msgstr "&Не запускать более одной копии DC"
|
||
|
||
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
||
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
||
msgstr "Укажите диски или точки монтирования, перечислив через \";\""
|
||
|
||
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
||
msgid "Drives &blacklist"
|
||
msgstr "&Чёрный список дисков"
|
||
|
||
#: tfrmoptionsbriefview.gbcolumns.caption
|
||
msgid "Columns size"
|
||
msgstr "Размер колонок"
|
||
|
||
#: tfrmoptionsbriefview.gbshowfileext.caption
|
||
msgid "Show file extensions"
|
||
msgstr "Показывать расширения файлов"
|
||
|
||
#: tfrmoptionsbriefview.rbaligned.caption
|
||
msgid "ali&gned (with Tab)"
|
||
msgstr "&Выровненными (по Tab)"
|
||
|
||
#: tfrmoptionsbriefview.rbdirectly.caption
|
||
msgid "di&rectly after filename"
|
||
msgstr "&Сразу после имени"
|
||
|
||
#: tfrmoptionsbriefview.rbuseautosize.caption
|
||
msgid "Auto"
|
||
msgstr "Автоматически"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
||
msgid "Fixed columns count"
|
||
msgstr "Фиксированное число колонок"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
||
msgid "Fixed columns width"
|
||
msgstr "Фиксированная ширина колонок"
|
||
|
||
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBCUTTEXTTOCOLWIDTH.CAPTION"
|
||
msgid "Cut &text to column width"
|
||
msgstr "Обр&езать текст по ширине колонки"
|
||
|
||
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
|
||
msgid "&Extend cell width if text is not fitting into column"
|
||
msgstr "Рас&ширить ширину ячейки, если текст не умещается в колонке"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDHORZLINE.CAPTION"
|
||
msgid "&Horizontal lines"
|
||
msgstr "&Горизонтальные линии"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDVERTLINE.CAPTION"
|
||
msgid "&Vertical lines"
|
||
msgstr "&Вертикальные линии"
|
||
|
||
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CHKAUTOFILLCOLUMNS.CAPTION"
|
||
msgid "A&uto fill columns"
|
||
msgstr "&Растягивать колонки на всю ширину панели"
|
||
|
||
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
||
msgid "Show grid"
|
||
msgstr "Показывать сетку"
|
||
|
||
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
||
msgid "Auto-size columns"
|
||
msgstr "Автоматически изменять размер колонок"
|
||
|
||
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
||
msgctxt "TFRMOPTIONSCOLUMNSVIEW.LBLAUTOSIZECOLUMN.CAPTION"
|
||
msgid "Auto si&ze column:"
|
||
msgstr "И&зменять размер колонки:"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "П&рименить"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Р&едактировать"
|
||
|
||
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBCMDLINEHISTORY.CAPTION"
|
||
msgid "Co&mmand line history"
|
||
msgstr "&Историю командной строки"
|
||
|
||
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
|
||
msgid "&Directory history"
|
||
msgstr "И&сторию каталогов"
|
||
|
||
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBFILEMASKHISTORY.CAPTION"
|
||
msgid "&File mask history"
|
||
msgstr "Историю &масок файлов"
|
||
|
||
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSAVECONFIGURATION.CAPTION"
|
||
msgid "Sa&ve configuration"
|
||
msgstr "Со&хранять конфигурацию"
|
||
|
||
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSEARCHREPLACEHISTORY.CAPTION"
|
||
msgid "Searc&h/Replace history"
|
||
msgstr "Истори&ю поиска/замены"
|
||
|
||
#: tfrmoptionsconfiguration.gbdirectories.caption
|
||
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Каталоги"
|
||
|
||
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.GBLOCCONFIGFILES.CAPTION"
|
||
msgid "Location of configuration files"
|
||
msgstr "Расположение файлов конфигурации"
|
||
|
||
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.GBSAVEONEXIT.CAPTION"
|
||
msgid "Save on exit"
|
||
msgstr "Сохранять при выходе"
|
||
|
||
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
||
msgid "Sort order of configuration order in left tree"
|
||
msgstr "Сортировка дерева конфигурации (слева)"
|
||
|
||
#: tfrmoptionsconfiguration.gpconfigurationtreestate.caption
|
||
msgid "Tree state when entering in configuration page"
|
||
msgstr "Состояние дерева при открытии окна настроек"
|
||
|
||
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.LBLCMDLINECONFIGDIR.CAPTION"
|
||
msgid "Set on command line"
|
||
msgstr "Задано через командную строку"
|
||
|
||
#: tfrmoptionsconfiguration.lblhighlighters.caption
|
||
msgid "Highlighters:"
|
||
msgstr "Файлы подсветки:"
|
||
|
||
#: tfrmoptionsconfiguration.lbliconthemes.caption
|
||
msgid "Icon themes:"
|
||
msgstr "Темы значков:"
|
||
|
||
#: tfrmoptionsconfiguration.lblthumbcache.caption
|
||
msgid "Thumbnails cache:"
|
||
msgstr "Кэш эскизов:"
|
||
|
||
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.RBPROGRAMDIR.CAPTION"
|
||
msgid "P&rogram directory (portable version)"
|
||
msgstr "&Каталог программы (portable version)"
|
||
|
||
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.RBUSERHOMEDIR.CAPTION"
|
||
msgid "&User home directory"
|
||
msgstr "&Домашний каталог пользователя"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Применить изменения ко всем колонкам"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
|
||
msgid "&Delete"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmoptionscustomcolumns.btnfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
||
msgid "Go to set default"
|
||
msgstr "Перейти к умолчаниям"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
|
||
msgid "New"
|
||
msgstr "Создать"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnext.caption
|
||
msgid "Next"
|
||
msgstr "Далее"
|
||
|
||
#: tfrmoptionscustomcolumns.btnprev.caption
|
||
msgid "Previous"
|
||
msgstr "Назад"
|
||
|
||
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
|
||
msgid "Rename"
|
||
msgstr "Переименовать"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
|
||
msgid "R"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Восстановить значение по умолчанию"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
|
||
msgid "Save as"
|
||
msgstr "Сохранить как"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
|
||
msgid "Save"
|
||
msgstr "Сохранить"
|
||
|
||
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Разрешить наложение цвета"
|
||
|
||
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
||
msgid "When clicking to change something, change for all columns"
|
||
msgstr "Изменять для всех колонок"
|
||
|
||
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
||
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
|
||
msgid "General"
|
||
msgstr "Основные"
|
||
|
||
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Рамка вокруг курсора"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
||
msgid "Use Frame Cursor"
|
||
msgstr "Использовать курсор-рамку"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Selection Color"
|
||
msgstr "Выделение в неактивной панели"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
||
msgid "Use Inverted Selection"
|
||
msgstr "Использовать инверсное выделение"
|
||
|
||
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
||
msgid "Use custom font and color for this view"
|
||
msgstr "Использовать пользовательский шрифт и цвет"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
|
||
msgid "BackGround:"
|
||
msgstr "Фон 1:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
|
||
msgid "Background 2:"
|
||
msgstr "Фон 2:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCONFIGCOLUMNS.CAPTION"
|
||
msgid "Con&figure columns view:"
|
||
msgstr "&Настроить набор:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
||
msgid "[Current Column Name]"
|
||
msgstr "[Имя текущей колонки]"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
|
||
msgid "Cursor Color:"
|
||
msgstr "Курсор:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
|
||
msgid "Cursor Text:"
|
||
msgstr "Текст под курсором:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontname.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
|
||
msgid "Font:"
|
||
msgstr "Шрифт:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
|
||
msgid "Size:"
|
||
msgstr "Размер:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
|
||
msgid "Text Color:"
|
||
msgstr "Текст:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Неактивный курсор:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Неактивное выделение:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
|
||
msgid "Mark Color:"
|
||
msgstr "Выделение:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Ниже находится предварительный просмотр. Вы можете перемещать курсор и выбирать файлы, чтобы получить полное представление о выбранных настройках."
|
||
|
||
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
||
msgid "Settings for column:"
|
||
msgstr "Настройки колонки:"
|
||
|
||
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
||
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
|
||
msgid "Add column"
|
||
msgstr "Добавить колонку"
|
||
|
||
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
||
msgid "Position of frame panel after the comparison:"
|
||
msgstr "Позиция панели после сравнения:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
|
||
msgid "Add directory of the &active frame"
|
||
msgstr "Добавить каталог &активной вкладки"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
|
||
msgid "Add &directories of the active && inactive frames"
|
||
msgstr "Добавить каталоги активной &и неактивной вкладок"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
|
||
msgid "Add directory I will bro&wse to"
|
||
msgstr "Диалог выбора &каталога"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
|
||
msgid "Add a copy of the selected entry"
|
||
msgstr "Добавить копию выделенного элемента"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
|
||
msgid "Add current &selected or active directories of active frame"
|
||
msgstr "Добавить &выделенные или каталог под курсором в активной вкладке"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
|
||
msgid "Add a separator"
|
||
msgstr "Добавить разделитель"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
|
||
msgid "Add a sub menu"
|
||
msgstr "Добавить подменю"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
|
||
msgid "Add directory I will type"
|
||
msgstr "Добавить вручную"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Свернуть все"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
|
||
msgid "Collapse item"
|
||
msgstr "Свернуть элемент"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcut.caption
|
||
msgid "Cut selection of entries"
|
||
msgstr "Вырезать выделенные"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
|
||
msgid "Delete all!"
|
||
msgstr "Удалить все!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Удалить выделенный элемент"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
|
||
msgid "Delete sub-menu and all its elements"
|
||
msgstr "Удалить подменю и все его элементы"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
|
||
msgid "Delete just sub-menu but keep elements"
|
||
msgstr "Удалить подменю, но оставить все его элементы"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
|
||
msgid "Expand item"
|
||
msgstr "Развернуть элемент"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
|
||
msgid "Focus tree window"
|
||
msgstr "Фокус на дерево элементов"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
|
||
msgid "Goto first item"
|
||
msgstr "Перейти к первому элементу"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
|
||
msgid "Goto last item"
|
||
msgstr "Перейти к последнему элементу"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
|
||
msgid "Go to next item"
|
||
msgstr "Перейти к следующему элементу"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
|
||
msgid "Go to previous item"
|
||
msgstr "Перейти к предыдущему элементу"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
|
||
msgid "Insert directory of the &active frame"
|
||
msgstr "Вставить каталог &активной вкладки"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
|
||
msgid "Insert &directories of the active && inactive frames"
|
||
msgstr "Вставить каталоги активной &и неактивной вкладок"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
|
||
msgid "Insert directory I will bro&wse to"
|
||
msgstr "Диалог выбора &каталога"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
|
||
msgid "Insert a copy of the selected entry"
|
||
msgstr "Вставить копию выделенного элемента"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
|
||
msgid "Insert current &selected or active directories of active frame"
|
||
msgstr "Вставить &выделенные или каталог под курсором в активной вкладке"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
|
||
msgid "Insert a separator"
|
||
msgstr "Вставить разделитель"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
|
||
msgid "Insert sub menu"
|
||
msgstr "Вставить подменю"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
|
||
msgid "Insert directory I will type"
|
||
msgstr "Вставить вручную"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
|
||
msgid "Move to next"
|
||
msgstr "Переместить вниз"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
|
||
msgid "Move to previous"
|
||
msgstr "Переместить вверх"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Развернуть все ветки"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actpaste.caption
|
||
msgid "Paste what was cut"
|
||
msgstr "Вставить вырезанное"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
|
||
msgid "Search && replace in &path"
|
||
msgstr "Найти и заменить в &пути"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
|
||
msgid "Search && replace in both path and target"
|
||
msgstr "&Найти и заменить в пути и целевом пути"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
|
||
msgid "Search && replace in &target path"
|
||
msgstr "Найти и заменить в &целевом пути"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
|
||
msgid "Tweak path"
|
||
msgstr "Изменить путь"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
|
||
msgid "Tweak target path"
|
||
msgstr "Изменить целевой путь"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
||
msgid "A&dd..."
|
||
msgstr "&Добавить..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
||
msgid "Bac&kup..."
|
||
msgstr "Ре&зервирование..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
||
msgid "De&lete..."
|
||
msgstr "&Удалить..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
||
msgid "E&xport..."
|
||
msgstr "&Экспорт..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Помо&щь"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
||
msgid "Impo&rt..."
|
||
msgstr "&Импорт..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
||
msgid "&Insert..."
|
||
msgstr "&Вставить..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
||
msgid "&Miscellaneous..."
|
||
msgstr "&Разное..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
|
||
msgid "Some functions to select appropriate target"
|
||
msgstr "Некоторые функции для выбора целевого пути"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
||
msgid "&Sort..."
|
||
msgstr "&Сортировать..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
||
msgid "&When adding directory, add also target"
|
||
msgstr "При добавлении также добавить и це&левой путь"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
||
msgid "Alwa&ys expand tree"
|
||
msgstr "Все&гда разворачивать дерево"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
||
msgid "Show only &valid environment variables"
|
||
msgstr "Показывать только приемлемые п&еременные окружения"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
||
msgid "In pop&up, show [path also]"
|
||
msgstr "Показывать в меню так&же и [путь]"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Имя, а-я"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Имя, а-я"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
||
msgid "Directory Hotlist (reorder by drag && drop)"
|
||
msgstr "Избранные каталоги (сортируйте перетаскиванием)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Другие настройки"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
|
||
msgid "Name:"
|
||
msgstr "Имя:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
|
||
msgid "Path:"
|
||
msgstr "Путь:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
|
||
msgid "&Target:"
|
||
msgstr "&Целевой путь:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
||
msgid "...current le&vel of item(s) selected only"
|
||
msgstr "...текущий &уровень элемента(ов), только выделенные"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
|
||
msgid "Scan all &hotdir's path to validate the ones that actually exist"
|
||
msgstr "Проверить &существование всех путей"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
|
||
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
|
||
msgstr "Проверить существование &всех путей и целевых путей"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
||
msgid "to a Directory &Hotlist file (.hotlist)"
|
||
msgstr "в файл &избранных каталогов (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
|
||
msgstr "в файл \"wincmd.ini\" TC (&оставить существующие)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
|
||
msgstr "в файл \"wincmd.ini\" TC (&удалить существующие)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
||
msgid "Go to &configure TC related info"
|
||
msgstr "Перейти к &настройкам, связанным с TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
|
||
msgid "Go to &configure TC related info"
|
||
msgstr "Перейти к &настройкам, связанным с TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
||
msgid "HotDirTestMenu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
||
msgid "from a Directory &Hotlist file (.hotlist)"
|
||
msgstr "из файла &избранных каталогов (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
||
msgid "from \"&wincmd.ini\" of TC"
|
||
msgstr "из &файла \"wincmd.ini\" TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.minavigate.caption
|
||
msgid "&Navigate..."
|
||
msgstr "&Навигация..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
||
msgid "&Restore a backup of Directory Hotlist"
|
||
msgstr "&Восстановить избранные каталоги из резервной копии"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
||
msgid "&Save a backup of current Directory Hotlist"
|
||
msgstr "&Сохранить резервную копию избранных каталогов"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
||
msgid "Search and &replace..."
|
||
msgstr "Найти и &заменить..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
||
msgid "...everything, from A to &Z!"
|
||
msgstr "...все, от А до &Я!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
||
msgid "...single &group of item(s) only"
|
||
msgstr "...только &одну группу элементов"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
||
msgid "...&content of submenu(s) selected, no sublevel"
|
||
msgstr "...&содержимое выделенного(ых) подменю, но не подуровни"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and &all sublevels"
|
||
msgstr "...содержимое выделенного(ых) подменю и &все подуровни"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
|
||
msgid "Test resultin&g menu"
|
||
msgstr "Проверить полученное &меню"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
|
||
msgid "Tweak &path"
|
||
msgstr "Изменить &путь"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
|
||
msgid "Tweak &target path"
|
||
msgstr "Изменить &целевой путь"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
||
msgid "Addition from main panel"
|
||
msgstr "Добавление из главной панели"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
||
msgid "From all the supported formats, ask which one to use every time"
|
||
msgstr "Предлагать все поддерживаемые форматы, спрашивать каждый раз"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
||
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
||
msgstr "При сохранении текста в Unicode сохранять в кодировке UTF-8 (иначе будет UTF-16 LE)"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
||
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
||
msgstr "При перетаскивании текста генерировать имя файла автоматически (иначе будет спрашивать)"
|
||
|
||
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
||
msgid "&Show confirmation dialog after drop"
|
||
msgstr "По&казать диалог подтверждения при перетаскивании"
|
||
|
||
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
||
msgid "When drag && dropping text into panels:"
|
||
msgstr "При перетаскивании текста в панель:"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
||
msgid "Place the most desired format on top of list (use dag && drop):"
|
||
msgstr "Расположите форматы в порядке убывания предпочтения (используйте перетаскивание):"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
||
msgid "(if the most desired is not present, we'll take second one and so on)"
|
||
msgstr "(если наиболее предпочтительный не поддерживается, будет взят второй и так далее)"
|
||
|
||
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
||
msgid "(will not work with some source application, so try to uncheck if problem)"
|
||
msgstr "(не будет работать с некоторыми приложениями, поэтому если есть проблемы, то попробуйте снять галочку)"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
||
msgid "Show &file system"
|
||
msgstr "Тип &файловой системы"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
||
msgid "Show fr&ee space"
|
||
msgstr "&Свободное место"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
||
msgid "Show &label"
|
||
msgstr "&Метка"
|
||
|
||
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
||
msgid "Drives list"
|
||
msgstr "Список дисков"
|
||
|
||
#: tfrmoptionseditor.chkautoindent.caption
|
||
msgid "Auto Indent"
|
||
msgstr "Автоматический отступ"
|
||
|
||
#: tfrmoptionseditor.chkautoindent.hint
|
||
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
|
||
msgstr "При нажатии клавиши Enter новая строка будет создана с тем же отступом, что и у предыдущей"
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.caption
|
||
msgid "Caret past end of line"
|
||
msgstr "Прокручивать за конец строки"
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.hint
|
||
msgid "Allows caret to go into empty space beyond end-of-line position"
|
||
msgstr "Позволяет перемещать каретку в пустое пространство за пределом конца строки"
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.caption
|
||
msgid "Show special characters"
|
||
msgstr "Показывать специальные символы"
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.hint
|
||
msgid "Shows special characters for spaces and tabulations"
|
||
msgstr "Пробелы и табуляции будут обозначаться специальными символами"
|
||
|
||
#: tfrmoptionseditor.chksmarttabs.caption
|
||
msgid "Smart Tabs"
|
||
msgstr "\"Умные\" табуляции"
|
||
|
||
#: tfrmoptionseditor.chksmarttabs.hint
|
||
msgid "When using <Tab> key, caret will go to the next non-space character of the previous line"
|
||
msgstr "Нажатия клавиши Tab будут перемещать каретку к позиции под следующим непробельным символом предыдущей строки"
|
||
|
||
#: tfrmoptionseditor.chktabindent.caption
|
||
msgid "Tab indents blocks"
|
||
msgstr "Tab меняет отступ блоков"
|
||
|
||
#: tfrmoptionseditor.chktabindent.hint
|
||
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
|
||
msgstr "Нажатия клавиш Tab и Shift+Tab соответственно увеличивают и уменьшают отступ выделенного текста"
|
||
|
||
#: tfrmoptionseditor.chktabstospaces.caption
|
||
msgid "Use spaces instead tab characters"
|
||
msgstr "Использовать пробелы вместо символов табуляции"
|
||
|
||
#: tfrmoptionseditor.chktabstospaces.hint
|
||
msgid "Converts tab characters to a specified number of space characters (when entering)"
|
||
msgstr "Конвертировать символы табуляции в заданное количество пробелов (при вводе)"
|
||
|
||
#: tfrmoptionseditor.chktrimtrailingspaces.caption
|
||
msgid "Delete trailing spaces"
|
||
msgstr "Удалять концевые пробелы"
|
||
|
||
#: tfrmoptionseditor.chktrimtrailingspaces.hint
|
||
msgid "Auto delete trailing spaces, this applies only to edited lines"
|
||
msgstr "Автоматическое удаление концевых пробелов, применяется только к редактируемым строкам"
|
||
|
||
#: tfrmoptionseditor.edtabwidth.hint
|
||
msgctxt "tfrmoptionseditor.edtabwidth.hint"
|
||
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
|
||
msgstr "Обратите внимание, опция \"Умные табуляции\" имеет преимущество над заданным значением"
|
||
|
||
#: tfrmoptionseditor.gbinternaleditor.caption
|
||
msgid "Internal editor options"
|
||
msgstr "Опции встроенного редактора"
|
||
|
||
#: tfrmoptionseditor.lbltabwidth.caption
|
||
msgid "Tab width:"
|
||
msgstr "Ширина табуляции:"
|
||
|
||
#: tfrmoptionseditor.lbltabwidth.hint
|
||
msgctxt "tfrmoptionseditor.lbltabwidth.hint"
|
||
msgid "Please note that the \"Smart Tabs\" option takes precedence over the tabulation to be performed"
|
||
msgstr "Обратите внимание, опция \"Умные табуляции\" имеет преимущество над заданным значением"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "Фо&н"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "Фо&н"
|
||
|
||
#: tfrmoptionseditorcolors.btnresetmask.hint
|
||
msgid "Reset"
|
||
msgstr "Сбросить"
|
||
|
||
#: tfrmoptionseditorcolors.btnsavemask.hint
|
||
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
|
||
msgid "Save"
|
||
msgstr "Сохранить"
|
||
|
||
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
||
msgid "Element Attributes"
|
||
msgstr "Атрибуты элементов"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
||
msgid "Fo®round"
|
||
msgstr "&Цвет текста"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
|
||
msgid "Fo®round"
|
||
msgstr "&Цвет текста"
|
||
|
||
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
||
msgid "&Text-mark"
|
||
msgstr "О&тметка"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
||
msgid "Use (and edit) &global scheme settings"
|
||
msgstr "Использовать (и менять) &глобальную схему"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
||
msgid "Use &local scheme settings"
|
||
msgstr "Использовать &локальную схему"
|
||
|
||
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
||
msgid "&Bold"
|
||
msgstr "&Жирный"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "О&братить"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "В&ыкл."
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Вкл."
|
||
|
||
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
||
msgid "&Italic"
|
||
msgstr "К&урсив"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "О&братить"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "В&ыкл."
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Вкл."
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
||
msgid "&Strike Out"
|
||
msgstr "&Зачёркнутый"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "О&братить"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "В&ыкл."
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Вкл."
|
||
|
||
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
||
msgid "&Underline"
|
||
msgstr "По&дчёркнутый"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "О&братить"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "В&ыкл."
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Вкл."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnadd.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
|
||
msgid "Add..."
|
||
msgstr "Добавить..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btndelete.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
|
||
msgid "Delete..."
|
||
msgstr "Удалить..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
||
msgid "Import/Export"
|
||
msgstr "Импорт/Экспорт"
|
||
|
||
#: tfrmoptionsfavoritetabs.btninsert.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
|
||
msgid "Insert..."
|
||
msgstr "Вставить..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnrename.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Переименовать"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnsort.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
|
||
msgid "Sort..."
|
||
msgstr "Сортировать..."
|
||
|
||
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "Нет"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
|
||
msgid "Always expand tree"
|
||
msgstr "Всегда разворачивать дерево"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Нет"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
||
msgid "Right"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
||
msgid "Favorite Tabs list (reorder by drag && drop)"
|
||
msgstr "Список избранных вкладок (сортируйте перетаскиванием)"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Другие настройки"
|
||
|
||
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
||
msgid "What to restore where for the selected entry:"
|
||
msgstr "Что восстановить для выбранной записи:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
||
msgid "Existing tabs to keep:"
|
||
msgstr "Сохранять существующие вкладки:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
||
msgid "Save dir history:"
|
||
msgstr "Сохранять историю каталогов:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
||
msgid "Tabs saved on left to be restored to:"
|
||
msgstr "Сохранённые слева вкладки будут восстановлены:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
||
msgid "Tabs saved on right to be restored to:"
|
||
msgstr "Сохранённые справа вкладки будут восстановлены:"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
|
||
msgid "a separator"
|
||
msgstr "разделитель"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
||
msgid "Add separator"
|
||
msgstr "Добавить разделитель"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
|
||
msgid "sub-menu"
|
||
msgstr "подменю"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
|
||
msgid "Add sub-menu"
|
||
msgstr "Добавить подменю"
|
||
|
||
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Свернуть все"
|
||
|
||
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr "...текущий уровень элемента(ов), только выделенные"
|
||
|
||
#: tfrmoptionsfavoritetabs.micutselection.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
|
||
msgid "Cut"
|
||
msgstr "Вырезать"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
|
||
msgid "delete all!"
|
||
msgstr "удалить все!"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "подменю и все его элементы"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "только подменю без элементов"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
|
||
msgid "selected item"
|
||
msgstr "выделенный элемент"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Удалить выделенный элемент"
|
||
|
||
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
||
msgid "Export selection to legacy .tab file(s)"
|
||
msgstr "Экспортировать выбранное в TAB-файл(ы)"
|
||
|
||
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
||
msgid "FavoriteTabsTestMenu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
||
msgid "Import legacy .tab file(s) according to default setting"
|
||
msgstr "Импортировать TAB-файл(ы) с настройками по умолчанию"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr "Импортировать TAB-файл(ы) в выбранную позицию"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr "Импортировать TAB-файл(ы) в выбранную позицию"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
||
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
||
msgstr "Импортировать TAB-файл(ы) в подменю в выбранной позиции"
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
||
msgid "Insert separator"
|
||
msgstr "Вставить разделитель"
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
||
msgid "Insert sub-menu"
|
||
msgstr "Вставить подменю"
|
||
|
||
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Развернуть все ветки"
|
||
|
||
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
|
||
msgid "Paste"
|
||
msgstr "Вставить"
|
||
|
||
#: tfrmoptionsfavoritetabs.mirename.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
|
||
msgid "Rename"
|
||
msgstr "Переименовать"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "...все, от А до Я!"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr "...только одну группу элементов"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr "Сортировать только одну группу элементов"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr "...содержимое выделенного(ых) подменю, но не подуровни"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr "...содержимое выделенного(ых) подменю и все подуровни"
|
||
|
||
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr "Проверить полученное меню"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
|
||
msgid "Add"
|
||
msgstr "Добавить"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
|
||
msgid "Add"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmoptionsfileassoc.btncloneact.caption
|
||
msgid "C&lone"
|
||
msgstr "Клонировать"
|
||
|
||
#: tfrmoptionsfileassoc.btncommands.hint
|
||
msgctxt "tfrmoptionsfileassoc.btncommands.hint"
|
||
msgid "Select your internal command"
|
||
msgstr "Выберите внутреннюю команду"
|
||
|
||
#: tfrmoptionsfileassoc.btndownact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
|
||
msgid "Do&wn"
|
||
msgstr "&Вниз"
|
||
|
||
#: tfrmoptionsfileassoc.btneditext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
|
||
msgid "Edi&t"
|
||
msgstr "Редактировать"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
||
msgid "Insert"
|
||
msgstr "Вставить"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
|
||
msgid "&Insert"
|
||
msgstr "Вставить"
|
||
|
||
#: tfrmoptionsfileassoc.btnparametershelper.hint
|
||
msgctxt "tfrmoptionsfileassoc.btnparametershelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsfileassoc.btnrelativecommand.hint
|
||
msgctxt "tfrmoptionsfileassoc.btnrelativecommand.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
|
||
msgid "Remo&ve"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveext.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
|
||
msgid "Re&move"
|
||
msgstr "Уд&алить"
|
||
|
||
#: tfrmoptionsfileassoc.btnremovetype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
|
||
msgid "&Remove"
|
||
msgstr "Уда&лить"
|
||
|
||
#: tfrmoptionsfileassoc.btnrenametype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
||
msgid "R&ename"
|
||
msgstr "Пе&реименовать"
|
||
|
||
#: tfrmoptionsfileassoc.btnstartpathpathhelper.hint
|
||
msgctxt "tfrmoptionsfileassoc.btnstartpathpathhelper.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionsfileassoc.btnstartpathvarhelper.hint
|
||
msgctxt "tfrmoptionsfileassoc.btnstartpathvarhelper.hint"
|
||
msgid "Variable reminder helper"
|
||
msgstr "Помощник с переменными"
|
||
|
||
#: tfrmoptionsfileassoc.btnupact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
|
||
msgid "&Up"
|
||
msgstr "Вв&ерх"
|
||
|
||
#: tfrmoptionsfileassoc.destartpath.hint
|
||
msgid "Starting path of the command. Never quote this string."
|
||
msgstr "Путь запуска команды. Не используйте кавычки."
|
||
|
||
#: tfrmoptionsfileassoc.edbactionname.hint
|
||
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
||
msgstr "Название действия. Оно никогда не передаётся в систему, это просто выбранное вами мнемоническое имя, для вас"
|
||
|
||
#: tfrmoptionsfileassoc.edtparams.hint
|
||
msgid "Parameter to pass to the command. Long filename with spaces should be quoted (manually entering)."
|
||
msgstr "Параметры, передаваемые команде. Имя файла с пробелами должно быть заключено в кавычки (вручную)."
|
||
|
||
#: tfrmoptionsfileassoc.fnecommand.hint
|
||
msgid "Command to execute. Never quote this string."
|
||
msgstr "Команда для выполнения. Не используйте кавычки."
|
||
|
||
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
||
msgid "Action description"
|
||
msgstr "Описание действия"
|
||
|
||
#: tfrmoptionsfileassoc.gbactions.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
||
msgid "Actions"
|
||
msgstr "Действия"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
|
||
msgid "Extensions"
|
||
msgstr "Расширения"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.hint
|
||
msgid "Can be sorted by drag & drop"
|
||
msgstr "Могут быть отсортированы перетаскиванием"
|
||
|
||
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
||
msgid "File types"
|
||
msgstr "Типы файлов"
|
||
|
||
#: tfrmoptionsfileassoc.gbicon.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
|
||
msgid "Icon"
|
||
msgstr "Значок"
|
||
|
||
#: tfrmoptionsfileassoc.lbactions.hint
|
||
msgid "Actions may be sorted by drag & drop"
|
||
msgstr "Действия могут быть отсортированы перетаскиванием"
|
||
|
||
#: tfrmoptionsfileassoc.lbexts.hint
|
||
msgid "Extensions may be sorted by drag & drop"
|
||
msgstr "Расширения могут быть отсортированы перетаскиванием"
|
||
|
||
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
||
msgid "File types may be sorted by drag & drop"
|
||
msgstr "Типы файлов могут быть отсортированы перетаскиванием"
|
||
|
||
#: tfrmoptionsfileassoc.lblaction.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
|
||
msgid "Action &name:"
|
||
msgstr "Название:"
|
||
|
||
#: tfrmoptionsfileassoc.lblcommand.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
|
||
msgid "Command:"
|
||
msgstr "&Команда:"
|
||
|
||
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Параметры:"
|
||
|
||
#: tfrmoptionsfileassoc.lblstartpath.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "П&уть запуска:"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem3.caption
|
||
msgid "Custom with..."
|
||
msgstr "Пользовательское с..."
|
||
|
||
#: tfrmoptionsfileassoc.micustom.caption
|
||
msgid "Custom"
|
||
msgstr "Пользовательское"
|
||
|
||
#: tfrmoptionsfileassoc.miedit.caption
|
||
msgctxt "tfrmoptionsfileassoc.miedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Редактировать"
|
||
|
||
#: tfrmoptionsfileassoc.mieditor.caption
|
||
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
|
||
msgid "Open in Editor"
|
||
msgstr "Открыть в редакторе"
|
||
|
||
#: tfrmoptionsfileassoc.mieditwith.caption
|
||
msgid "Edit with..."
|
||
msgstr "Редактировать с помощью..."
|
||
|
||
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
||
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
|
||
msgid "Get output from command"
|
||
msgstr "Получить вывод команды"
|
||
|
||
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
||
msgid "Open in Internal Editor"
|
||
msgstr "Открыть во встроенном редакторе"
|
||
|
||
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
||
msgid "Open in Internal Viewer"
|
||
msgstr "Открыть во встроенном просмотрщике"
|
||
|
||
#: tfrmoptionsfileassoc.miopen.caption
|
||
msgctxt "tfrmoptionsfileassoc.miopen.caption"
|
||
msgid "Open"
|
||
msgstr "Открыть"
|
||
|
||
#: tfrmoptionsfileassoc.miopenwith.caption
|
||
msgid "Open with..."
|
||
msgstr "Открыть с помощью..."
|
||
|
||
#: tfrmoptionsfileassoc.mishell.caption
|
||
msgctxt "tfrmoptionsfileassoc.mishell.caption"
|
||
msgid "Run in terminal"
|
||
msgstr "Запустить в терминале"
|
||
|
||
#: tfrmoptionsfileassoc.miview.caption
|
||
msgctxt "tfrmoptionsfileassoc.miview.caption"
|
||
msgid "View"
|
||
msgstr "Просмотреть"
|
||
|
||
#: tfrmoptionsfileassoc.miviewer.caption
|
||
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
|
||
msgid "Open in Viewer"
|
||
msgstr "Открыть в просмотрщике"
|
||
|
||
#: tfrmoptionsfileassoc.miviewwith.caption
|
||
msgid "View with..."
|
||
msgstr "Просмотреть с помощью..."
|
||
|
||
#: tfrmoptionsfileassoc.sbtnicon.hint
|
||
msgid "Click me to change icon!"
|
||
msgstr "Нажмите здесь для смены значка"
|
||
|
||
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
||
msgid "Execute via shell"
|
||
msgstr "Запустить с помощью оболочки"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
||
msgid "Extended context menu"
|
||
msgstr "Расширенное контекстное меню"
|
||
|
||
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
||
msgid "File association configuration"
|
||
msgstr "Настроить файловые ассоциации"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
||
msgid "Offer to add selection to file association when not included already"
|
||
msgstr "Предлагать добавить в файловые ассоциации файл под курсором (если ещё не включен)"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr "При открытии настроек файловых ассоциаций будет предложено добавить тип с расширением файла под курсором (если оно не найдено в уже существующих типах)"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Запустить в терминале и закрыть"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Запустить в терминале и оставить открытым"
|
||
|
||
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
||
msgid "Extended options items:"
|
||
msgstr "Дополнительные пункты:"
|
||
|
||
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
||
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
|
||
msgid "Show confirmation window for:"
|
||
msgstr "Показывать окно подтверждения для следующих операций:"
|
||
|
||
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
||
msgid "Cop&y operation"
|
||
msgstr "&Копирование"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
||
msgid "&Delete operation"
|
||
msgstr "&Удаление"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDELETETOTRASH.CAPTION"
|
||
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
||
msgstr "Удаление в Корзину (с Shift - око&нчательно)"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
||
msgid "D&elete to trash operation"
|
||
msgstr "У&даление в корзину"
|
||
|
||
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "D&rop readonly flag"
|
||
msgstr "&Сбросить флаг \"Только для чтения\""
|
||
|
||
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
||
msgid "&Move operation"
|
||
msgstr "П&еремещение"
|
||
|
||
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBPROCESSCOMMENTS.CAPTION"
|
||
msgid "&Process comments with files/folders"
|
||
msgstr "О&брабатывать комментарии с файлами/папками"
|
||
|
||
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBRENAMESELONLYNAME.CAPTION"
|
||
msgid "Select &file name without extension when renaming"
|
||
msgstr "П&ри переименовании выделять только имя файла, без расширения"
|
||
|
||
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSHOWCOPYTABSELECTPANEL.CAPTION"
|
||
msgid "Sho&w tab select panel in copy/move dialog"
|
||
msgstr "Показ&ывать панель выбора вкладок в диалоге копирования/перемещения"
|
||
|
||
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSKIPFILEOPERROR.CAPTION"
|
||
msgid "S&kip file operations errors and write them to log window"
|
||
msgstr "Пропускать о&шибки при файловых операциях и выводить их в окно протокола"
|
||
|
||
#: tfrmoptionsfileoperations.cbverifychecksumconfirmation.caption
|
||
msgid "Verify checksum operation"
|
||
msgstr "Проверка контрольных сумм"
|
||
|
||
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
||
msgid "Executing operations"
|
||
msgstr "Выполнение операций"
|
||
|
||
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
||
msgid "User interface"
|
||
msgstr "Пользовательский интерфейс"
|
||
|
||
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
||
msgid "&Buffer size for file operations (in KB):"
|
||
msgstr "Ра&змер буфера для файловых операций (Кб):"
|
||
|
||
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
||
msgid "Buffer size for &hash calculation (in KB):"
|
||
msgstr "Размер буфера для вычисления &хэша (Кб):"
|
||
|
||
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
||
msgid "Show operations progress &initially in"
|
||
msgstr "Показыват&ь прогресс операций в"
|
||
|
||
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
||
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
|
||
msgid "Duplicated name auto-rename style:"
|
||
msgstr "Стиль автопереименования совпадающих имён:"
|
||
|
||
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLWIPEPASSNUMBER.CAPTION"
|
||
msgid "&Number of wipe passes:"
|
||
msgstr "Число перезаписе&й при стирании (Wipe):"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
||
msgid "Reset to DC default"
|
||
msgstr "Сбросить на умолчания DC"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Разрешить наложение цвета"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEFRAMECURSOR.CAPTION"
|
||
msgid "Use &Frame Cursor"
|
||
msgstr "К&урсор-рамка"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
||
msgid "Use &Gradient Indicator"
|
||
msgstr "Использовать &градиентный индикатор"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Sel Color"
|
||
msgstr "Курсор в неактивной панели"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "U&se Inverted Selection"
|
||
msgstr "Инверсное в&ыделение"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Рамка вокруг курсора"
|
||
|
||
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
|
||
msgid "Drive Free Space Indicator"
|
||
msgstr "Индикатор свободного места"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR.CAPTION"
|
||
msgid "Bac&kground:"
|
||
msgstr "&Фон 1:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
|
||
msgid "Backg&round 2:"
|
||
msgstr "Фо&н 2:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
|
||
msgid "C&ursor Color:"
|
||
msgstr "&Курсор:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
|
||
msgid "Cursor Te&xt:"
|
||
msgstr "Т&екст под курсором:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Неактивный курсор:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Неактивное выделение:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEPANELBRIGHTNESS.CAPTION"
|
||
msgid "&Brightness level of inactive panel"
|
||
msgstr "Уровень &яркости неактивной панели"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
||
msgid "In&dicator Back Color:"
|
||
msgstr "Цвет фона &индикатора:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
||
msgid "&Indicator Fore Color:"
|
||
msgstr "&Цвет индикатора:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
|
||
msgid "&Mark Color:"
|
||
msgstr "&Выделение:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
||
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
||
msgstr "Ниже находится предварительный просмотр. Вы можете перемещать курсор и выбирать файлы, чтобы получить полное представление о выбранных настройках."
|
||
|
||
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
|
||
msgid "T&ext Color:"
|
||
msgstr "&Текст:"
|
||
|
||
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
||
msgid "When launching file search, clear file mask filter"
|
||
msgstr "При запуске поиска очистить фильтр маски файла"
|
||
|
||
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
||
msgid "&Search for part of file name"
|
||
msgstr "По&иск по части имени"
|
||
|
||
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
||
msgid "Show menu bar in \"Find files\""
|
||
msgstr "Показать меню окна в \"Поиск файлов\""
|
||
|
||
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
||
msgid "Text search in files"
|
||
msgstr "Поиск текста в файлах"
|
||
|
||
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
||
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
|
||
msgid "File search"
|
||
msgstr "Поиск файлов"
|
||
|
||
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
||
msgid "Current filters with \"New search\" button:"
|
||
msgstr "Текущие фильтры после нажатия \"Новый поиск\":"
|
||
|
||
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
||
msgid "Default search template:"
|
||
msgstr "Шаблон поиска по умолчанию:"
|
||
|
||
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
||
msgid "Use memory mapping for search te&xt in files"
|
||
msgstr "Использовать отобра&жение в память"
|
||
|
||
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
||
msgid "&Use stream for search text in files"
|
||
msgstr "Испо&льзовать поток"
|
||
|
||
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
||
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
||
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Помощ&ь"
|
||
|
||
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
||
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
||
msgstr "Разрешить переход в родительский каталог двойным щелчком по свободному месту в файловой панели"
|
||
|
||
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
||
msgid "Do&n't load file list until a tab is activated"
|
||
msgstr "&Не загружать список файлов, пока вкладка не будет активирована"
|
||
|
||
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBDIRBRACKETS.CAPTION"
|
||
msgid "S&how square brackets around directories"
|
||
msgstr "Показыват&ь квадратные скобки вокруг имён папок"
|
||
|
||
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
||
msgid "Hi&ghlight new and updated files"
|
||
msgstr "По&дсвечивать новые и изменённые файлы"
|
||
|
||
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
||
msgid "Enable inplace &renaming when clicking twice on a name"
|
||
msgstr "Разрешить &переименование при щелчке по имени файла под курсором"
|
||
|
||
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
|
||
msgid "Load &file list in separate thread"
|
||
msgstr "Загру&жать список файлов в отдельном потоке"
|
||
|
||
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
|
||
msgid "Load icons af&ter file list"
|
||
msgstr "За&гружать значки после списка файлов"
|
||
|
||
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
||
msgid "Show s&ystem and hidden files"
|
||
msgstr "Показывать систе&мные и скрытые файлы"
|
||
|
||
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBSPACEMOVESDOWN.CAPTION"
|
||
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
||
msgstr "При в&ыделении файлов пробелом перемещать курсор на следующий файл"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
|
||
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
||
msgstr "Фильтр для файлов в стиле Windows (\"*.*\" выделяет также файлы без расширения и т.д.)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
|
||
msgid "Use an independent attribute filter in mask input dialog each time"
|
||
msgstr "Каждый раз показывать в окне ввода независимый фильтр маски атрибутов"
|
||
|
||
#: tfrmoptionsfilesviews.gbformatting.caption
|
||
msgid "Formatting"
|
||
msgstr "Форматирование"
|
||
|
||
#: tfrmoptionsfilesviews.gbmarking.caption
|
||
msgid "Marking/Unmarking entries"
|
||
msgstr "Выделение/снятие выделения"
|
||
|
||
#: tfrmoptionsfilesviews.gbsorting.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.GBSORTING.CAPTION"
|
||
msgid "Sorting"
|
||
msgstr "Сортировка"
|
||
|
||
#: tfrmoptionsfilesviews.lbattributemask.caption
|
||
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
|
||
msgid "Default attribute mask value to use:"
|
||
msgstr "Маска атрибута по умолчанию:"
|
||
|
||
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
||
msgid "Case s&ensitivity:"
|
||
msgstr "&Чувствительность к регистру:"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
||
msgid "Incorrect format"
|
||
msgstr "Неверный формат"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.LBLDATETIMEFORMAT.CAPTION"
|
||
msgid "&Date and time format:"
|
||
msgstr "&Формат даты и времени:"
|
||
|
||
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
||
msgid "File si&ze format:"
|
||
msgstr "Формат ра&змера файла:"
|
||
|
||
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
||
msgid "&Insert new files:"
|
||
msgstr "&Вставлять новые файлы:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
||
msgid "So&rting directories:"
|
||
msgstr "Со&ртировка каталогов:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.LBLSORTMETHOD.CAPTION"
|
||
msgid "&Sort method:"
|
||
msgstr "Метод &сортировки:"
|
||
|
||
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
||
msgid "&Move updated files:"
|
||
msgstr "П&еремещать изменённые файлы:"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "П&рименить"
|
||
|
||
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Шаблон..."
|
||
|
||
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.GBFILETYPESCOLORS.CAPTION"
|
||
msgid "File types colors (sort by drag&&drop)"
|
||
msgstr "Цвета по типу (сортировка перетаскиванием)"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYATTR.CAPTION"
|
||
msgid "Category a&ttributes:"
|
||
msgstr "&Атрибуты:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYCOLOR.CAPTION"
|
||
msgid "Category co&lor:"
|
||
msgstr "&Цвет:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "&Маска:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "&Имя:"
|
||
|
||
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnseleditfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsellogfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselmainfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.lblconsolefont.caption
|
||
msgid "&Console font"
|
||
msgstr "&Консоль"
|
||
|
||
#: tfrmoptionsfonts.lbleditorfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
|
||
msgid "&Editor font"
|
||
msgstr "&Редактор"
|
||
|
||
#: tfrmoptionsfonts.lbllogfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
|
||
msgid "&Log font"
|
||
msgstr "Протоко&л"
|
||
|
||
#: tfrmoptionsfonts.lblmainfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
|
||
msgid "Main &font"
|
||
msgstr "О&сновной"
|
||
|
||
#: tfrmoptionsfonts.lblpatheditfont.caption
|
||
msgid "Path font"
|
||
msgstr "Текущий &путь"
|
||
|
||
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
||
msgid "Search results font"
|
||
msgstr "Результаты поиска"
|
||
|
||
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
|
||
msgid "Viewer&Book Font"
|
||
msgstr "Просмотрщик в режиме \"&Книга\""
|
||
|
||
#: tfrmoptionsfonts.lblviewerfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
|
||
msgid "&Viewer font"
|
||
msgstr "Прос&мотрщик"
|
||
|
||
#: tfrmoptionshotkeys.actaddhotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
|
||
msgid "Add &hotkey"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmoptionshotkeys.actcopy.caption
|
||
msgctxt "tfrmoptionshotkeys.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "&Копировать"
|
||
|
||
#: tfrmoptionshotkeys.actdelete.caption
|
||
msgctxt "tfrmoptionshotkeys.actdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
|
||
msgid "&Delete hotkey"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmoptionshotkeys.actedithotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
|
||
msgid "&Edit hotkey"
|
||
msgstr "&Редактировать"
|
||
|
||
#: tfrmoptionshotkeys.actnextcategory.caption
|
||
msgid "Next category"
|
||
msgstr "Следующая категория"
|
||
|
||
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
||
msgid "Make popup the file related menu"
|
||
msgstr "Меню действий для набора"
|
||
|
||
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
||
msgid "Previous category"
|
||
msgstr "Предыдущая категория"
|
||
|
||
#: tfrmoptionshotkeys.actrename.caption
|
||
msgctxt "tfrmoptionshotkeys.actrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Переименовать"
|
||
|
||
#: tfrmoptionshotkeys.actrestoredefault.caption
|
||
msgid "Restore DC default"
|
||
msgstr "Восстановить настройки DC"
|
||
|
||
#: tfrmoptionshotkeys.actsavenow.caption
|
||
msgid "Save now"
|
||
msgstr "Сохранить сейчас"
|
||
|
||
#: tfrmoptionshotkeys.actsortbycommand.caption
|
||
msgid "Sort by command name"
|
||
msgstr "По имени команды"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
||
msgid "Sort by hotkeys (grouped)"
|
||
msgstr "По горячим клавишам (группировать)"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
||
msgid "Sort by hotkeys (one per row)"
|
||
msgstr "По горячим клавишам (одна на строку)"
|
||
|
||
#: tfrmoptionshotkeys.lbfilter.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
|
||
msgid "&Filter"
|
||
msgstr "&Фильтр"
|
||
|
||
#: tfrmoptionshotkeys.lblcategories.caption
|
||
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
|
||
msgid "C&ategories:"
|
||
msgstr "К&атегории:"
|
||
|
||
#: tfrmoptionshotkeys.lblcommands.caption
|
||
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
|
||
msgid "Co&mmands:"
|
||
msgstr "Ко&манды:"
|
||
|
||
#: tfrmoptionshotkeys.lblscfiles.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
|
||
msgid "&Shortcut files:"
|
||
msgstr "&Набор горячих клавиш:"
|
||
|
||
#: tfrmoptionshotkeys.lblsortorder.caption
|
||
msgid "So&rt order:"
|
||
msgstr "Порядок &сортировки:"
|
||
|
||
#: tfrmoptionshotkeys.micategories.caption
|
||
msgid "Categories"
|
||
msgstr "Категории"
|
||
|
||
#: tfrmoptionshotkeys.micommands.caption
|
||
msgctxt "tfrmoptionshotkeys.micommands.caption"
|
||
msgid "Command"
|
||
msgstr "Команда"
|
||
|
||
#: tfrmoptionshotkeys.miseparator1.caption
|
||
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionshotkeys.misortorder.caption
|
||
msgid "Sort order"
|
||
msgstr "Порядок сортировки"
|
||
|
||
#: tfrmoptionsicons.cbiconsexclude.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Для следующих &каталогов и их подкаталогов:"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenus.caption
|
||
msgid "Show icons for actions in &menus"
|
||
msgstr "Показывать значки для &команд в меню"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenussize.text
|
||
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
||
msgid "Show icons on buttons"
|
||
msgstr "Показывать значки на кнопках"
|
||
|
||
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
|
||
msgid "Show o&verlay icons, e.g. for links"
|
||
msgstr "Показывать &оверлейные значки (например, для ярлыков)"
|
||
|
||
#: tfrmoptionsicons.chkshowhiddendimmed.caption
|
||
msgid "&Dimmed hidden files (slower)"
|
||
msgstr "Затен&ять значки скрытых файлов (медленнее)"
|
||
|
||
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
||
msgid "Disable special icons"
|
||
msgstr "Отключить загрузку специальных значков"
|
||
|
||
#: tfrmoptionsicons.gbiconssize.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
|
||
msgid " Icon size "
|
||
msgstr " Размер значков "
|
||
|
||
#: tfrmoptionsicons.gbicontheme.caption
|
||
msgid "Icon theme"
|
||
msgstr "Тема значков"
|
||
|
||
#: tfrmoptionsicons.gbshowicons.caption
|
||
msgid "Show icons"
|
||
msgstr "Показывать значки"
|
||
|
||
#: tfrmoptionsicons.gbshowiconsmode.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
|
||
msgid " Show icons to the left of the filename "
|
||
msgstr " Показ значков, связанных с типом файлов "
|
||
|
||
#: tfrmoptionsicons.lbldiskpanel.caption
|
||
msgid "Disk panel:"
|
||
msgstr "Панель дисков:"
|
||
|
||
#: tfrmoptionsicons.lblfilepanel.caption
|
||
msgid "File panel:"
|
||
msgstr "Панель файлов:"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowall.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
||
msgid "A&ll"
|
||
msgstr "&Все"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
|
||
msgid "All associated + &EXE/LNK (slow)"
|
||
msgstr "Вс&е ассоциированные + EXE/LNK (медленно)"
|
||
|
||
#: tfrmoptionsicons.rbiconsshownone.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
|
||
msgid "&No icons"
|
||
msgstr "&Не показывать значки"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
|
||
msgid "Only &standard icons"
|
||
msgstr "Только &стандартные"
|
||
|
||
#: tfrmoptionsignorelist.btnaddsel.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
|
||
msgid "A&dd selected names"
|
||
msgstr "&Добавить все выделенные"
|
||
|
||
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
|
||
msgid "Add selected names with &full path"
|
||
msgstr "До&бавить все выделенные с путями"
|
||
|
||
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
||
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionsignorelist.chkignoreenable.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
|
||
msgid "&Ignore (don't show) the following files and folders:"
|
||
msgstr "&Исключить (не показывать) следующие файлы и каталоги:"
|
||
|
||
#: tfrmoptionsignorelist.lblsavein.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
|
||
msgid "&Save in:"
|
||
msgstr "&Сохранить в:"
|
||
|
||
#: tfrmoptionskeyboard.cblynxlike.caption
|
||
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
||
msgstr "П&равая и левая стрелки меняют каталог (Lynx-поведение)"
|
||
|
||
#: tfrmoptionskeyboard.gbtyping.caption
|
||
msgid "Typing"
|
||
msgstr "Ввод"
|
||
|
||
#: tfrmoptionskeyboard.lblalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
|
||
msgid "Alt+L&etters:"
|
||
msgstr "Alt+Б&уква:"
|
||
|
||
#: tfrmoptionskeyboard.lblctrlalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
|
||
msgid "Ctrl+Alt+Le&tters:"
|
||
msgstr "Ctrl+Alt+Бу&ква:"
|
||
|
||
#: tfrmoptionskeyboard.lblnomodifier.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
|
||
msgid "&Letters:"
|
||
msgstr "&Буквы:"
|
||
|
||
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
|
||
msgid "&Flat buttons"
|
||
msgstr "П&лоские кнопки"
|
||
|
||
#: tfrmoptionslayout.cbflatinterface.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
|
||
msgid "Flat i&nterface"
|
||
msgstr "Плоский инт&ерфейс"
|
||
|
||
#: tfrmoptionslayout.cbflattoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
|
||
msgid "Flat b&uttons"
|
||
msgstr "Пло&ские кнопки"
|
||
|
||
#: tfrmoptionslayout.cbfreespaceind.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
|
||
msgid "Show fr&ee space indicator on drive label"
|
||
msgstr "&Индикатор свободного места на диске"
|
||
|
||
#: tfrmoptionslayout.cblogwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
|
||
msgid "Show lo&g window"
|
||
msgstr "Окно протокола"
|
||
|
||
#: tfrmoptionslayout.cbpanelofoperations.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
|
||
msgid "Show panel of operation in background"
|
||
msgstr "Панель фонов&ых операций"
|
||
|
||
#: tfrmoptionslayout.cbproginmenubar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
|
||
msgid "Show common progress in menu bar"
|
||
msgstr "Об&щий прогресс в меню"
|
||
|
||
#: tfrmoptionslayout.cbshowcmdline.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
|
||
msgid "Show command l&ine"
|
||
msgstr "Ко&мандная строка"
|
||
|
||
#: tfrmoptionslayout.cbshowcurdir.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
|
||
msgid "Show current director&y"
|
||
msgstr "Тек&ущий путь"
|
||
|
||
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
|
||
msgid "Show &drive buttons"
|
||
msgstr "Кнопки &дисков"
|
||
|
||
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
|
||
msgid "Show free s&pace label"
|
||
msgstr "Строка сво&бодного места на диске"
|
||
|
||
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
||
msgid "Show drives list bu&tton"
|
||
msgstr "К&нопка списка дисков"
|
||
|
||
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
|
||
msgid "Show function &key buttons"
|
||
msgstr "Кнопки &функциональных клавиш"
|
||
|
||
#: tfrmoptionslayout.cbshowmainmenu.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
|
||
msgid "Show &main menu"
|
||
msgstr "&Главное меню"
|
||
|
||
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
|
||
msgid "Show tool&bar"
|
||
msgstr "П&анель инструментов"
|
||
|
||
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
||
msgid "Show short free space &label"
|
||
msgstr "К&ратко"
|
||
|
||
#: tfrmoptionslayout.cbshowstatusbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
|
||
msgid "Show &status bar"
|
||
msgstr "Строка состо&яния"
|
||
|
||
#: tfrmoptionslayout.cbshowtabheader.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
|
||
msgid "S&how tabstop header"
|
||
msgstr "&Заголовки табуляторов"
|
||
|
||
#: tfrmoptionslayout.cbshowtabs.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
|
||
msgid "Sho&w folder tabs"
|
||
msgstr "В&кладки каталогов"
|
||
|
||
#: tfrmoptionslayout.cbtermwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
|
||
msgid "Show te&rminal window"
|
||
msgstr "Окно термина&ла"
|
||
|
||
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
|
||
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
||
msgstr "Д&ве панели кнопок дисков (над файловыми панелями)"
|
||
|
||
#: tfrmoptionslayout.gbscreenlayout.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
|
||
msgid " Screen layout "
|
||
msgstr " Компоненты основного окна "
|
||
|
||
#: tfrmoptionslog.btnrelativelogfile.hint
|
||
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionslog.btnviewlogfile.hint
|
||
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Просмотреть содержимое файла протокола"
|
||
|
||
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
||
msgid "Include date in log filename"
|
||
msgstr "Добавлять дату в имя файла протокола"
|
||
|
||
#: tfrmoptionslog.cblogarcop.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
|
||
msgid "&Pack/Unpack"
|
||
msgstr "Уп&аковка / Распаковка"
|
||
|
||
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
||
msgid "External command line execution"
|
||
msgstr "Выполнение внешней команды"
|
||
|
||
#: tfrmoptionslog.cblogcpmvln.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
|
||
msgid "Cop&y/Move/Create link/symlink"
|
||
msgstr "&Копирование / Перемещение / Создание ссылок"
|
||
|
||
#: tfrmoptionslog.cblogdelete.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Удаление"
|
||
|
||
#: tfrmoptionslog.cblogdirop.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
|
||
msgid "Crea&te/Delete directories"
|
||
msgstr "Со&здание / Удаление каталогов"
|
||
|
||
#: tfrmoptionslog.cblogerrors.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
|
||
msgid "Log &errors"
|
||
msgstr "О&шибки"
|
||
|
||
#: tfrmoptionslog.cblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
|
||
msgid "C&reate a log file:"
|
||
msgstr "Соз&дать файл протокола:"
|
||
|
||
#: tfrmoptionslog.cbloginfo.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
|
||
msgid "Log &information messages"
|
||
msgstr "&Информационные сообщения"
|
||
|
||
#: tfrmoptionslog.cblogstartshutdown.caption
|
||
msgid "Start/shutdown"
|
||
msgstr "Запуск / завершение"
|
||
|
||
#: tfrmoptionslog.cblogsuccess.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
|
||
msgid "Log &successful operations"
|
||
msgstr "У&спешные операции"
|
||
|
||
#: tfrmoptionslog.cblogvfs.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
|
||
msgid "&File system plugins"
|
||
msgstr "П&лагины файловой системы"
|
||
|
||
#: tfrmoptionslog.gblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
|
||
msgid "File operation log file"
|
||
msgstr "Отчёт о файловых операциях"
|
||
|
||
#: tfrmoptionslog.gblogfileop.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILEOP.CAPTION"
|
||
msgid "Log operations"
|
||
msgstr "Протоколируемые действия"
|
||
|
||
#: tfrmoptionslog.gblogfilestatus.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILESTATUS.CAPTION"
|
||
msgid "Operation status"
|
||
msgstr "Протоколировать операции со статусом"
|
||
|
||
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
||
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
||
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
||
msgid "&Remove thumbnails for no longer existing files"
|
||
msgstr "&Удалить эскизы для отсутствующих файлов"
|
||
|
||
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
||
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Просмотреть содержимое файла протокола"
|
||
|
||
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
||
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
|
||
msgid "Create new with the encoding:"
|
||
msgstr "Создавать новые с кодировкой:"
|
||
|
||
#: tfrmoptionsmisc.chkgotoroot.caption
|
||
msgid "Always &go to the root of a drive when changing drives"
|
||
msgstr "При смене диска всегда пере&ходить в корневой каталог"
|
||
|
||
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
||
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
|
||
msgid "Show &warning messages (\"OK\" button only)"
|
||
msgstr "По&казывать некритические сообщения об ошибках (с одной кнопкой \"ОК\")"
|
||
|
||
#: tfrmoptionsmisc.chkthumbsave.caption
|
||
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
|
||
msgid "&Save thumbnails in cache"
|
||
msgstr "&Сохранять эскизы в кэш"
|
||
|
||
#: tfrmoptionsmisc.dblthumbnails.caption
|
||
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Эскизы"
|
||
|
||
#: tfrmoptionsmisc.gbfilecomments.caption
|
||
msgid "File comments (descript.ion)"
|
||
msgstr "Комментарии к файлам (descript.ion)"
|
||
|
||
#: tfrmoptionsmisc.gbtcexportimport.caption
|
||
msgid "Regarding TC export/import:"
|
||
msgstr "Касательно TC экспорта/импорта:"
|
||
|
||
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
||
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
|
||
msgid "Default encoding:"
|
||
msgstr "Кодировка по умолчанию:"
|
||
|
||
#: tfrmoptionsmisc.lbltcconfig.caption
|
||
msgid "Configuration file:"
|
||
msgstr "Файл настроек:"
|
||
|
||
#: tfrmoptionsmisc.lbltcexecutable.caption
|
||
msgid "TC executable:"
|
||
msgstr "Исполняемый файл TC:"
|
||
|
||
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
||
msgid "Toolbar output path:"
|
||
msgstr "Каталог с панелями инструментов:"
|
||
|
||
#: tfrmoptionsmisc.lblthumbpixels.caption
|
||
msgid "pixels"
|
||
msgstr "пикселей"
|
||
|
||
#: tfrmoptionsmisc.lblthumbseparator.caption
|
||
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmoptionsmisc.lblthumbsize.caption
|
||
msgid "&Thumbnail size:"
|
||
msgstr "&Размер эскизов:"
|
||
|
||
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
||
msgid "&Selection by mouse"
|
||
msgstr "&Выбор с помощью мыши"
|
||
|
||
#: tfrmoptionsmouse.chkcursornofollow.caption
|
||
msgid "The text cursor no longer follows the mouse cursor"
|
||
msgstr "Текстовый курсор не следует за курсором мыши"
|
||
|
||
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
|
||
msgid "By clic&king on icon"
|
||
msgstr "Щелч&ком по значку"
|
||
|
||
#: tfrmoptionsmouse.gbopenwith.caption
|
||
msgctxt "tfrmoptionsmouse.gbopenwith.caption"
|
||
msgid "Open with"
|
||
msgstr "Открытие файлов и запуск программ"
|
||
|
||
#: tfrmoptionsmouse.gbscrolling.caption
|
||
msgid "Scrolling"
|
||
msgstr "Прокрутка"
|
||
|
||
#: tfrmoptionsmouse.gbselection.caption
|
||
msgid "Selection"
|
||
msgstr "Выбор"
|
||
|
||
#: tfrmoptionsmouse.lblmousemode.caption
|
||
msgid "&Mode:"
|
||
msgstr "Р&ежим"
|
||
|
||
#: tfrmoptionsmouse.rbdoubleclick.caption
|
||
msgid "Double click"
|
||
msgstr "Двойным щелчком"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
||
msgid "&Line by line"
|
||
msgstr "По&строчно"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
||
msgid "Line by line &with cursor movement"
|
||
msgstr "Построчно с &движением курсора"
|
||
|
||
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
||
msgid "&Page by page"
|
||
msgstr "Пост&ранично"
|
||
|
||
#: tfrmoptionsmouse.rbsingleclickboth.caption
|
||
msgid "Single click (opens files and folders)"
|
||
msgstr "Одним щелчком"
|
||
|
||
#: tfrmoptionsmouse.rbsingleclickfolders.caption
|
||
msgid "Single click (opens folders, double click for files)"
|
||
msgstr "Одним щелчком открывать папки и двойным файлы"
|
||
|
||
#: tfrmoptionspluginsbase.btnaddplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btnaddplugin.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmoptionspluginsbase.btnconfigplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btnconfigplugin.caption"
|
||
msgid "Con&figure"
|
||
msgstr "&Настроить"
|
||
|
||
#: tfrmoptionspluginsbase.btnenableplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btnenableplugin.caption"
|
||
msgid "E&nable"
|
||
msgstr "&Включить"
|
||
|
||
#: tfrmoptionspluginsbase.btnremoveplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btnremoveplugin.caption"
|
||
msgid "&Remove"
|
||
msgstr "Уда&лить"
|
||
|
||
#: tfrmoptionspluginsbase.btntweakplugin.caption
|
||
msgctxt "tfrmoptionspluginsbase.btntweakplugin.caption"
|
||
msgid "&Tweak"
|
||
msgstr "Параметр&ы"
|
||
|
||
#: tfrmoptionspluginsbase.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginsbase.lblplugindescription.caption"
|
||
msgid "Description"
|
||
msgstr "Описание"
|
||
|
||
#: tfrmoptionspluginsbase.stgplugins.columns[0].title.caption
|
||
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[0].title.caption"
|
||
msgid "Active"
|
||
msgstr "Состояние"
|
||
|
||
#: tfrmoptionspluginsbase.stgplugins.columns[1].title.caption
|
||
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[1].title.caption"
|
||
msgid "Plugin"
|
||
msgstr "Плагин"
|
||
|
||
#: tfrmoptionspluginsbase.stgplugins.columns[2].title.caption
|
||
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[2].title.caption"
|
||
msgid "Registered for"
|
||
msgstr "Ассоциация"
|
||
|
||
#: tfrmoptionspluginsbase.stgplugins.columns[3].title.caption
|
||
msgctxt "tfrmoptionspluginsbase.stgplugins.columns[3].title.caption"
|
||
msgid "File name"
|
||
msgstr "Имя файла"
|
||
|
||
#: tfrmoptionspluginsdsx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginsdsx.lblplugindescription.caption"
|
||
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
||
msgstr "Поз&воляют использовать в поиске альтернативные алгоритмы или внешние инструменты (например \"locate\", и т.п.)"
|
||
|
||
#: tfrmoptionspluginsgroup.btnpathtoberelativetoall.caption
|
||
msgid "Apply current settings to all current configured plugins"
|
||
msgstr "Применить настройки ко всем уже добавленным плагинам"
|
||
|
||
#: tfrmoptionspluginsgroup.ckbautotweak.caption
|
||
msgid "When adding a new plugin, automatically go in tweak window"
|
||
msgstr "При добавлении нового плагина автоматически открывать окно настроек"
|
||
|
||
#: tfrmoptionspluginsgroup.gbconfiguration.caption
|
||
msgid "Configuration:"
|
||
msgstr "Общие настройки:"
|
||
|
||
#: tfrmoptionspluginsgroup.lbpathtoberelativeto.caption
|
||
msgid "Path to be relative to:"
|
||
msgstr "Путь:"
|
||
|
||
#: tfrmoptionspluginsgroup.lbpluginfilenamestyle.caption
|
||
msgid "Plugin filename style when adding a new plugin:"
|
||
msgstr "Имя файла плагина при добавлении:"
|
||
|
||
#: tfrmoptionspluginswcx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginswcx.lblplugindescription.caption"
|
||
msgid "Pack&er plugins are used to work with archives"
|
||
msgstr "Позволяют р&аботать с архивами"
|
||
|
||
#: tfrmoptionspluginswcx.stgplugins.columns[0].title.caption
|
||
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[0].title.caption"
|
||
msgid "Active"
|
||
msgstr "Состояние"
|
||
|
||
#: tfrmoptionspluginswcx.stgplugins.columns[1].title.caption
|
||
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[1].title.caption"
|
||
msgid "Plugin"
|
||
msgstr "Плагин"
|
||
|
||
#: tfrmoptionspluginswcx.stgplugins.columns[2].title.caption
|
||
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[2].title.caption"
|
||
msgid "Registered for"
|
||
msgstr "Ассоциация"
|
||
|
||
#: tfrmoptionspluginswcx.stgplugins.columns[3].title.caption
|
||
msgctxt "tfrmoptionspluginswcx.stgplugins.columns[3].title.caption"
|
||
msgid "File name"
|
||
msgstr "Имя файла"
|
||
|
||
#: tfrmoptionspluginswdx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginswdx.lblplugindescription.caption"
|
||
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
||
msgstr "Позвол&яют использовать расширенные сведения о файлах (теги mp3, атрибуты изображений и т.д.) в панелях или при поиске/переименовании"
|
||
|
||
#: tfrmoptionspluginswfx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginswfx.lblplugindescription.caption"
|
||
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
||
msgstr "Позволя&ют обращаться к дискам, недоступным из ОС или к внешним устройствам, типа Palm/PocketPC, и т.д."
|
||
|
||
#: tfrmoptionspluginswlx.lblplugindescription.caption
|
||
msgctxt "tfrmoptionspluginswlx.lblplugindescription.caption"
|
||
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
||
msgstr "Позволяют ото&бражать во внутреннем просмотрщике (F3, Ctrl+Q) файлы различных форматов, таких как рисунки, таблицы, базы данных и т.д."
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
|
||
msgid "&Beginning (name must start with first typed character)"
|
||
msgstr "&Начало (имя должно начинаться с набранных символов)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
|
||
msgid "En&ding (last character before a typed dot . must match)"
|
||
msgstr "&Конец (последние символы до набранной точки \".\" должны совпадать)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Настройка"
|
||
|
||
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.GBEXACTNAMEMATCH.CAPTION"
|
||
msgid "Exact name match"
|
||
msgstr "Точное соответствие имени"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
||
msgid "Search case"
|
||
msgstr "Регистр поиска"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
||
msgid "Search for these items"
|
||
msgstr "Искать"
|
||
|
||
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
||
msgid "Keep renamed name when unlocking a tab"
|
||
msgstr "Сохранять изменённое имя при разблокировании вкладки"
|
||
|
||
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
|
||
msgid "Activate target &panel when clicking on one of its Tabs"
|
||
msgstr "Делат&ь панель активной при щелчке по одной из её вкладок"
|
||
|
||
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
|
||
msgid "&Show tab header also when there is only one tab"
|
||
msgstr "Показ&ывать заголовок вкладки, даже если она одна"
|
||
|
||
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
||
msgid "Close duplicate tabs when closing application"
|
||
msgstr "Закрыть дубликаты вкладок при закрытии приложения"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
|
||
msgid "Con&firm close all tabs"
|
||
msgstr "По&дтверждать закрытие всех вкладок"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
||
msgid "Confirm close locked tabs"
|
||
msgstr "Подтверждать закрытие заблокированных вкладок"
|
||
|
||
#: tfrmoptionstabs.cbtabslimitoption.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
|
||
msgid "&Limit tab title length to"
|
||
msgstr "Ог&раничить размер заголовка до"
|
||
|
||
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
|
||
msgid "Show locked tabs &with an asterisk *"
|
||
msgstr "Отмечать за&блокированные вкладки звёздочкой *"
|
||
|
||
#: tfrmoptionstabs.cbtabsmultilines.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
|
||
msgid "&Tabs on multiple lines"
|
||
msgstr "Размещать вкладки в несколько рядов"
|
||
|
||
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
|
||
msgid "Ctrl+&Up opens new tab in foreground"
|
||
msgstr "Ctrl+вверх делает &новую вкладку активной"
|
||
|
||
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
|
||
msgid "Open &new tabs near current tab"
|
||
msgstr "От&крывать новую вкладку рядом с текущей"
|
||
|
||
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
||
msgid "Reuse existing tab when possible"
|
||
msgstr "По возможности использовать существующие вкладки"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
|
||
msgid "Show ta&b close button"
|
||
msgstr "Кнопка &закрытия вкладки"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
||
msgid "Always show drive letter in tab title"
|
||
msgstr "Всегда показывать букву диска в заголовке вкладки"
|
||
|
||
#: tfrmoptionstabs.gbtabs.caption
|
||
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
|
||
msgid "Folder tabs headers"
|
||
msgstr "За&головки вкладок"
|
||
|
||
#: tfrmoptionstabs.lblchar.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
|
||
msgid "characters"
|
||
msgstr "символов"
|
||
|
||
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
||
msgid "Action to do when double click on a tab:"
|
||
msgstr "Действие двойного щелчка по вкладке:"
|
||
|
||
#: tfrmoptionstabs.lbltabsposition.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
|
||
msgid "Ta&bs position"
|
||
msgstr "Положение &вкладок:"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "Нет"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Нет"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
||
msgid "Right"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after resaving"
|
||
msgstr "Перейти к настройкам избранных вкладок после пересохранения"
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
||
msgstr "Перейти к настройкам избранных вкладок после сохранения новых"
|
||
|
||
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
||
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
||
msgstr "Включить дополнительные параметры избранных вкладок (выбор панели при восстановлении и т.д.)"
|
||
|
||
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
||
msgid "Default extra settings when saving new Favorite Tabs:"
|
||
msgstr "Дополнительные настройки по умолчанию для новых избранных вкладок:"
|
||
|
||
#: tfrmoptionstabsextra.gbtabs.caption
|
||
msgid "Folder tabs headers extra"
|
||
msgstr "Дополнительные параметры избранных вкладок"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
||
msgid "When restoring tab, existing tabs to keep:"
|
||
msgstr "Сохранить существующие вкладки при восстановлении:"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
||
msgid "Tabs saved on left will be restored to:"
|
||
msgstr "Сохранённые слева вкладки будут восстановлены:"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
||
msgid "Tabs saved on right will be restored to:"
|
||
msgstr "Сохранённые справа вкладки будут восстановлены:"
|
||
|
||
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
||
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "Сохранять историю каталогов для избранных вкладок:"
|
||
|
||
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
||
msgid "Default position in menu when saving a new Favorite Tabs:"
|
||
msgstr "Позиция в меню по умолчанию при сохранении новых избранных вкладок:"
|
||
|
||
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "Шаблон {command} обозначает команду, запуск которой будет произведён в терминале"
|
||
|
||
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "Шаблон {command} обозначает команду, запуск которой будет произведён в терминале"
|
||
|
||
#: tfrmoptionsterminal.edruntermparams.hint
|
||
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "Шаблон {command} обозначает команду, запуск которой будет произведён в терминале"
|
||
|
||
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
||
msgid "Command for just running terminal:"
|
||
msgstr "Команда запуска терминала:"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
||
msgid "Command for running a command in terminal and close after:"
|
||
msgstr "Команда для запуска команд в терминале (окно будет закрыто):"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
||
msgid "Command for running a command in terminal and stay open:"
|
||
msgstr "Команда для запуска команд в терминале (окно останется открытым):"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Параметры:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Параметры:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermcmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Параметры:"
|
||
|
||
#: tfrmoptionstoolbar.btnclonebutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btnclonebutton.caption"
|
||
msgid "C&lone button"
|
||
msgstr "&Дублировать"
|
||
|
||
#: tfrmoptionstoolbar.btndeletebutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
|
||
msgid "&Delete"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmoptionstoolbar.btnedithotkey.caption
|
||
msgctxt "tfrmoptionstoolbar.btnedithotkey.caption"
|
||
msgid "Edit hot&key"
|
||
msgstr "&Редактировать"
|
||
|
||
#: tfrmoptionstoolbar.btninsertbutton.caption
|
||
msgctxt "tfrmoptionstoolbar.btninsertbutton.caption"
|
||
msgid "&Insert new button"
|
||
msgstr "Доба&вить"
|
||
|
||
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
||
msgid "Select"
|
||
msgstr "Выбрать"
|
||
|
||
#: tfrmoptionstoolbar.btnopenfile.caption
|
||
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnother.caption
|
||
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
||
msgid "Other..."
|
||
msgstr "Другое..."
|
||
|
||
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
||
msgctxt "tfrmoptionstoolbar.btnremovehotkey.caption"
|
||
msgid "Remove hotke&y"
|
||
msgstr "У&далить"
|
||
|
||
#: tfrmoptionstoolbar.btnstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
||
msgid "Suggest"
|
||
msgstr "Подсказка"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
||
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
||
msgstr "Всплывающая подсказка на основе типа, команды и параметров кнопки"
|
||
|
||
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
||
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
||
msgid "&Flat buttons"
|
||
msgstr "&Плоские кнопки"
|
||
|
||
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
||
msgid "Report errors with commands"
|
||
msgstr "Сообщить об ошибках с командами"
|
||
|
||
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
||
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
||
msgstr "Параметры команды, каждый на отдельной строке. F1 - помощь"
|
||
|
||
#: tfrmoptionstoolbar.gbgroupbox.caption
|
||
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
|
||
msgid "Appearance"
|
||
msgstr "Вид кнопок"
|
||
|
||
#: tfrmoptionstoolbar.lblbarsize.caption
|
||
msgctxt "tfrmoptionstoolbar.lblbarsize.caption"
|
||
msgid "&Bar size:"
|
||
msgstr "Р&азмер панели:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblexternalcommand.caption"
|
||
msgid "Comman&d:"
|
||
msgstr "Команда:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Параметры:"
|
||
|
||
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
|
||
msgid "Help"
|
||
msgstr "Помощь"
|
||
|
||
#: tfrmoptionstoolbar.lblhotkey.caption
|
||
msgid "Hot key:"
|
||
msgstr "Горячая клавиша:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconfile.caption
|
||
msgctxt "tfrmoptionstoolbar.lbliconfile.caption"
|
||
msgid "Ico&n:"
|
||
msgstr "&Файл значка:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconsize.caption
|
||
msgctxt "tfrmoptionstoolbar.lbliconsize.caption"
|
||
msgid "Icon si&ze:"
|
||
msgstr "Ра&змер значков:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
|
||
msgid "Co&mmand:"
|
||
msgstr "Кома&нда:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
|
||
msgid "&Parameters:"
|
||
msgstr "Пара&метры:"
|
||
|
||
#: tfrmoptionstoolbar.lblstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "П&уть запуска:"
|
||
|
||
#: tfrmoptionstoolbar.lbltooltip.caption
|
||
msgctxt "tfrmoptionstoolbar.lbltooltip.caption"
|
||
msgid "&Tooltip:"
|
||
msgstr "Подс&казка:"
|
||
|
||
#: tfrmoptionstoolbar.miaddallcmds.caption
|
||
msgid "Add toolbar with ALL DC commands"
|
||
msgstr "Добавить панель со ВСЕМИ командами DC"
|
||
|
||
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
||
msgid "for an external command"
|
||
msgstr "внешнюю команду"
|
||
|
||
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
||
msgid "for an internal command"
|
||
msgstr "внутреннюю команду"
|
||
|
||
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
||
msgid "for a separator"
|
||
msgstr "разделитель"
|
||
|
||
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
||
msgid "for a sub-tool bar"
|
||
msgstr "меню"
|
||
|
||
#: tfrmoptionstoolbar.mibackup.caption
|
||
msgctxt "tfrmoptionstoolbar.mibackup.caption"
|
||
msgid "Backup..."
|
||
msgstr "Резервирование..."
|
||
|
||
#: tfrmoptionstoolbar.miexport.caption
|
||
msgctxt "tfrmoptionstoolbar.miexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Экспорт..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrent.caption
|
||
msgid "Current toolbar..."
|
||
msgstr "Текущая панель инструментов..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "в файл панели инструментов (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "в файл TC .BAR (оставить существующий)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "в файл TC .BAR (удалить существующий)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "в файл \"wincmd.ini\" TC (оставить существующий)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "в файл \"wincmd.ini\" TC (удалить существующий)"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator3.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator4.caption
|
||
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexporttop.caption
|
||
msgid "Top toolbar..."
|
||
msgstr "Наивысшая панель инструментов..."
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
||
msgid "Save a backup of Toolbar"
|
||
msgstr "Сохранить резервную копию панели инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "в файл панели инструментов (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "в файл TC .BAR (оставить существующий)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "в файл TC .BAR (удалить существующий)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "в файл \"wincmd.ini\" TC (оставить существующий)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "в файл \"wincmd.ini\" TC (удалить существующий)"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "сразу после выбранного"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "как первый элемент"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "как последний элемент"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "сразу перед выбранным"
|
||
|
||
#: tfrmoptionstoolbar.miimport.caption
|
||
msgctxt "tfrmoptionstoolbar.miimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Импорт..."
|
||
|
||
#: tfrmoptionstoolbar.miimportbackup.caption
|
||
msgid "Restore a backup of Toolbar"
|
||
msgstr "Восстановить панель инструментов из резервной копии"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "добавить в текущую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "добавить в новую панель в текущей панели инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "добавить в новую панель в наивысшей панели инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "добавить в наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "заменить наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbar.caption
|
||
msgid "from a Toolbar File (.toolbar)"
|
||
msgstr "из файла панели инструментов (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "добавить в текущую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "добавить в новую панель в текущей панели инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "добавить в новую панель в наивысшей панели инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "добавить в наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "заменить наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimportseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbar.caption
|
||
msgid "from a single TC .BAR file"
|
||
msgstr "из одного файла TC .BAR"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "добавить в текущую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "добавить в новую панель в текущую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "добавить в новую панель в наивысшей панели инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "добавить в наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "заменить наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcini.caption
|
||
msgid "from \"wincmd.ini\" of TC..."
|
||
msgstr "из файла \"wincmd.ini\" TC..."
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "добавить в текущую панель"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "добавить в новую панель в текущую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "добавить в новую панель в наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "добавить в наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "заменить наивысшую панель инструментов"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "сразу после выбранного"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "как первый элемент"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "как последний элемент"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "сразу перед выбранным"
|
||
|
||
#: tfrmoptionstoolbar.misearchandreplace.caption
|
||
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
|
||
msgid "Search and replace..."
|
||
msgstr "Найти и заменить..."
|
||
|
||
#: tfrmoptionstoolbar.miseparator1.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator10.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator11.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator13.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator14.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator2.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator6.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator7.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator8.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator9.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "сразу после выбранного"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
||
msgid "as first element"
|
||
msgstr "как первый элемент"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "как последний элемент"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "сразу перед выбранным"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
||
msgid "in all of all the above..."
|
||
msgstr "во всём вышеперечисленном..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
||
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
||
msgid "in all commands..."
|
||
msgstr "во всех командах..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
||
msgid "in all icon names..."
|
||
msgstr "во всех файлах значка..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
||
msgid "in all parameters..."
|
||
msgstr "во всех параметрах..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
||
msgid "in all start path..."
|
||
msgstr "во всех путях запуска..."
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "сразу после выбранного"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
|
||
msgid "as first element"
|
||
msgstr "как первый элемент"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "как последний элемент"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "сразу перед выбранным"
|
||
|
||
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
||
msgid "Button type"
|
||
msgstr "Тип кнопки"
|
||
|
||
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
||
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSKEEPTERMINALOPEN.CAPTION"
|
||
msgid "&Keep terminal window open after executing program"
|
||
msgstr "&Не закрывать окно терминала после запуска программы"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSRUNINTERMINAL.CAPTION"
|
||
msgid "&Execute in terminal"
|
||
msgstr "&Запускать в терминале"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSUSEEXTERNALPROGRAM.CAPTION"
|
||
msgid "&Use external program"
|
||
msgstr "&Использовать внешнюю программу"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPARAMETERS.CAPTION"
|
||
msgid "A&dditional parameters"
|
||
msgstr "&Дополнительные параметры"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolspath.caption
|
||
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPATH.CAPTION"
|
||
msgid "&Path to program to execute"
|
||
msgstr "П&уть к программе"
|
||
|
||
#: tfrmoptionstooltips.btnaddtooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btnaddtooltipsfiletype.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmoptionstooltips.btnapplytooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btnapplytooltipsfiletype.caption"
|
||
msgid "A&pply"
|
||
msgstr "П&рименить"
|
||
|
||
#: tfrmoptionstooltips.btncopytooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btncopytooltipsfiletype.caption"
|
||
msgid "Cop&y"
|
||
msgstr "&Копировать"
|
||
|
||
#: tfrmoptionstooltips.btndeletetooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btndeletetooltipsfiletype.caption"
|
||
msgid "Delete"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmoptionstooltips.btnfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Шаблон..."
|
||
|
||
#: tfrmoptionstooltips.btnrenametooltipsfiletype.caption
|
||
msgctxt "tfrmoptionstooltips.btnrenametooltipsfiletype.caption"
|
||
msgid "&Rename"
|
||
msgstr "П&ереименовать"
|
||
|
||
#: tfrmoptionstooltips.btntooltipother.caption
|
||
msgctxt "tfrmoptionstooltips.btntooltipother.caption"
|
||
msgid "Oth&er..."
|
||
msgstr "Дру&гое..."
|
||
|
||
#: tfrmoptionstooltips.bvltooltips1.caption
|
||
msgid "Tooltip configuration for selected file type:"
|
||
msgstr "Параметры подсказки для выбранного типа файлов:"
|
||
|
||
#: tfrmoptionstooltips.bvltooltips2.caption
|
||
msgid "General options about tooltips:"
|
||
msgstr "Общие параметры подсказок:"
|
||
|
||
#: tfrmoptionstooltips.chkshowtooltip.caption
|
||
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
|
||
msgid "&Show tooltip for files in the file panel"
|
||
msgstr "Показывать всплывающие подсказки в файловой панели"
|
||
|
||
#: tfrmoptionstooltips.lblfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
|
||
msgid "Category &hint:"
|
||
msgstr "Под&сказка:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsmask.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "&Маска:"
|
||
|
||
#: tfrmoptionstooltips.lbltooltiphidingdelay.caption
|
||
msgid "Tooltip hiding delay:"
|
||
msgstr "Скрыть подсказку через:"
|
||
|
||
#: tfrmoptionstooltips.lbltooltipshowingmode.caption
|
||
msgid "Tooltip showing mode:"
|
||
msgstr "Режим использования:"
|
||
|
||
#: tfrmoptionstooltips.lbltooltipslistbox.caption
|
||
msgid "&File types:"
|
||
msgstr "Типы &файлов:"
|
||
|
||
#: tfrmoptionstooltips.mitooltipsfiletypediscardmodification.caption
|
||
msgid "Discard Modifications"
|
||
msgstr "Отменить изменения"
|
||
|
||
#: tfrmoptionstooltips.mitooltipsfiletypeexport.caption
|
||
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeexport.caption"
|
||
msgid "Export..."
|
||
msgstr "Экспорт..."
|
||
|
||
#: tfrmoptionstooltips.mitooltipsfiletypeimport.caption
|
||
msgctxt "tfrmoptionstooltips.mitooltipsfiletypeimport.caption"
|
||
msgid "Import..."
|
||
msgstr "Импорт..."
|
||
|
||
#: tfrmoptionstooltips.mitooltipsfiletypesortfiletype.caption
|
||
msgid "Sort Tooltip File Types"
|
||
msgstr "Сортировать типы файлов"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
||
msgid "With double-click on the bar on top of a file panel"
|
||
msgstr "Двойной щелчок по верхней полосе файловой панели"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr "С помощью меню и внутренней команды"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
||
msgid "Double click in tree select and exit"
|
||
msgstr "Двойной щелчок по выбранному в дереве и выход"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr "С помощью меню и внутренней команды"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
||
msgid "With double-click on a tab (if configured for it)"
|
||
msgstr "Двойной щелчок по вкладке"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
||
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
||
msgstr "Если используется комбинация клавиш - выбор и закрытие окна"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
||
msgid "Single mouse click in tree select and exit"
|
||
msgstr "Щелчок мыши по выбранному в дереве и выход"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
||
msgid "Use it for Command Line History"
|
||
msgstr "Использовать историю командной строки"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
||
msgid "Use it for the Dir History"
|
||
msgstr "Использовать историю каталогов"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
||
msgid "Use it for the View History (Visited paths for active view)"
|
||
msgstr "Использовать историю просмотра (посещённые каталоги)"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
||
msgid "Behavior regarding selection:"
|
||
msgstr "Поведение при выборе:"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
||
msgid "Tree View Menus related options:"
|
||
msgstr "Настройки древовидного меню:"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
||
msgid "Where to use Tree View Menus:"
|
||
msgstr "Где использовать древовидное меню:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblnote.caption
|
||
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
||
msgstr "*ПРИМЕЧАНИЕ: Состояние таких опций, как чувствительность к регистру и игнорирование акцентов, сохраняется для последующих вызовов меню."
|
||
|
||
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
||
msgid "With Directory Hotlist:"
|
||
msgstr "С избранными каталогами:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
||
msgid "With Favorite Tabs:"
|
||
msgstr "С избранными вкладками:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
||
msgid "With History:"
|
||
msgstr "С историей:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
||
msgid "Use and display keyboard shortcut for choosing items"
|
||
msgstr "Использовать и показывать сочетания клавиш для выбора пунктов"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
||
msgid "Layout and colors options:"
|
||
msgstr "Настройки цвета и макет:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
||
msgid "Background color:"
|
||
msgstr "Фон:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
||
msgid "Cursor color:"
|
||
msgstr "Курсор:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
||
msgid "Found text color:"
|
||
msgstr "Найденный текст:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
||
msgid "Found text under cursor:"
|
||
msgstr "Найденный текст под курсором:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
||
msgid "Normal text color:"
|
||
msgstr "Нормальный текст:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
||
msgid "Normal text under cursor:"
|
||
msgstr "Нормальный текст под курсором:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
||
msgid "Tree View Menu Preview:"
|
||
msgstr "Предварительный просмотр:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
||
msgid "Secondary text color:"
|
||
msgstr "Дополнительный текст:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
||
msgid "Secondary text under cursor:"
|
||
msgstr "Дополнительный текст под курсором:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
||
msgid "Shortcut color:"
|
||
msgstr "Горячая клавиша:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
||
msgid "Shortcut under cursor:"
|
||
msgstr "Горячая клавиша под курсором:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
||
msgid "Unselectable text color:"
|
||
msgstr "Невыделяемый текст:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
||
msgid "Unselectable under cursor:"
|
||
msgstr "Невыделяемый текст под курсором:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
||
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
||
msgstr "Измените цвета слева, и вы увидите, как будет выглядеть ваше древовидное меню."
|
||
|
||
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWERBOOKMODE.CAPTION"
|
||
msgid "Viewer Book Mode"
|
||
msgstr "Режим просмотра \"Книга\""
|
||
|
||
#: tfrmoptionsviewer.gbviewerexample.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
|
||
msgid "Example"
|
||
msgstr "Пример"
|
||
|
||
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLBACKGROUNDCOLORVIEWERBOOK.CAPTION"
|
||
msgid "&Background color in book viewer"
|
||
msgstr "&Цвет фона "
|
||
|
||
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLFONTCOLORVIEWERBOOK.CAPTION"
|
||
msgid "&Font color in book viewer"
|
||
msgstr "Цвет &текста"
|
||
|
||
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.LBLNUMBERCOLUMNSVIEWER.CAPTION"
|
||
msgid "&Number of columns in book viewer"
|
||
msgstr "&Кол-во колонок"
|
||
|
||
#: tfrmpackdlg.btnconfig.caption
|
||
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "&Настроить"
|
||
|
||
#: tfrmpackdlg.caption
|
||
msgctxt "TFRMPACKDLG.CAPTION"
|
||
msgid "Pack files"
|
||
msgstr "Упаковка файлов"
|
||
|
||
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
||
msgid "C&reate separate archives, one per selected file/dir"
|
||
msgstr "Отде&льные архивы для кажд&ого выбранного файла/каталога"
|
||
|
||
#: tfrmpackdlg.cbcreatesfx.caption
|
||
msgid "Create self e&xtracting archive"
|
||
msgstr "Само&распаковывающийся архив"
|
||
|
||
#: tfrmpackdlg.cbencrypt.caption
|
||
msgid "Encr&ypt"
|
||
msgstr "&Шифровать"
|
||
|
||
#: tfrmpackdlg.cbmovetoarchive.caption
|
||
msgid "Mo&ve to archive"
|
||
msgstr "У&далить исходные файлы после упаковки"
|
||
|
||
#: tfrmpackdlg.cbmultivolume.caption
|
||
msgid "&Multiple disk archive"
|
||
msgstr "&Многотомный архив"
|
||
|
||
#: tfrmpackdlg.cbotherplugins.caption
|
||
msgid "=>"
|
||
msgstr "=>"
|
||
|
||
#: tfrmpackdlg.cbputintarfirst.caption
|
||
msgid "P&ut in the TAR archive first"
|
||
msgstr "Пр&едварительно упаковать в TAR архив"
|
||
|
||
#: tfrmpackdlg.cbstoredir.caption
|
||
msgid "Also &pack path names (only recursed)"
|
||
msgstr "&Сохранять пути"
|
||
|
||
#: tfrmpackdlg.lblprompt.caption
|
||
msgid "Pack file(s) to the file:"
|
||
msgstr "Имя архива:"
|
||
|
||
#: tfrmpackdlg.rgpacker.caption
|
||
msgid "Packer"
|
||
msgstr "Архиватор"
|
||
|
||
#: tfrmpackinfodlg.btnclose.caption
|
||
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
||
msgid "Unpack &all and execute"
|
||
msgstr "&Выполнить, распаковав все"
|
||
|
||
#: tfrmpackinfodlg.btnunpackandexec.caption
|
||
msgid "&Unpack and execute"
|
||
msgstr "Р&аспаковать и выполнить"
|
||
|
||
#: tfrmpackinfodlg.caption
|
||
msgctxt "TFRMPACKINFODLG.CAPTION"
|
||
msgid "Properties of packed file"
|
||
msgstr "Свойства упакованного файла"
|
||
|
||
#: tfrmpackinfodlg.lblattributes.caption
|
||
msgid "Attributes:"
|
||
msgstr "Атрибуты:"
|
||
|
||
#: tfrmpackinfodlg.lblcompressionratio.caption
|
||
msgid "Compression ratio:"
|
||
msgstr "Коэффициент сжатия:"
|
||
|
||
#: tfrmpackinfodlg.lbldate.caption
|
||
msgid "Date:"
|
||
msgstr "Дата:"
|
||
|
||
#: tfrmpackinfodlg.lblmethod.caption
|
||
msgid "Method:"
|
||
msgstr "Метод:"
|
||
|
||
#: tfrmpackinfodlg.lbloriginalsize.caption
|
||
msgid "Original size:"
|
||
msgstr "Исходный размер:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedfile.caption
|
||
msgid "File:"
|
||
msgstr "Файл:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedsize.caption
|
||
msgid "Packed size:"
|
||
msgstr "Размер после сжатия:"
|
||
|
||
#: tfrmpackinfodlg.lblpacker.caption
|
||
msgid "Packer:"
|
||
msgstr "Архиватор:"
|
||
|
||
#: tfrmpackinfodlg.lbltime.caption
|
||
msgid "Time:"
|
||
msgstr "Время:"
|
||
|
||
#: tfrmquicksearch.btncancel.caption
|
||
msgctxt "tfrmquicksearch.btncancel.caption"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmquicksearch.btncancel.hint
|
||
msgid "Close filter panel"
|
||
msgstr "Закрыть панель фильтра"
|
||
|
||
#: tfrmquicksearch.edtsearch.hint
|
||
msgid "Enter text to search for or filter by"
|
||
msgstr "Текст для поиска или для фильтрации"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.caption
|
||
msgid "Aa"
|
||
msgstr "Аа"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.hint
|
||
msgid "Case Sensitive"
|
||
msgstr "Учитывать регистр"
|
||
|
||
#: tfrmquicksearch.sbdirectories.caption
|
||
msgid "D"
|
||
msgstr "К"
|
||
|
||
#: tfrmquicksearch.sbdirectories.hint
|
||
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
||
msgid "Directories"
|
||
msgstr "Каталоги"
|
||
|
||
#: tfrmquicksearch.sbfiles.caption
|
||
msgid "F"
|
||
msgstr "Ф"
|
||
|
||
#: tfrmquicksearch.sbfiles.hint
|
||
msgctxt "tfrmquicksearch.sbfiles.hint"
|
||
msgid "Files"
|
||
msgstr "Файлы"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.caption
|
||
msgid "{"
|
||
msgstr "{"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.hint
|
||
msgid "Match Beginning"
|
||
msgstr "Совпадает с началом"
|
||
|
||
#: tfrmquicksearch.sbmatchending.caption
|
||
msgid "}"
|
||
msgstr "}"
|
||
|
||
#: tfrmquicksearch.sbmatchending.hint
|
||
msgid "Match Ending"
|
||
msgstr "Совпадает с концом"
|
||
|
||
#: tfrmquicksearch.tglfilter.caption
|
||
msgctxt "tfrmquicksearch.tglfilter.caption"
|
||
msgid "Filter"
|
||
msgstr "Фильтр"
|
||
|
||
#: tfrmquicksearch.tglfilter.hint
|
||
msgid "Toggle between search or filter"
|
||
msgstr "Поиск или фильтр"
|
||
|
||
#: tfrmsearchplugin.btnadd.caption
|
||
msgid "&More rules"
|
||
msgstr "Добавить правило"
|
||
|
||
#: tfrmsearchplugin.btndelete.caption
|
||
msgid "L&ess rules"
|
||
msgstr "Удалить правило"
|
||
|
||
#: tfrmsearchplugin.chkuseplugins.caption
|
||
msgid "Use &content plugins, combine with:"
|
||
msgstr "Использовать контентные плагины, объединять с:"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[0].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
|
||
msgid "Plugin"
|
||
msgstr "Плагин"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[1].text
|
||
msgid "Field"
|
||
msgstr "Поле"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[2].text
|
||
msgid "Operator"
|
||
msgstr "Оператор"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[3].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
||
msgid "Value"
|
||
msgstr "Значение"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[4].text
|
||
msgid "Unit"
|
||
msgstr ""
|
||
|
||
#: tfrmsearchplugin.rband.caption
|
||
msgid "&AND (all match)"
|
||
msgstr "И (все правила)"
|
||
|
||
#: tfrmsearchplugin.rbor.caption
|
||
msgid "&OR (any match)"
|
||
msgstr "ИЛИ (любое правило)"
|
||
|
||
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Отмена"
|
||
|
||
#: tfrmselecttextrange.btppanel.closebutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Закрыть"
|
||
|
||
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Помощ&ь"
|
||
|
||
#: tfrmselecttextrange.btppanel.okbutton.caption
|
||
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmselecttextrange.lblselecttext.caption
|
||
msgid "&Select the characters to insert:"
|
||
msgstr "Си&мволы для вставки"
|
||
|
||
#: tfrmsetfileproperties.btncancel.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmsetfileproperties.btnok.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmsetfileproperties.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change attributes"
|
||
msgstr "Изменить атрибуты"
|
||
|
||
#: tfrmsetfileproperties.cbsgid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmsetfileproperties.cbsticky.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Закрепляющий бит"
|
||
|
||
#: tfrmsetfileproperties.cbsuid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmsetfileproperties.chkarchive.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
|
||
msgid "Archive"
|
||
msgstr "Архивный"
|
||
|
||
#: tfrmsetfileproperties.chkcreationtime.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
|
||
msgid "Created:"
|
||
msgstr "Создан:"
|
||
|
||
#: tfrmsetfileproperties.chkhidden.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
|
||
msgid "Hidden"
|
||
msgstr "Скрытый"
|
||
|
||
#: tfrmsetfileproperties.chklastaccesstime.caption
|
||
msgid "Accessed:"
|
||
msgstr "Открыт:"
|
||
|
||
#: tfrmsetfileproperties.chklastwritetime.caption
|
||
msgid "Modified:"
|
||
msgstr "Изменён:"
|
||
|
||
#: tfrmsetfileproperties.chkreadonly.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
|
||
msgid "Read only"
|
||
msgstr "Только для чтения"
|
||
|
||
#: tfrmsetfileproperties.chkrecursive.caption
|
||
msgid "Including subfolders"
|
||
msgstr "Рекурсивно"
|
||
|
||
#: tfrmsetfileproperties.chksystem.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
|
||
msgid "System"
|
||
msgstr "Системный"
|
||
|
||
#: tfrmsetfileproperties.gbtimesamp.caption
|
||
msgid "Timestamp properties"
|
||
msgstr "Дата и время"
|
||
|
||
#: tfrmsetfileproperties.gbunixattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Атрибуты"
|
||
|
||
#: tfrmsetfileproperties.gbwinattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Атрибуты"
|
||
|
||
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Биты:"
|
||
|
||
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Группа"
|
||
|
||
#: tfrmsetfileproperties.lblattrinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(серое поле означает неизменяемое значение)"
|
||
|
||
#: tfrmsetfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Другие"
|
||
|
||
#: tfrmsetfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Владелец"
|
||
|
||
#: tfrmsetfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmsetfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Текст:"
|
||
|
||
#: tfrmsetfileproperties.lblexec.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Выполнение"
|
||
|
||
#: tfrmsetfileproperties.lblmodeinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(серое поле означает неизменяемое значение)"
|
||
|
||
#: tfrmsetfileproperties.lbloctal.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Восьмеричный:"
|
||
|
||
#: tfrmsetfileproperties.lblread.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Чтение"
|
||
|
||
#: tfrmsetfileproperties.lblwrite.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Запись"
|
||
|
||
#: tfrmsplitter.btncancel.caption
|
||
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmsplitter.btnftchoice.caption
|
||
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmsplitter.btnok.caption
|
||
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmsplitter.btnrelativeftchoice.hint
|
||
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmsplitter.caption
|
||
msgctxt "TFRMSPLITTER.CAPTION"
|
||
msgid "Splitter"
|
||
msgstr "Разбиение"
|
||
|
||
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
||
msgid "Require a CRC32 verification file"
|
||
msgstr "Создать файл контрольной суммы"
|
||
|
||
#: tfrmsplitter.cmbxsize.text
|
||
msgid "1457664B - 3.5\""
|
||
msgstr "1457664B - 3.5\""
|
||
|
||
#: tfrmsplitter.grbxfile.caption
|
||
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Имя файла"
|
||
|
||
#: tfrmsplitter.grbxsize.caption
|
||
msgid "Size and number of parts"
|
||
msgstr "Размер и количество частей"
|
||
|
||
#: tfrmsplitter.lbdirtarget.caption
|
||
msgid "Directory &target"
|
||
msgstr "&Каталог назначения"
|
||
|
||
#: tfrmsplitter.lbfilesource.caption
|
||
msgid "File &source"
|
||
msgstr "&Исходный файл"
|
||
|
||
#: tfrmsplitter.lblnumberparts.caption
|
||
msgid "&Number of parts"
|
||
msgstr "Ко&личество частей"
|
||
|
||
#: tfrmsplitter.rbtnbyte.caption
|
||
msgid "&Bytes"
|
||
msgstr "Байт"
|
||
|
||
#: tfrmsplitter.rbtngigab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
|
||
msgid "&Gigabytes"
|
||
msgstr "&Гигабайт"
|
||
|
||
#: tfrmsplitter.rbtnkilob.caption
|
||
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
|
||
msgid "&Kilobytes"
|
||
msgstr "К&илобайт"
|
||
|
||
#: tfrmsplitter.rbtnmegab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
|
||
msgid "&Megabytes"
|
||
msgstr "&Мегабайт"
|
||
|
||
#: tfrmstartingsplash.caption
|
||
msgctxt "tfrmstartingsplash.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblbuild.caption
|
||
msgctxt "tfrmstartingsplash.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Сборка"
|
||
|
||
#: tfrmstartingsplash.lblfreepascalver.caption
|
||
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmstartingsplash.lbllazarusver.caption
|
||
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmstartingsplash.lbloperatingsystem.caption
|
||
msgid "Operating System"
|
||
msgstr "Операционная система"
|
||
|
||
#: tfrmstartingsplash.lblplatform.caption
|
||
msgid "Platform"
|
||
msgstr "Платформа"
|
||
|
||
#: tfrmstartingsplash.lblrevision.caption
|
||
msgctxt "tfrmstartingsplash.lblrevision.caption"
|
||
msgid "Revision"
|
||
msgstr "Ревизия"
|
||
|
||
#: tfrmstartingsplash.lbltitle.caption
|
||
msgctxt "tfrmstartingsplash.lbltitle.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblversion.caption
|
||
msgctxt "tfrmstartingsplash.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Версия"
|
||
|
||
#: tfrmstartingsplash.lblwidgetsetver.caption
|
||
msgid "WidgetsetVer"
|
||
msgstr ""
|
||
|
||
#: tfrmsymlink.btncancel.caption
|
||
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmsymlink.btnok.caption
|
||
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmsymlink.caption
|
||
msgid "Create symbolic link"
|
||
msgstr "Создать символьную ссылку"
|
||
|
||
#: tfrmsymlink.chkuserelativepath.caption
|
||
msgid "Use &relative path when possible"
|
||
msgstr "&Относительный путь если возможно"
|
||
|
||
#: tfrmsymlink.lblexistingfile.caption
|
||
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "&На что указывает"
|
||
|
||
#: tfrmsymlink.lbllinktocreate.caption
|
||
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "&Имя ссылки"
|
||
|
||
#: tfrmsyncdirsdlg.actselectclear.caption
|
||
msgid "Remove selection"
|
||
msgstr "Снять метку копирования/удаления"
|
||
|
||
#: tfrmsyncdirsdlg.actselectcopydefault.caption
|
||
msgid "Select for copying (default direction)"
|
||
msgstr "Отметить для копирования (направление по умолчанию)"
|
||
|
||
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
|
||
msgid "Select for copying -> (left to right)"
|
||
msgstr "Отметить для копирования -> (слева направо)"
|
||
|
||
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
|
||
msgid "Reverse copy direction"
|
||
msgstr "Поменять направление копирования"
|
||
|
||
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
|
||
msgid "Select for copying <- (right to left)"
|
||
msgstr "Отметить для копирования <- (справа налево)"
|
||
|
||
#: tfrmsyncdirsdlg.actselectdeleteright.caption
|
||
msgid "Select for deleting -> (right)"
|
||
msgstr "Отметить для удаления -> (справа)"
|
||
|
||
#: tfrmsyncdirsdlg.btnclose.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
|
||
msgid "Close"
|
||
msgstr "Закрыть"
|
||
|
||
#: tfrmsyncdirsdlg.btncompare.caption
|
||
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Сравнить"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir1.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir2.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Синхронизировать"
|
||
|
||
#: tfrmsyncdirsdlg.caption
|
||
msgid "Synchronize directories"
|
||
msgstr "Синхронизация каталогов"
|
||
|
||
#: tfrmsyncdirsdlg.cbextfilter.text
|
||
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
||
msgid "asymmetric"
|
||
msgstr "&асимметрично"
|
||
|
||
#: tfrmsyncdirsdlg.chkbycontent.caption
|
||
msgid "by content"
|
||
msgstr "&по содержимому"
|
||
|
||
#: tfrmsyncdirsdlg.chkignoredate.caption
|
||
msgid "ignore date"
|
||
msgstr "&игнорировать дату"
|
||
|
||
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
||
msgid "only selected"
|
||
msgstr "&Выделенные"
|
||
|
||
#: tfrmsyncdirsdlg.chksubdirs.caption
|
||
msgid "Subdirs"
|
||
msgstr "с &подкаталогами"
|
||
|
||
#: tfrmsyncdirsdlg.groupbox1.caption
|
||
msgid "Show:"
|
||
msgstr "Показывать:"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Имя"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
|
||
msgid "Size"
|
||
msgstr "Размер"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
||
msgid "<=>"
|
||
msgstr "<=>"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
|
||
msgid "Size"
|
||
msgstr "Размер"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
|
||
msgid "Name"
|
||
msgstr "Имя"
|
||
|
||
#: tfrmsyncdirsdlg.label1.caption
|
||
msgid "(in main window)"
|
||
msgstr "(в главном окне)"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
||
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Сравнить"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
||
msgid "View left"
|
||
msgstr "Внутренний просмотр слева"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
||
msgid "View right"
|
||
msgstr "Внутренний просмотр справа"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyright.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmsyncdirsdlg.sbduplicates.caption
|
||
msgid "duplicates"
|
||
msgstr "&дубликаты"
|
||
|
||
#: tfrmsyncdirsdlg.sbequal.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbequal.caption"
|
||
msgid "="
|
||
msgstr "="
|
||
|
||
#: tfrmsyncdirsdlg.sbnotequal.caption
|
||
msgctxt "tfrmsyncdirsdlg.sbnotequal.caption"
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: tfrmsyncdirsdlg.sbsingles.caption
|
||
msgid "singles"
|
||
msgstr "&уникальные"
|
||
|
||
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
||
msgid "Please press \"Compare\" to start"
|
||
msgstr "Чтобы начать, нажмите \"Сравнить\""
|
||
|
||
#: tfrmsyncdirsperformdlg.caption
|
||
msgctxt "tfrmsyncdirsperformdlg.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Синхронизировать"
|
||
|
||
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
||
msgid "Confirm overwrites"
|
||
msgstr "Подтвердить замену"
|
||
|
||
#: tfrmtreeviewmenu.caption
|
||
msgctxt "tfrmtreeviewmenu.caption"
|
||
msgid "Tree View Menu"
|
||
msgstr "Древовидное меню"
|
||
|
||
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
||
msgid "Select your hot directory:"
|
||
msgstr "Выберите ваш избранный каталог:"
|
||
|
||
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
||
msgid "Search is case sensitive"
|
||
msgstr "Поиск чувствителен к регистру"
|
||
|
||
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
||
msgid "Full collapse"
|
||
msgstr "Свернуть все"
|
||
|
||
#: tfrmtreeviewmenu.pmifullexpand.caption
|
||
msgid "Full expand"
|
||
msgstr "Развернуть все"
|
||
|
||
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
||
msgid "Search ignore accents and ligatures"
|
||
msgstr "Игнорировать акценты и лигатуры"
|
||
|
||
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
||
msgid "Search is not case sensitive"
|
||
msgstr "Поиск не чувствителен к регистру"
|
||
|
||
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
||
msgid "Search is strict regarding accents and ligatures"
|
||
msgstr "Поиск с акцентами и лигатурами"
|
||
|
||
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
||
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
||
msgstr "Если строка найдена в имени ветви, то не показывать содержимое ветви"
|
||
|
||
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
||
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
||
msgstr "Если строка найдена в имени ветви, то показать всю ветвь, даже если элементы не соответствуют"
|
||
|
||
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
||
msgid "Close Tree View Menu"
|
||
msgstr "Закрыть древовидное меню"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Настроить древовидное меню"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Настроить цвета древовидного меню"
|
||
|
||
#: tfrmtweakplugin.btnadd.caption
|
||
msgid "A&dd new"
|
||
msgstr "&Добавить"
|
||
|
||
#: tfrmtweakplugin.btncancel.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: tfrmtweakplugin.btnchange.caption
|
||
msgid "C&hange"
|
||
msgstr "&Изменить"
|
||
|
||
#: tfrmtweakplugin.btndefault.caption
|
||
msgid "De&fault"
|
||
msgstr "По умол&чанию"
|
||
|
||
#: tfrmtweakplugin.btnok.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&ОК"
|
||
|
||
#: tfrmtweakplugin.btnrelativeplugin1.hint
|
||
msgctxt "tfrmtweakplugin.btnrelativeplugin1.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmtweakplugin.btnrelativeplugin2.hint
|
||
msgctxt "tfrmtweakplugin.btnrelativeplugin2.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Некоторые функции для выбора подходящего пути"
|
||
|
||
#: tfrmtweakplugin.btnremove.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "&Удалить"
|
||
|
||
#: tfrmtweakplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
|
||
msgid "Tweak plugin"
|
||
msgstr "Настройка плагина"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
||
msgid "De&tect archive type by content"
|
||
msgstr "Определяет тип ар&хива по содержимому"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
||
msgid "Can de&lete files"
|
||
msgstr "Мо&жет удалять из архива"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
||
msgid "Supports e&ncryption"
|
||
msgstr "Поддерживает &шифрование"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
||
msgid "Sho&w as normal files (hide packer icon)"
|
||
msgstr "Пока&зывать как нормальные файлы (скрывать значок архива)"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
||
msgid "Supports pac&king in memory"
|
||
msgstr "Поддерживает упа&ковку в памяти"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
||
msgid "Can &modify existing archives"
|
||
msgstr "Может &модифицировать архивы"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
||
msgid "&Archive can contain multiple files"
|
||
msgstr "&Архив может содержать несколько файлов"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_new.caption
|
||
msgid "Can create new archi&ves"
|
||
msgstr "Может &создавать архивы"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_options.caption
|
||
msgid "S&upports the options dialogbox"
|
||
msgstr "Им&еет диалог настроек"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
||
msgid "Allow searchin&g for text in archives"
|
||
msgstr "Поз&воляет искать текст в архивах"
|
||
|
||
#: tfrmtweakplugin.lbldescription.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
|
||
msgid "&Description:"
|
||
msgstr "Опис&ание:"
|
||
|
||
#: tfrmtweakplugin.lbldetectstr.caption
|
||
msgid "D&etect string:"
|
||
msgstr "Дете&кт-строка:"
|
||
|
||
#: tfrmtweakplugin.lblextension.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
|
||
msgid "&Extension:"
|
||
msgstr "&Расширение:"
|
||
|
||
#: tfrmtweakplugin.lblflags.caption
|
||
msgid "Flags:"
|
||
msgstr "Флаги:"
|
||
|
||
#: tfrmtweakplugin.lblname.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
|
||
msgid "&Name:"
|
||
msgstr "&Имя:"
|
||
|
||
#: tfrmtweakplugin.lblplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "&Плагин:"
|
||
|
||
#: tfrmtweakplugin.lblplugin2.caption
|
||
msgctxt "tfrmtweakplugin.lblplugin2.caption"
|
||
msgid "&Plugin:"
|
||
msgstr "&Плагин:"
|
||
|
||
#: tfrmviewer.actabout.caption
|
||
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
|
||
msgid "About Viewer..."
|
||
msgstr "О просмотрщике..."
|
||
|
||
#: tfrmviewer.actabout.hint
|
||
msgid "Displays the About message"
|
||
msgstr "Показывает сообщение о..."
|
||
|
||
#: tfrmviewer.actchangeencoding.caption
|
||
msgid "Change encoding"
|
||
msgstr "Сменить кодировку"
|
||
|
||
#: tfrmviewer.actcopyfile.caption
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
||
msgid "Copy File"
|
||
msgstr "Копировать файл"
|
||
|
||
#: tfrmviewer.actcopyfile.hint
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
||
msgid "Copy File"
|
||
msgstr "Копировать файл"
|
||
|
||
#: tfrmviewer.actcopytoclipboard.caption
|
||
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
||
msgid "Copy To Clipboard"
|
||
msgstr "&Копировать в буфер"
|
||
|
||
#: tfrmviewer.actcopytoclipboardformatted.caption
|
||
msgid "Copy To Clipboard Formatted"
|
||
msgstr "Копировать в буфер с &форматированием"
|
||
|
||
#: tfrmviewer.actdeletefile.caption
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
||
msgid "Delete File"
|
||
msgstr "Удалить файл"
|
||
|
||
#: tfrmviewer.actdeletefile.hint
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
||
msgid "Delete File"
|
||
msgstr "Удалить файл"
|
||
|
||
#: tfrmviewer.actexitviewer.caption
|
||
msgctxt "tfrmviewer.actexitviewer.caption"
|
||
msgid "E&xit"
|
||
msgstr "Выход"
|
||
|
||
#: tfrmviewer.actfind.caption
|
||
msgctxt "tfrmviewer.actfind.caption"
|
||
msgid "Find"
|
||
msgstr "Найти"
|
||
|
||
#: tfrmviewer.actfindnext.caption
|
||
msgctxt "tfrmviewer.actfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Найти далее"
|
||
|
||
#: tfrmviewer.actfindprev.caption
|
||
msgctxt "tfrmviewer.actfindprev.caption"
|
||
msgid "Find previous"
|
||
msgstr "Найти предыдущее"
|
||
|
||
#: tfrmviewer.actfullscreen.caption
|
||
msgctxt "tfrmviewer.actfullscreen.caption"
|
||
msgid "Full Screen"
|
||
msgstr "Развернуть на весь экран"
|
||
|
||
#: tfrmviewer.actimagecenter.caption
|
||
msgctxt "tfrmviewer.actimagecenter.caption"
|
||
msgid "Center"
|
||
msgstr "По центру окна"
|
||
|
||
#: tfrmviewer.actloadnextfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
|
||
msgid "&Next"
|
||
msgstr "&Следующий"
|
||
|
||
#: tfrmviewer.actloadnextfile.hint
|
||
msgid "Load Next File"
|
||
msgstr "Загрузить следующий файл"
|
||
|
||
#: tfrmviewer.actloadprevfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
|
||
msgid "&Previous"
|
||
msgstr "&Предыдущий"
|
||
|
||
#: tfrmviewer.actloadprevfile.hint
|
||
msgid "Load Previous File"
|
||
msgstr "Загрузить предыдущий файл"
|
||
|
||
#: tfrmviewer.actmirrorhorz.caption
|
||
msgid "Mirror Horizontally"
|
||
msgstr "Отразить по горизонтали"
|
||
|
||
#: tfrmviewer.actmirrorhorz.hint
|
||
msgctxt "tfrmviewer.actmirrorhorz.hint"
|
||
msgid "Mirror"
|
||
msgstr "Зеркально"
|
||
|
||
#: tfrmviewer.actmirrorvert.caption
|
||
msgid "Mirror Vertically"
|
||
msgstr "Отразить по вертикали"
|
||
|
||
#: tfrmviewer.actmovefile.caption
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
||
msgid "Move File"
|
||
msgstr "Переместить файл"
|
||
|
||
#: tfrmviewer.actmovefile.hint
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
||
msgid "Move File"
|
||
msgstr "Переместить файл"
|
||
|
||
#: tfrmviewer.actpreview.caption
|
||
msgctxt "tfrmviewer.actpreview.caption"
|
||
msgid "Preview"
|
||
msgstr "Предварительный просмотр"
|
||
|
||
#: tfrmviewer.actreload.caption
|
||
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
||
msgid "Reload"
|
||
msgstr "Перезагрузить"
|
||
|
||
#: tfrmviewer.actreload.hint
|
||
msgid "Reload current file"
|
||
msgstr "Перезагрузить текущий файл"
|
||
|
||
#: tfrmviewer.actrotate180.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
|
||
msgid "+ 180"
|
||
msgstr "Повернуть на 180°"
|
||
|
||
#: tfrmviewer.actrotate180.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
|
||
msgid "Rotate 180 degrees"
|
||
msgstr "Повернуть на 180 градусов"
|
||
|
||
#: tfrmviewer.actrotate270.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
|
||
msgid "- 90"
|
||
msgstr "Повернуть на 270°"
|
||
|
||
#: tfrmviewer.actrotate270.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
|
||
msgid "Rotate -90 degrees"
|
||
msgstr "Повернуть на -90 градусов"
|
||
|
||
#: tfrmviewer.actrotate90.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
|
||
msgid "+ 90"
|
||
msgstr "Повернуть на 90°"
|
||
|
||
#: tfrmviewer.actrotate90.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
|
||
msgid "Rotate +90 degrees"
|
||
msgstr "Повернуть на +90 градусов"
|
||
|
||
#: tfrmviewer.actsave.caption
|
||
msgctxt "tfrmviewer.actsave.caption"
|
||
msgid "Save"
|
||
msgstr "Сохранить"
|
||
|
||
#: tfrmviewer.actsaveas.caption
|
||
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
|
||
msgid "Save As..."
|
||
msgstr "Сохранить как..."
|
||
|
||
#: tfrmviewer.actsaveas.hint
|
||
msgid "Save File As..."
|
||
msgstr "Сохранить файл как..."
|
||
|
||
#: tfrmviewer.actscreenshot.caption
|
||
msgctxt "tfrmviewer.actscreenshot.caption"
|
||
msgid "Screenshot"
|
||
msgstr "Скриншот"
|
||
|
||
#: tfrmviewer.actscreenshotdelay3sec.caption
|
||
msgid "Delay 3 sec"
|
||
msgstr "Задержка 3 секунды"
|
||
|
||
#: tfrmviewer.actscreenshotdelay5sec.caption
|
||
msgid "Delay 5 sec"
|
||
msgstr "Задержка 5 секунд"
|
||
|
||
#: tfrmviewer.actselectall.caption
|
||
msgctxt "tfrmviewer.actselectall.caption"
|
||
msgid "Select All"
|
||
msgstr "Выделить &всё"
|
||
|
||
#: tfrmviewer.actshowasbin.caption
|
||
msgid "Show as &Bin"
|
||
msgstr "Показать в &двоичном виде"
|
||
|
||
#: tfrmviewer.actshowasbook.caption
|
||
msgid "Show as B&ook"
|
||
msgstr "Показать в режиме \"&Книга\" (текст с колонками)"
|
||
|
||
#: tfrmviewer.actshowasdec.caption
|
||
msgid "Show as &Dec"
|
||
msgstr "Показать в д&есятеричном виде"
|
||
|
||
#: tfrmviewer.actshowashex.caption
|
||
msgid "Show as &Hex"
|
||
msgstr "Показать в &шестнадцатеричном виде"
|
||
|
||
#: tfrmviewer.actshowastext.caption
|
||
msgid "Show as &Text"
|
||
msgstr "Показать как &текст"
|
||
|
||
#: tfrmviewer.actshowaswraptext.caption
|
||
msgid "Show as &Wrap text"
|
||
msgstr "Показать как текст с &разрывами строк"
|
||
|
||
#: tfrmviewer.actshowgraphics.caption
|
||
msgctxt "tfrmviewer.actshowgraphics.caption"
|
||
msgid "Graphics"
|
||
msgstr "&Графика"
|
||
|
||
#: tfrmviewer.actshowplugins.caption
|
||
msgctxt "tfrmviewer.actshowplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Плагины"
|
||
|
||
#: tfrmviewer.actstretchimage.caption
|
||
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
|
||
msgid "Stretch"
|
||
msgstr "В размер окна"
|
||
|
||
#: tfrmviewer.actstretchimage.hint
|
||
msgid "Stretch Image"
|
||
msgstr "Все изображения в размер окна"
|
||
|
||
#: tfrmviewer.actstretchonlylarge.caption
|
||
msgctxt "tfrmviewer.actstretchonlylarge.caption"
|
||
msgid "Stretch only large"
|
||
msgstr "Только большие в размер окна"
|
||
|
||
#: tfrmviewer.actzoom.caption
|
||
msgid "Zoom"
|
||
msgstr "Увеличение"
|
||
|
||
#: tfrmviewer.actzoomin.caption
|
||
msgctxt "tfrmviewer.actzoomin.caption"
|
||
msgid "Zoom In"
|
||
msgstr "Увеличить"
|
||
|
||
#: tfrmviewer.actzoomout.caption
|
||
msgctxt "tfrmviewer.actzoomout.caption"
|
||
msgid "Zoom Out"
|
||
msgstr "Уменьшить"
|
||
|
||
#: tfrmviewer.btncuttuimage.hint
|
||
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
|
||
msgid "Crop"
|
||
msgstr "Обрезать"
|
||
|
||
#: tfrmviewer.btnfullscreen.hint
|
||
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
||
msgid "Full Screen"
|
||
msgstr "Развернуть на весь экран"
|
||
|
||
#: tfrmviewer.btngifmove.caption
|
||
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmviewer.btngiftobmp.caption
|
||
msgid "S"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.btnhightlight.hint
|
||
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
||
msgid "Highlight"
|
||
msgstr "Выделение"
|
||
|
||
#: tfrmviewer.btnnextgifframe.caption
|
||
msgid "||>"
|
||
msgstr "||>"
|
||
|
||
#: tfrmviewer.btnpaint.hint
|
||
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
||
msgid "Paint"
|
||
msgstr "Рисование"
|
||
|
||
#: tfrmviewer.btnprevgifframe.caption
|
||
msgid "<||"
|
||
msgstr "<||"
|
||
|
||
#: tfrmviewer.btnredeye.hint
|
||
msgid "Red Eyes"
|
||
msgstr "Красные глаза"
|
||
|
||
#: tfrmviewer.btnresize.hint
|
||
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
|
||
msgid "Resize"
|
||
msgstr "Изменить размер"
|
||
|
||
#: tfrmviewer.btnundo.hint
|
||
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Отменить"
|
||
|
||
#: tfrmviewer.caption
|
||
msgctxt "tfrmviewer.caption"
|
||
msgid "Viewer"
|
||
msgstr "Программа просмотра"
|
||
|
||
#: tfrmviewer.cbslideshow.caption
|
||
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Слайд шоу"
|
||
|
||
#: tfrmviewer.comboboxpaint.text
|
||
msgid "Pen"
|
||
msgstr "Карандаш"
|
||
|
||
#: tfrmviewer.comboboxwidth.text
|
||
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmviewer.gboxhightlight.caption
|
||
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
||
msgid "Highlight"
|
||
msgstr "Выделение"
|
||
|
||
#: tfrmviewer.gboxpaint.caption
|
||
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
||
msgid "Paint"
|
||
msgstr "Рисование"
|
||
|
||
#: tfrmviewer.gboxslideshow.caption
|
||
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Слайд шоу"
|
||
|
||
#: tfrmviewer.gboxview.caption
|
||
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Просмотреть"
|
||
|
||
#: tfrmviewer.lblhightlight.caption
|
||
msgid "0x0"
|
||
msgstr "0x0"
|
||
|
||
#: tfrmviewer.miabout.caption
|
||
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "О программе..."
|
||
|
||
#: tfrmviewer.miedit.caption
|
||
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Правка"
|
||
|
||
#: tfrmviewer.miencoding.caption
|
||
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "&Кодировка"
|
||
|
||
#: tfrmviewer.mifile.caption
|
||
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: tfrmviewer.miimage.caption
|
||
msgid "&Image"
|
||
msgstr "Изоб&ражение"
|
||
|
||
#: tfrmviewer.miprint.caption
|
||
msgid "Print..."
|
||
msgstr "Печать..."
|
||
|
||
#: tfrmviewer.mirotate.caption
|
||
msgid "Rotate"
|
||
msgstr "Повернуть"
|
||
|
||
#: tfrmviewer.miscreenshot.caption
|
||
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
||
msgid "Screenshot"
|
||
msgstr "Скриншот"
|
||
|
||
#: tfrmviewer.miview.caption
|
||
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
||
msgid "&View"
|
||
msgstr "&Вид"
|
||
|
||
#: tfrmviewer.pmiselectall.caption
|
||
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Выделить &всё"
|
||
|
||
#: tfrmviewoperations.btnstartpause.caption
|
||
msgctxt "tfrmviewoperations.btnstartpause.caption"
|
||
msgid "&Start"
|
||
msgstr "&Старт"
|
||
|
||
#: tfrmviewoperations.btnstop.caption
|
||
msgid "S&top"
|
||
msgstr "С&топ"
|
||
|
||
#: tfrmviewoperations.caption
|
||
msgctxt "tfrmviewoperations.caption"
|
||
msgid "File operations"
|
||
msgstr "Файловые операции"
|
||
|
||
#: tfrmviewoperations.cbalwaysontop.caption
|
||
msgid "Always on top"
|
||
msgstr "Поверх всех окон"
|
||
|
||
#: tfrmviewoperations.lblusedragdrop.caption
|
||
msgid "&Use \"drag && drop\" to move operations between queues"
|
||
msgstr "Для перемещения операций между очередями используйте перетаскивание"
|
||
|
||
#: tfrmviewoperations.mnucanceloperation.caption
|
||
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
|
||
msgid "Cancel"
|
||
msgstr "Отмена"
|
||
|
||
#: tfrmviewoperations.mnucancelqueue.caption
|
||
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
|
||
msgid "Cancel"
|
||
msgstr "Отмена"
|
||
|
||
#: tfrmviewoperations.mnunewqueue.caption
|
||
msgctxt "tfrmviewoperations.mnunewqueue.caption"
|
||
msgid "New queue"
|
||
msgstr "Новая очередь"
|
||
|
||
#: tfrmviewoperations.mnuoperationshowdetached.caption
|
||
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
|
||
msgid "Show in detached window"
|
||
msgstr "Показать в отдельном окне"
|
||
|
||
#: tfrmviewoperations.mnuputfirstinqueue.caption
|
||
msgid "Put first in queue"
|
||
msgstr "Переместить в начало очереди"
|
||
|
||
#: tfrmviewoperations.mnuputlastinqueue.caption
|
||
msgid "Put last in queue"
|
||
msgstr "Переместить в конец очереди"
|
||
|
||
#: tfrmviewoperations.mnuqueue.caption
|
||
msgctxt "tfrmviewoperations.mnuqueue.caption"
|
||
msgid "Queue"
|
||
msgstr "Очередь"
|
||
|
||
#: tfrmviewoperations.mnuqueue0.caption
|
||
msgid "Out of queue"
|
||
msgstr "Вне очереди"
|
||
|
||
#: tfrmviewoperations.mnuqueue1.caption
|
||
msgctxt "tfrmviewoperations.mnuqueue1.caption"
|
||
msgid "Queue 1"
|
||
msgstr "Очередь 1"
|
||
|
||
#: tfrmviewoperations.mnuqueue2.caption
|
||
msgctxt "tfrmviewoperations.mnuqueue2.caption"
|
||
msgid "Queue 2"
|
||
msgstr "Очередь 2"
|
||
|
||
#: tfrmviewoperations.mnuqueue3.caption
|
||
msgctxt "tfrmviewoperations.mnuqueue3.caption"
|
||
msgid "Queue 3"
|
||
msgstr "Очередь 3"
|
||
|
||
#: tfrmviewoperations.mnuqueue4.caption
|
||
msgctxt "tfrmviewoperations.mnuqueue4.caption"
|
||
msgid "Queue 4"
|
||
msgstr "Очередь 4"
|
||
|
||
#: tfrmviewoperations.mnuqueue5.caption
|
||
msgctxt "tfrmviewoperations.mnuqueue5.caption"
|
||
msgid "Queue 5"
|
||
msgstr "Очередь 5"
|
||
|
||
#: tfrmviewoperations.mnuqueueshowdetached.caption
|
||
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
|
||
msgid "Show in detached window"
|
||
msgstr "Показать в отдельном окне"
|
||
|
||
#: tfrmviewoperations.tbpauseall.caption
|
||
msgid "&Pause all"
|
||
msgstr "&Пауза для всех"
|
||
|
||
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Если файл существует"
|
||
|
||
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Если файл существует"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Копировать дат&у/время"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
||
msgid "Work in background (separate connection)"
|
||
msgstr "Работать в фоне (отдельное соединение)"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Если файл существует"
|
||
|
||
#: uexifreader.rsdatetimeoriginal
|
||
msgid "Date taken"
|
||
msgstr "Дата съёмки"
|
||
|
||
#: uexifreader.rsimageheight
|
||
msgctxt "uexifreader.rsimageheight"
|
||
msgid "Height"
|
||
msgstr "Высота"
|
||
|
||
#: uexifreader.rsimagewidth
|
||
msgctxt "uexifreader.rsimagewidth"
|
||
msgid "Width"
|
||
msgstr "Ширина"
|
||
|
||
#: uexifreader.rsmake
|
||
msgid "Manufacturer"
|
||
msgstr "Производитель"
|
||
|
||
#: uexifreader.rsmodel
|
||
msgid "Camera model"
|
||
msgstr "Модель камеры"
|
||
|
||
#: uexifreader.rsorientation
|
||
msgid "Orientation"
|
||
msgstr "Ориентация"
|
||
|
||
#: ulng.msgtrytolocatecrcfile
|
||
msgid ""
|
||
"This file cannot be found and could help to validate final combination of files:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Could you make it available and press \"OK\" when ready,\n"
|
||
"or press \"CANCEL\" to continue without it?\n"
|
||
msgstr ""
|
||
"Файл с контрольной суммой поможет объединить файлы, но не был найден:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Вы можете сделать его доступным и нажать \"OK\", когда будете готовы,\n"
|
||
"или нажать \"ОТМЕНА\", чтобы продолжить объединение без него.\n"
|
||
|
||
#: ulng.rscancelfilter
|
||
msgid "Cancel Quick Filter"
|
||
msgstr "Отменить быстрый фильтр"
|
||
|
||
#: ulng.rscanceloperation
|
||
msgid "Cancel Current Operation"
|
||
msgstr "Отменить текущую операцию"
|
||
|
||
#: ulng.rscaptionforaskingfilename
|
||
msgid "Enter filename, with extension, for dropped text"
|
||
msgstr "Введите имя файла, с расширением"
|
||
|
||
#: ulng.rscaptionfortextformattoimport
|
||
msgid "Text format to import"
|
||
msgstr "Формат текста для импорта"
|
||
|
||
#: ulng.rschecksumverifybroken
|
||
msgid "Broken:"
|
||
msgstr "Ошибка:"
|
||
|
||
#: ulng.rschecksumverifygeneral
|
||
msgid "General:"
|
||
msgstr "Отчёт:"
|
||
|
||
#: ulng.rschecksumverifymissing
|
||
msgid "Missing:"
|
||
msgstr "Не найдено:"
|
||
|
||
#: ulng.rschecksumverifyreaderror
|
||
msgid "Read error:"
|
||
msgstr "Ошибка чтения:"
|
||
|
||
#: ulng.rschecksumverifysuccess
|
||
msgid "Success:"
|
||
msgstr "Успешно:"
|
||
|
||
#: ulng.rschecksumverifytext
|
||
msgid "Enter checksum and select algorithm:"
|
||
msgstr "Введите контрольную сумму и выберите алгоритм:"
|
||
|
||
#: ulng.rschecksumverifytitle
|
||
msgid "Verify checksum"
|
||
msgstr "Проверка контрольной суммы"
|
||
|
||
#: ulng.rschecksumverifytotal
|
||
msgid "Total:"
|
||
msgstr "Всего:"
|
||
|
||
#: ulng.rsclearfiltersornot
|
||
msgid "Do you want to clear filters for this new search?"
|
||
msgstr "Хотите очистить фильтры для этого нового поиска?"
|
||
|
||
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
||
msgid "Clipboard doesn't contain any valid toolbar data."
|
||
msgstr "Буфер обмена не содержит данных панели инструментов"
|
||
|
||
#: ulng.rscmdcategorylistinorder
|
||
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
||
msgstr "Все;Активная панель;Левая панель;Правая панель;Файловые операции;Настройка;Сеть;Разное;Параллельный порт;Печать;Выделение;Безопасность;Буфер обмена;FTP;Навигация;Помощь;Окно;Командная строка;Инструменты;Вид;Пользователь;Вкладки;Сортировка;Протокол"
|
||
|
||
#: ulng.rscmdkindofsort
|
||
msgid "Legacy sorted;A-Z sorted"
|
||
msgstr "По умолчанию;По алфавиту"
|
||
|
||
#: ulng.rscolattr
|
||
msgid "Attr"
|
||
msgstr "Атриб"
|
||
|
||
#: ulng.rscoldate
|
||
msgctxt "ulng.rscoldate"
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: ulng.rscolext
|
||
msgid "Ext"
|
||
msgstr "Тип"
|
||
|
||
#: ulng.rscolname
|
||
msgctxt "ulng.rscolname"
|
||
msgid "Name"
|
||
msgstr "Имя"
|
||
|
||
#: ulng.rscolsize
|
||
msgctxt "ulng.rscolsize"
|
||
msgid "Size"
|
||
msgstr "Размер"
|
||
|
||
#: ulng.rsconfcolalign
|
||
msgid "Align"
|
||
msgstr "Выравн."
|
||
|
||
#: ulng.rsconfcolcaption
|
||
msgid "Caption"
|
||
msgstr "Заголовок"
|
||
|
||
#: ulng.rsconfcoldelete
|
||
msgctxt "ulng.rsconfcoldelete"
|
||
msgid "Delete"
|
||
msgstr "Удалить"
|
||
|
||
#: ulng.rsconfcolfieldcont
|
||
msgid "Field contents"
|
||
msgstr "Содержимое поля данных"
|
||
|
||
#: ulng.rsconfcolmove
|
||
msgctxt "ulng.rsconfcolmove"
|
||
msgid "Move"
|
||
msgstr "Переместить"
|
||
|
||
#: ulng.rsconfcolwidth
|
||
msgctxt "ulng.rsconfcolwidth"
|
||
msgid "Width"
|
||
msgstr "Ширина"
|
||
|
||
#: ulng.rsconfcustheader
|
||
msgid "Customize column"
|
||
msgstr "Настроить колонку"
|
||
|
||
#: ulng.rsconfigurationfileassociation
|
||
msgid "Configure file association"
|
||
msgstr "Настроить файловые ассоциации"
|
||
|
||
#: ulng.rsconfirmexecution
|
||
msgid "Confirming command line and parameters"
|
||
msgstr "Подтверждение командной строки и параметров"
|
||
|
||
#: ulng.rscopynametemplate
|
||
msgid "Copy (%d) %s"
|
||
msgstr "Копия (%d) %s"
|
||
|
||
#: ulng.rsdefaultimporteddctoolbarhint
|
||
msgid "Imported DC toolbar"
|
||
msgstr "Импортированная панель инструментов DC"
|
||
|
||
#: ulng.rsdefaultimportedtctoolbarhint
|
||
msgid "Imported TC toolbar"
|
||
msgstr "Импортированная панель инструментов TC"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtext
|
||
msgid "_DroppedText"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
||
msgid "_DroppedHTMLtext"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
||
msgid "_DroppedRichtext"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
||
msgid "_DroppedSimpleText"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
||
msgid "_DroppedUnicodeUTF16text"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
||
msgid "_DroppedUnicodeUTF8text"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdiffadds
|
||
msgid " Adds: "
|
||
msgstr " Добавлено: "
|
||
|
||
#: ulng.rsdiffdeletes
|
||
msgid " Deletes: "
|
||
msgstr " Удалено: "
|
||
|
||
#: ulng.rsdifffilesidentical
|
||
msgid "The two files are identical!"
|
||
msgstr "Эти два файла идентичны!"
|
||
|
||
#: ulng.rsdiffmatches
|
||
msgid " Matches: "
|
||
msgstr " Совпало: "
|
||
|
||
#: ulng.rsdiffmodifies
|
||
msgid " Modifies: "
|
||
msgstr " Изменено: "
|
||
|
||
#: ulng.rsdlgbuttonabort
|
||
msgid "Ab&ort"
|
||
msgstr "Пр&ервать"
|
||
|
||
#: ulng.rsdlgbuttonall
|
||
msgctxt "ulng.rsdlgbuttonall"
|
||
msgid "A&ll"
|
||
msgstr "&Все"
|
||
|
||
#: ulng.rsdlgbuttonappend
|
||
msgid "A&ppend"
|
||
msgstr "&Дописать"
|
||
|
||
#: ulng.rsdlgbuttonautorenamesource
|
||
msgid "A&uto-rename source files"
|
||
msgstr "&Автоматически переименовывать копируемые файлы"
|
||
|
||
#: ulng.rsdlgbuttoncancel
|
||
msgctxt "ulng.rsdlgbuttoncancel"
|
||
msgid "&Cancel"
|
||
msgstr "О&тмена"
|
||
|
||
#: ulng.rsdlgbuttoncompare
|
||
msgid "Compare &by content"
|
||
msgstr "Сравнить"
|
||
|
||
#: ulng.rsdlgbuttoncontinue
|
||
msgid "&Continue"
|
||
msgstr "&Продолжить"
|
||
|
||
#: ulng.rsdlgbuttoncopyinto
|
||
msgid "&Merge"
|
||
msgstr "&Объединить"
|
||
|
||
#: ulng.rsdlgbuttoncopyintoall
|
||
msgid "Mer&ge All"
|
||
msgstr "Объ&единить (для всех)"
|
||
|
||
#: ulng.rsdlgbuttonexitprogram
|
||
msgid "E&xit program"
|
||
msgstr "&Выйти из программы"
|
||
|
||
#: ulng.rsdlgbuttonignore
|
||
msgid "Ig&nore"
|
||
msgstr "Игнорировать"
|
||
|
||
#: ulng.rsdlgbuttonignoreall
|
||
msgid "I&gnore All"
|
||
msgstr "И&гнорировать все"
|
||
|
||
#: ulng.rsdlgbuttonno
|
||
msgid "&No"
|
||
msgstr "&Нет"
|
||
|
||
#: ulng.rsdlgbuttonnone
|
||
msgid "Non&e"
|
||
msgstr "&Ни одного"
|
||
|
||
#: ulng.rsdlgbuttonok
|
||
msgctxt "ulng.rsdlgbuttonok"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: ulng.rsdlgbuttonother
|
||
msgid "Ot&her"
|
||
msgstr "&Другое"
|
||
|
||
#: ulng.rsdlgbuttonoverwrite
|
||
msgid "&Overwrite"
|
||
msgstr "&Переписать"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteall
|
||
msgid "Overwrite &All"
|
||
msgstr "Переписать &все"
|
||
|
||
#: ulng.rsdlgbuttonoverwritelarger
|
||
msgid "Overwrite All &Larger"
|
||
msgstr "Заменить &большие"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteolder
|
||
msgid "Overwrite All Ol&der"
|
||
msgstr "Заменить более &старые"
|
||
|
||
#: ulng.rsdlgbuttonoverwritesmaller
|
||
msgid "Overwrite All S&maller"
|
||
msgstr "Заменить &меньшие"
|
||
|
||
#: ulng.rsdlgbuttonrename
|
||
msgctxt "ulng.rsdlgbuttonrename"
|
||
msgid "R&ename"
|
||
msgstr "Пере&именовать"
|
||
|
||
#: ulng.rsdlgbuttonresume
|
||
msgid "&Resume"
|
||
msgstr "П&родолжить"
|
||
|
||
#: ulng.rsdlgbuttonretry
|
||
msgid "Re&try"
|
||
msgstr "Пов&торить"
|
||
|
||
#: ulng.rsdlgbuttonretryadmin
|
||
msgid "As Ad&ministrator"
|
||
msgstr "Как &Администратор"
|
||
|
||
#: ulng.rsdlgbuttonskip
|
||
msgid "&Skip"
|
||
msgstr "Пр&опустить"
|
||
|
||
#: ulng.rsdlgbuttonskipall
|
||
msgid "S&kip All"
|
||
msgstr "Проп&устить все"
|
||
|
||
#: ulng.rsdlgbuttonunlock
|
||
msgid "&Unlock"
|
||
msgstr "&Разблокировать"
|
||
|
||
#: ulng.rsdlgbuttonyes
|
||
msgid "&Yes"
|
||
msgstr "&Да"
|
||
|
||
#: ulng.rsdlgcp
|
||
msgctxt "ulng.rsdlgcp"
|
||
msgid "Copy file(s)"
|
||
msgstr "Копировать файл(ы)"
|
||
|
||
#: ulng.rsdlgmv
|
||
msgid "Move file(s)"
|
||
msgstr "Переместить файл(ы)"
|
||
|
||
#: ulng.rsdlgoppause
|
||
msgctxt "ulng.rsdlgoppause"
|
||
msgid "Pau&se"
|
||
msgstr "Па&уза"
|
||
|
||
#: ulng.rsdlgopstart
|
||
msgctxt "ulng.rsdlgopstart"
|
||
msgid "&Start"
|
||
msgstr "&Старт"
|
||
|
||
#: ulng.rsdlgqueue
|
||
msgctxt "ulng.rsdlgqueue"
|
||
msgid "Queue"
|
||
msgstr "Очередь"
|
||
|
||
#: ulng.rsdlgspeed
|
||
msgid "Speed %s/s"
|
||
msgstr "Скорость %s/с"
|
||
|
||
#: ulng.rsdlgspeedtime
|
||
msgid "Speed %s/s, time remaining %s"
|
||
msgstr "Скорость %s/с, осталось времени %s"
|
||
|
||
#: ulng.rsdraganddroptextformat
|
||
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
||
msgstr "Формат RTF;Формат HTML;Текст в Unicode;Простой текст"
|
||
|
||
#: ulng.rsdrivenolabel
|
||
msgid "<no label>"
|
||
msgstr "<нет метки>"
|
||
|
||
#: ulng.rsdrivenomedia
|
||
msgid "<no media>"
|
||
msgstr "<нет носителя>"
|
||
|
||
#: ulng.rseditabouttext
|
||
msgid "Internal Editor of Double Commander."
|
||
msgstr "Встроенный редактор Double Commander."
|
||
|
||
#: ulng.rseditgotolinequery
|
||
msgid "Goto line:"
|
||
msgstr "Перейти к строке:"
|
||
|
||
#: ulng.rseditgotolinetitle
|
||
msgctxt "ulng.rseditgotolinetitle"
|
||
msgid "Goto Line"
|
||
msgstr "Переход к строке"
|
||
|
||
#: ulng.rseditnewfile
|
||
msgid "new.txt"
|
||
msgstr "новый.txt"
|
||
|
||
#: ulng.rseditnewfilename
|
||
msgid "Filename:"
|
||
msgstr "Имя файла:"
|
||
|
||
#: ulng.rseditnewopen
|
||
msgid "Open file"
|
||
msgstr "Открыть файл"
|
||
|
||
#: ulng.rseditsearchback
|
||
msgid "&Backward"
|
||
msgstr "&Назад"
|
||
|
||
#: ulng.rseditsearchcaption
|
||
msgctxt "ulng.rseditsearchcaption"
|
||
msgid "Search"
|
||
msgstr "Найти..."
|
||
|
||
#: ulng.rseditsearchfrw
|
||
msgid "&Forward"
|
||
msgstr "&Вперед"
|
||
|
||
#: ulng.rseditsearchreplace
|
||
msgctxt "ulng.rseditsearchreplace"
|
||
msgid "Replace"
|
||
msgstr "Заменить"
|
||
|
||
#: ulng.rseditwithexternaleditor
|
||
msgid "with external editor"
|
||
msgstr "во внешнем редакторе"
|
||
|
||
#: ulng.rseditwithinternaleditor
|
||
msgid "with internal editor"
|
||
msgstr "во встроенном редакторе"
|
||
|
||
#: ulng.rsexecuteviashell
|
||
msgctxt "ulng.rsexecuteviashell"
|
||
msgid "Execute via shell"
|
||
msgstr "Запустить с помощью оболочки"
|
||
|
||
#: ulng.rsexecuteviaterminalclose
|
||
msgctxt "ulng.rsexecuteviaterminalclose"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Запустить в терминале и закрыть"
|
||
|
||
#: ulng.rsexecuteviaterminalstayopen
|
||
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Запустить в терминале и оставить открытым"
|
||
|
||
#: ulng.rsfavtabspanelsideselection
|
||
msgid "Left;Right;Active;Inactive;Both;None"
|
||
msgstr "Слева;Справа;В активной;В неактивной;В обеих;Нет"
|
||
|
||
#: ulng.rsfavtabssavedirhistory
|
||
msgid "No;Yes"
|
||
msgstr "Нет;Да"
|
||
|
||
#: ulng.rsfilenameexportedtcbarprefix
|
||
msgid "Exported_from_DC"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfileopcopymovefileexistsoptions
|
||
msgid "Ask;Overwrite;Skip"
|
||
msgstr ""
|
||
|
||
#: ulng.rsfileopdirectoryexistsoptions
|
||
msgid "Ask;Merge;Skip"
|
||
msgstr "Спрашивать;Объединять;Пропускать"
|
||
|
||
#: ulng.rsfileopfileexistsoptions
|
||
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
||
msgstr "Спрашивать;Перезаписывать;Перезаписывать более старые;Пропускать"
|
||
|
||
#: ulng.rsfileopsetpropertyerroroptions
|
||
msgctxt "ulng.rsfileopsetpropertyerroroptions"
|
||
msgid "Ask;Don't set anymore;Ignore errors"
|
||
msgstr "Спрашивать;Никогда не устанавливать;Игнорировать"
|
||
|
||
#: ulng.rsfilterstatus
|
||
msgid "FILTER"
|
||
msgstr "ФИЛЬТР"
|
||
|
||
#: ulng.rsfinddefinetemplate
|
||
msgid "Define template"
|
||
msgstr "Задать шаблон"
|
||
|
||
#: ulng.rsfinddepth
|
||
msgid "%s level(s)"
|
||
msgstr "число уровней: %s"
|
||
|
||
#: ulng.rsfinddepthall
|
||
msgid "all (unlimited depth)"
|
||
msgstr "все (неограниченная)"
|
||
|
||
#: ulng.rsfinddepthcurdir
|
||
msgid "current dir only"
|
||
msgstr "только текущий каталог"
|
||
|
||
#: ulng.rsfinddirnoex
|
||
msgid "Directory %s does not exist!"
|
||
msgstr "Каталог %s не существует!"
|
||
|
||
#: ulng.rsfindfound
|
||
msgid "Found: %d"
|
||
msgstr "Найдено: %d"
|
||
|
||
#: ulng.rsfindsavetemplatecaption
|
||
msgid "Save search template"
|
||
msgstr "Сохранить шаблон поиска"
|
||
|
||
#: ulng.rsfindsavetemplatetitle
|
||
msgid "Template name:"
|
||
msgstr "Имя шаблона:"
|
||
|
||
#: ulng.rsfindscanned
|
||
msgid "Scanned: %d"
|
||
msgstr "Просмотрено: %d"
|
||
|
||
#: ulng.rsfindscanning
|
||
msgid "Scanning"
|
||
msgstr "Сканирование"
|
||
|
||
#: ulng.rsfindsearchfiles
|
||
msgctxt "ulng.rsfindsearchfiles"
|
||
msgid "Find files"
|
||
msgstr "Поиск файлов"
|
||
|
||
#: ulng.rsfindtimeofscan
|
||
msgid "Time of scan: "
|
||
msgstr "Время сканирования: "
|
||
|
||
#: ulng.rsfindwherebeg
|
||
msgid "Begin at"
|
||
msgstr "Начинать у"
|
||
|
||
#: ulng.rsfreemsg
|
||
msgid "Free %s from %s bytes"
|
||
msgstr "Свободно %s из %s байт"
|
||
|
||
#: ulng.rsfreemsgshort
|
||
msgid "%s bytes free"
|
||
msgstr "%s байт свободно"
|
||
|
||
#: ulng.rsfuncatime
|
||
msgid "Access date/time"
|
||
msgstr "Дата/время последнего доступа"
|
||
|
||
#: ulng.rsfuncattr
|
||
msgctxt "ulng.rsfuncattr"
|
||
msgid "Attributes"
|
||
msgstr "Атрибуты"
|
||
|
||
#: ulng.rsfunccomment
|
||
msgctxt "ulng.rsfunccomment"
|
||
msgid "Comment"
|
||
msgstr "Комментарий"
|
||
|
||
#: ulng.rsfunccompressedsize
|
||
msgid "Compressed size"
|
||
msgstr "Сжатый размер"
|
||
|
||
#: ulng.rsfuncctime
|
||
msgid "Creation date/time"
|
||
msgstr "Дата/время создания"
|
||
|
||
#: ulng.rsfuncext
|
||
msgid "Extension"
|
||
msgstr "Расширение"
|
||
|
||
#: ulng.rsfuncgroup
|
||
msgctxt "ulng.rsfuncgroup"
|
||
msgid "Group"
|
||
msgstr "Группа"
|
||
|
||
#: ulng.rsfunchtime
|
||
msgid "Change date/time"
|
||
msgstr "Изменение даты/времени"
|
||
|
||
#: ulng.rsfunclinkto
|
||
msgid "Link to"
|
||
msgstr "Ссылка на"
|
||
|
||
#: ulng.rsfuncmtime
|
||
msgid "Modification date/time"
|
||
msgstr "Дата/время модификации"
|
||
|
||
#: ulng.rsfuncname
|
||
msgctxt "ulng.rsfuncname"
|
||
msgid "Name"
|
||
msgstr "Имя"
|
||
|
||
#: ulng.rsfuncnamenoext
|
||
msgid "Name without extension"
|
||
msgstr "Имя без расширения"
|
||
|
||
#: ulng.rsfuncowner
|
||
msgctxt "ulng.rsfuncowner"
|
||
msgid "Owner"
|
||
msgstr "Владелец"
|
||
|
||
#: ulng.rsfuncpath
|
||
msgctxt "ulng.rsfuncpath"
|
||
msgid "Path"
|
||
msgstr "Путь"
|
||
|
||
#: ulng.rsfuncsize
|
||
msgctxt "ulng.rsfuncsize"
|
||
msgid "Size"
|
||
msgstr "Размер"
|
||
|
||
#: ulng.rsfunctype
|
||
msgid "Type"
|
||
msgstr "Тип"
|
||
|
||
#: ulng.rsharderrcreate
|
||
msgid "Error creating hardlink."
|
||
msgstr "Ошибка создания жёсткой ссылки."
|
||
|
||
#: ulng.rshotdirforcesortingorderchoices
|
||
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
||
msgstr "нет;Имя, а-я;Имя, я-а;Тип, а-я;Тип, я-а;Размер 9-0;Размер 0-9;Дата 9-0;Дата 0-9"
|
||
|
||
#: ulng.rshotdirwarningabortrestorebackup
|
||
msgid ""
|
||
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
||
"\n"
|
||
"Are you sure you want to proceed?\n"
|
||
msgstr ""
|
||
"Внимание! Восстановление из резервной копии очистит существующий список избранных каталогов и заменит его импортированным.\n"
|
||
"\n"
|
||
"Вы уверены, что хотите продолжить?\n"
|
||
|
||
#: ulng.rshotkeycategorycopymovedialog
|
||
msgid "Copy/Move Dialog"
|
||
msgstr "Диалог копирования/перемещения"
|
||
|
||
#: ulng.rshotkeycategorydiffer
|
||
msgctxt "ulng.rshotkeycategorydiffer"
|
||
msgid "Differ"
|
||
msgstr "Поиск различий"
|
||
|
||
#: ulng.rshotkeycategoryeditcommentdialog
|
||
msgid "Edit Comment Dialog"
|
||
msgstr "Диалог редактирования комментария"
|
||
|
||
#: ulng.rshotkeycategoryeditor
|
||
msgctxt "ulng.rshotkeycategoryeditor"
|
||
msgid "Editor"
|
||
msgstr "Редактор"
|
||
|
||
#: ulng.rshotkeycategoryfindfiles
|
||
msgctxt "ulng.rshotkeycategoryfindfiles"
|
||
msgid "Find files"
|
||
msgstr "Поиск файлов"
|
||
|
||
#: ulng.rshotkeycategorymain
|
||
msgid "Main"
|
||
msgstr "Основные"
|
||
|
||
#: ulng.rshotkeycategorysyncdirs
|
||
msgid "Synchronize Directories"
|
||
msgstr "Синхронизация каталогов"
|
||
|
||
#: ulng.rshotkeycategoryviewer
|
||
msgctxt "ulng.rshotkeycategoryviewer"
|
||
msgid "Viewer"
|
||
msgstr "Внутренняя программа просмотра"
|
||
|
||
#: ulng.rshotkeyfilealreadyexists
|
||
msgid ""
|
||
"A setup with that name already exists.\n"
|
||
"Do you want to overwrite it?\n"
|
||
msgstr ""
|
||
"Файл с таким именем уже существует.\n"
|
||
"Хотите переписать его?\n"
|
||
|
||
#: ulng.rshotkeyfileconfirmdefault
|
||
msgid "Are you sure you want to restore default?"
|
||
msgstr "Вы уверены, что хотите восстановить значения по умолчанию?"
|
||
|
||
#: ulng.rshotkeyfileconfirmerasure
|
||
msgid "Are you sure you want to erase setup \"%s\"?"
|
||
msgstr "Вы уверены, что хотите удалить набор \"%s\"?"
|
||
|
||
#: ulng.rshotkeyfilecopyof
|
||
msgid "Copy of %s"
|
||
msgstr "Копия %s"
|
||
|
||
#: ulng.rshotkeyfileinputnewname
|
||
msgid "Input your new name"
|
||
msgstr "Введите новое имя"
|
||
|
||
#: ulng.rshotkeyfilemustkeepone
|
||
msgid "You must keep at least one shortcut file."
|
||
msgstr "Вы должны сохранить по крайней мере один файл горячих клавиш."
|
||
|
||
#: ulng.rshotkeyfilenewname
|
||
msgid "New name"
|
||
msgstr "Новое имя"
|
||
|
||
#: ulng.rshotkeyfilesavemodified
|
||
msgid ""
|
||
"\"%s\" setup has been modified.\n"
|
||
"Do you want to save it now?\n"
|
||
msgstr ""
|
||
"Файл \"%s\" был изменён.\n"
|
||
"Хотите сохранить его сейчас?\n"
|
||
|
||
#: ulng.rshotkeynoscenter
|
||
msgid "No shortcut with \"ENTER\""
|
||
msgstr "Не использовать \"Enter\""
|
||
|
||
#: ulng.rshotkeysortorder
|
||
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
||
msgstr "По имени команды;По горячим клавишам (группир.);По горячим клавишам (по одной)"
|
||
|
||
#: ulng.rsimporttoolbarproblem
|
||
msgid "Cannot find reference to default bar file"
|
||
msgstr "Не удалось найти ссылку на файл панели инструментов по умолчанию"
|
||
|
||
#: ulng.rslistoffindfileswindows
|
||
msgid "List of \"Find files\" windows"
|
||
msgstr "Список окон \"Поиск файлов\""
|
||
|
||
#: ulng.rsmarkminus
|
||
msgid "Unselect mask"
|
||
msgstr "Снять выделение по маске"
|
||
|
||
#: ulng.rsmarkplus
|
||
msgid "Select mask"
|
||
msgstr "Выделить по маске"
|
||
|
||
#: ulng.rsmaskinput
|
||
msgid "Input mask:"
|
||
msgstr "Укажите маску файлов (разделитель - \";\"):"
|
||
|
||
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
||
msgid "A columns view with that name already exists."
|
||
msgstr "Набор колонок с таким именем уже существует."
|
||
|
||
#: ulng.rsmenuconfigurecolumnssavetochange
|
||
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
||
msgstr "Изменить либо СОХРАНИТЬ, КОПИРОВАТЬ или УДАЛИТЬ текущий набор колонок"
|
||
|
||
#: ulng.rsmenuconfigurecustomcolumns
|
||
msgid "Configure custom columns"
|
||
msgstr "Настроить наборы колонок"
|
||
|
||
#: ulng.rsmenuconfigureentercustomcolumnname
|
||
msgid "Enter new custom columns name"
|
||
msgstr "Введите имя нового набора колонок"
|
||
|
||
#: ulng.rsmnuactions
|
||
msgctxt "ulng.rsmnuactions"
|
||
msgid "Actions"
|
||
msgstr "Команды"
|
||
|
||
#: ulng.rsmnucontentdefault
|
||
msgid "<Default>"
|
||
msgstr "<По умолчанию>"
|
||
|
||
#: ulng.rsmnucontentoctal
|
||
msgid "Octal"
|
||
msgstr "Восьмеричный"
|
||
|
||
#: ulng.rsmnucopynetnamestoclip
|
||
msgid "Copy names with UNC path"
|
||
msgstr "Копировать в буфер имена с UNC-путём"
|
||
|
||
#: ulng.rsmnudisconnectnetworkdrive
|
||
msgid "Disconnect Network Drive..."
|
||
msgstr "Отключить сетевой диск..."
|
||
|
||
#: ulng.rsmnuedit
|
||
msgctxt "ulng.rsmnuedit"
|
||
msgid "Edit"
|
||
msgstr "Редактировать"
|
||
|
||
#: ulng.rsmnueject
|
||
msgid "Eject"
|
||
msgstr "Извлечь"
|
||
|
||
#: ulng.rsmnuextracthere
|
||
msgid "Extract here..."
|
||
msgstr "Распаковать здесь..."
|
||
|
||
#: ulng.rsmnumapnetworkdrive
|
||
msgid "Map Network Drive..."
|
||
msgstr "Подключить сетевой диск..."
|
||
|
||
#: ulng.rsmnumount
|
||
msgid "Mount"
|
||
msgstr "Смонтировать"
|
||
|
||
#: ulng.rsmnunew
|
||
msgctxt "ulng.rsmnunew"
|
||
msgid "New"
|
||
msgstr "Создать"
|
||
|
||
#: ulng.rsmnunomedia
|
||
msgid "No media available"
|
||
msgstr "Устройство недоступно"
|
||
|
||
#: ulng.rsmnuopen
|
||
msgctxt "ulng.rsmnuopen"
|
||
msgid "Open"
|
||
msgstr "Открыть"
|
||
|
||
#: ulng.rsmnuopenwith
|
||
msgctxt "ulng.rsmnuopenwith"
|
||
msgid "Open with"
|
||
msgstr "Открыть с помощью"
|
||
|
||
#: ulng.rsmnuopenwithother
|
||
msgctxt "ulng.rsmnuopenwithother"
|
||
msgid "Other..."
|
||
msgstr "Другое..."
|
||
|
||
#: ulng.rsmnupackhere
|
||
msgid "Pack here..."
|
||
msgstr "Упаковать здесь..."
|
||
|
||
#: ulng.rsmnusortby
|
||
msgid "Sort by"
|
||
msgstr "Упор&ядочить по"
|
||
|
||
#: ulng.rsmnuumount
|
||
msgid "Unmount"
|
||
msgstr "Отмонтировать"
|
||
|
||
#: ulng.rsmnuview
|
||
msgctxt "ulng.rsmnuview"
|
||
msgid "View"
|
||
msgstr "Просмотреть"
|
||
|
||
#: ulng.rsmsgaccount
|
||
msgid "Account:"
|
||
msgstr "Учётная запись:"
|
||
|
||
#: ulng.rsmsgalldcintcmds
|
||
msgid "All Double Commander internal commands"
|
||
msgstr "Все внутренние команды Double Commander"
|
||
|
||
#: ulng.rsmsgapplicationname
|
||
msgid "Description: %s"
|
||
msgstr "Описание: %s"
|
||
|
||
#: ulng.rsmsgarchivercustomparams
|
||
msgid "Additional parameters for archiver command-line:"
|
||
msgstr "Дополнительные параметры командной строки архиватора:"
|
||
|
||
#: ulng.rsmsgaskquoteornot
|
||
msgid "Do you want to enclose between quotes?"
|
||
msgstr "Хотите взять в кавычки?"
|
||
|
||
#: ulng.rsmsgbadcrc32
|
||
msgid ""
|
||
"Bad CRC32 for resulting file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Do you want to keep the resulting corrupted file anyway?\n"
|
||
msgstr ""
|
||
"Неверная контрольная сумма файла назначения:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Хотите оставить повреждённый файл?\n"
|
||
|
||
#: ulng.rsmsgcannotcopymoveitself
|
||
msgid "You can not copy/move a file \"%s\" to itself!"
|
||
msgstr "Нельзя скопировать/переместить файл \"%s\" сам в себя!"
|
||
|
||
#: ulng.rsmsgcannotdeletedirectory
|
||
msgid "Cannot delete directory %s"
|
||
msgstr "Не удалось удалить каталог %s"
|
||
|
||
#: ulng.rsmsgcannotoverwritedirectory
|
||
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
||
msgstr "Невозможно перезаписать каталог \"%s\" файлом, не являющимся каталогом \"%s\""
|
||
|
||
#: ulng.rsmsgchdirfailed
|
||
msgid "Change current directory to \"%s\" failed!"
|
||
msgstr "Переход в каталог \"%s\" не удался!"
|
||
|
||
#: ulng.rsmsgcloseallinactivetabs
|
||
msgid "Remove all inactive tabs?"
|
||
msgstr "Закрыть все неактивные вкладки?"
|
||
|
||
#: ulng.rsmsgcloselockedtab
|
||
msgid "This tab (%s) is locked! Close anyway?"
|
||
msgstr "Вкладка (%s) заблокирована! Закрыть?"
|
||
|
||
#: ulng.rsmsgcofirmuserparam
|
||
msgid "Confirmation of parameter"
|
||
msgstr "Подтверждение параметра"
|
||
|
||
#: ulng.rsmsgconfirmquit
|
||
msgid "Are you sure you want to quit?"
|
||
msgstr "Вы уверены, что хотите выйти?"
|
||
|
||
#: ulng.rsmsgcopybackward
|
||
msgid "The file %s has changed. Do you want to copy it backward?"
|
||
msgstr "Файл %s изменён. Хотите скопировать его обратно?"
|
||
|
||
#: ulng.rsmsgcouldnotcopybackward
|
||
msgid "Could not copy backward - do you want to keep the changed file?"
|
||
msgstr "Не удалось скопировать обратно: хотите сохранить изменённый файл?"
|
||
|
||
#: ulng.rsmsgcpfldr
|
||
msgid "Copy %d selected files/directories?"
|
||
msgstr "Копировать выбранные файлы/каталоги (%d шт.)?"
|
||
|
||
#: ulng.rsmsgcpsel
|
||
msgid "Copy selected \"%s\"?"
|
||
msgstr "Копировать выбранный \"%s\"?"
|
||
|
||
#: ulng.rsmsgcreateanewfiletype
|
||
msgid "< Create a new file type \"%s files\" >"
|
||
msgstr "< Создать новый тип файла \"файлы %s\" >"
|
||
|
||
#: ulng.rsmsgdctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a DC Toolbar file"
|
||
msgstr "Укажите место и имя файла для сохранения файла панели инструментов DC"
|
||
|
||
#: ulng.rsmsgdefaultcustomactionname
|
||
msgid "Custom action"
|
||
msgstr "Пользовательское действие"
|
||
|
||
#: ulng.rsmsgdeletepartiallycopied
|
||
msgid "Delete the partially copied file ?"
|
||
msgstr "Удалить частично скопированный файл?"
|
||
|
||
#: ulng.rsmsgdelfldr
|
||
msgid "Delete %d selected files/directories?"
|
||
msgstr "Удалить %d выбранных файлов/каталогов?"
|
||
|
||
#: ulng.rsmsgdelfldrt
|
||
msgid "Delete %d selected files/directories into trash can?"
|
||
msgstr "Удалить %d выбранных файлов/каталогов в корзину?"
|
||
|
||
#: ulng.rsmsgdelsel
|
||
msgid "Delete selected \"%s\"?"
|
||
msgstr "Удалить выбранный \"%s\"?"
|
||
|
||
#: ulng.rsmsgdelselt
|
||
msgid "Delete selected \"%s\" into trash can?"
|
||
msgstr "Удалить выбранный \"%s\" в корзину?"
|
||
|
||
#: ulng.rsmsgdeltotrashforce
|
||
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
||
msgstr "Не удалось удалить \"%s\" в корзину! Удалить совсем?"
|
||
|
||
#: ulng.rsmsgdisknotavail
|
||
msgid "Disk is not available"
|
||
msgstr "Диск недоступен"
|
||
|
||
#: ulng.rsmsgentercustomaction
|
||
msgid "Enter custom action name:"
|
||
msgstr "Введите имя пользовательского действия:"
|
||
|
||
#: ulng.rsmsgenterfileext
|
||
msgid "Enter file extension:"
|
||
msgstr "Введите расширение:"
|
||
|
||
#: ulng.rsmsgentername
|
||
msgid "Enter name:"
|
||
msgstr "Введите имя:"
|
||
|
||
#: ulng.rsmsgenternewfiletypename
|
||
msgid "Enter name of new file type to create for extension \"%s\""
|
||
msgstr "Введите имя нового типа файлов для расширения \"%s\""
|
||
|
||
#: ulng.rsmsgerrbadarchive
|
||
msgid "CRC error in archive data"
|
||
msgstr "Контрольная сумма не совпадает, архив повреждён."
|
||
|
||
#: ulng.rsmsgerrbaddata
|
||
msgid "Data is bad"
|
||
msgstr "Данные повреждены"
|
||
|
||
#: ulng.rsmsgerrcannotconnect
|
||
msgid "Can not connect to server: \"%s\""
|
||
msgstr "Не удалось соединиться с сервером: \"%s\""
|
||
|
||
#: ulng.rsmsgerrcannotcopyfile
|
||
msgid "Cannot copy file %s to %s"
|
||
msgstr "Не удалось скопировать файл из %s в %s"
|
||
|
||
#: ulng.rsmsgerrcreatefiledirectoryexists
|
||
msgid "There already exists a directory named \"%s\"."
|
||
msgstr "Уже существует каталог с именем \"%s\"."
|
||
|
||
#: ulng.rsmsgerrdatenotsupported
|
||
msgid "Date %s is not supported"
|
||
msgstr "Дата %s не поддерживается"
|
||
|
||
#: ulng.rsmsgerrdirexists
|
||
msgid "Directory %s exists!"
|
||
msgstr "Каталог %s существует!"
|
||
|
||
#: ulng.rsmsgerreaborted
|
||
msgid "Function aborted by user"
|
||
msgstr "Прервано пользователем."
|
||
|
||
#: ulng.rsmsgerreclose
|
||
msgid "Error closing file"
|
||
msgstr "Ошибка закрытия файла"
|
||
|
||
#: ulng.rsmsgerrecreate
|
||
msgid "Cannot create file"
|
||
msgstr "Не удалось создать файл"
|
||
|
||
#: ulng.rsmsgerrendarchive
|
||
msgid "No more files in archive"
|
||
msgstr "В архиве нет больше файлов"
|
||
|
||
#: ulng.rsmsgerreopen
|
||
msgid "Cannot open existing file"
|
||
msgstr "Не удалось открыть существующий файл"
|
||
|
||
#: ulng.rsmsgerreread
|
||
msgid "Error reading from file"
|
||
msgstr "Ошибка чтения из файла"
|
||
|
||
#: ulng.rsmsgerrewrite
|
||
msgid "Error writing to file"
|
||
msgstr "Ошибка записи в файл"
|
||
|
||
#: ulng.rsmsgerrforcedir
|
||
msgid "Can not create directory %s!"
|
||
msgstr "Не удалось создать каталог %s!"
|
||
|
||
#: ulng.rsmsgerrinvalidlink
|
||
msgid "Invalid link"
|
||
msgstr "Некорректная ссылка"
|
||
|
||
#: ulng.rsmsgerrnofiles
|
||
msgid "No files found"
|
||
msgstr "Файлы не найдены"
|
||
|
||
#: ulng.rsmsgerrnomemory
|
||
msgid "Not enough memory"
|
||
msgstr "Недостаточно памяти"
|
||
|
||
#: ulng.rsmsgerrnotsupported
|
||
msgid "Function not supported!"
|
||
msgstr "Функция не поддерживается!"
|
||
|
||
#: ulng.rsmsgerrorincontextmenucommand
|
||
msgid "Error in context menu command"
|
||
msgstr "Ошибка в команде контекстного меню"
|
||
|
||
#: ulng.rsmsgerrorloadingconfiguration
|
||
msgid "Error when loading configuration"
|
||
msgstr "Ошибка при загрузке конфигурации"
|
||
|
||
#: ulng.rsmsgerrregexpsyntax
|
||
msgid "Syntax error in regular expression!"
|
||
msgstr "Ошибка синтаксиса в регулярном выражении!"
|
||
|
||
#: ulng.rsmsgerrrename
|
||
msgid "Cannot rename file %s to %s"
|
||
msgstr "Не удалось переименовать файл %s в %s"
|
||
|
||
#: ulng.rsmsgerrsaveassociation
|
||
msgid "Can not save association!"
|
||
msgstr "Не удалось сохранить ассоциацию!"
|
||
|
||
#: ulng.rsmsgerrsavefile
|
||
msgid "Cannot save file"
|
||
msgstr "Не удалось сохранить файл"
|
||
|
||
#: ulng.rsmsgerrsetattribute
|
||
msgid "Can not set attributes for \"%s\""
|
||
msgstr "Не удалось установить атрибуты для \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetdatetime
|
||
msgid "Can not set date/time for \"%s\""
|
||
msgstr "Не удалось установить дату/время для \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetownership
|
||
msgid "Can not set owner/group for \"%s\""
|
||
msgstr "Не удалось установить владельца/группу для \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetpermissions
|
||
msgid "Can not set permissions for \"%s\""
|
||
msgstr "Не удалось установить права доступа для \"%s\""
|
||
|
||
#: ulng.rsmsgerrsmallbuf
|
||
msgid "Buffer too small"
|
||
msgstr "Буфер слишком маленький"
|
||
|
||
#: ulng.rsmsgerrtoomanyfiles
|
||
msgid "Too many files to pack"
|
||
msgstr "Слишком много файлов"
|
||
|
||
#: ulng.rsmsgerrunknownformat
|
||
msgid "Archive format unknown"
|
||
msgstr "Архив повреждён или имеет неизвестный формат."
|
||
|
||
#: ulng.rsmsgexecutablepath
|
||
msgid "Executable: %s"
|
||
msgstr "Путь: %s"
|
||
|
||
#: ulng.rsmsgfavoritetabsdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
||
msgstr "Вы уверены, что хотите удалить все ваши избранные вкладки? (Нельзя будет отменить!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsdraghereentry
|
||
msgid "Drag here other entries"
|
||
msgstr "Перетащите сюда другие записи"
|
||
|
||
#: ulng.rsmsgfavoritetabsentername
|
||
msgid "Enter a name for this new Favorite Tabs entry:"
|
||
msgstr "Введите имя новых избранных вкладок:"
|
||
|
||
#: ulng.rsmsgfavoritetabsenternametitle
|
||
msgid "Saving a new Favorite Tabs entry"
|
||
msgstr "Сохранение новых избранных вкладок"
|
||
|
||
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
||
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
||
msgstr "Количество успешно экспортированных избранных вкладок: %d из %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsextramode
|
||
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
||
msgstr "Сохранять историю каталогов для новых избранных вкладок:"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
||
msgid "Number of file(s) imported successfully: %d on %d"
|
||
msgstr "Количество успешно импортированных файлов: %d из %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
||
msgid "Legacy tabs imported"
|
||
msgstr "Импортированные вкладки"
|
||
|
||
#: ulng.rsmsgfavoritetabsimporttitle
|
||
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
||
msgstr "Выделите TAB-файл(ы) для импорта (можно больше одного за раз!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
||
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
||
msgstr "Последнее изменение избранных вкладок ещё не сохранено. Хотите сохранить их перед тем как продолжить?"
|
||
|
||
#: ulng.rsmsgfavoritetabssimplemode
|
||
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "Сохранять историю каталогов для избранных вкладок:"
|
||
|
||
#: ulng.rsmsgfavoritetabssubmenuname
|
||
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Подменю"
|
||
|
||
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
||
msgid "This will load the Favorite Tabs: \"%s\""
|
||
msgstr "Будут загружены избранные вкладки: \"%s\""
|
||
|
||
#: ulng.rsmsgfavortietabssaveoverexisting
|
||
msgid "Save current tabs over existing Favorite Tabs entry"
|
||
msgstr "Сохранить текущие вкладки поверх существующих избранных вкладок"
|
||
|
||
#: ulng.rsmsgfilechangedsave
|
||
msgid "File %s changed, save?"
|
||
msgstr "Файл %s изменён, сохранить?"
|
||
|
||
#: ulng.rsmsgfileexistsfileinfo
|
||
msgid "%s bytes, %s"
|
||
msgstr "%s байт, %s"
|
||
|
||
#: ulng.rsmsgfileexistsoverwrite
|
||
msgid "Overwrite:"
|
||
msgstr "Заменить:"
|
||
|
||
#: ulng.rsmsgfileexistsrwrt
|
||
msgid "File %s exists, overwrite?"
|
||
msgstr "Файл %s существует, переписать?"
|
||
|
||
#: ulng.rsmsgfileexistswithfile
|
||
msgid "With file:"
|
||
msgstr "файлом:"
|
||
|
||
#: ulng.rsmsgfilenotfound
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Файл \"%s\" не найден."
|
||
|
||
#: ulng.rsmsgfileoperationsactive
|
||
msgid "File operations active"
|
||
msgstr "Активные файловые операции"
|
||
|
||
#: ulng.rsmsgfileoperationsactivelong
|
||
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
||
msgstr "Некоторые операции ещё не завершены. Закрытие Double Commander может привести к потере данных."
|
||
|
||
#: ulng.rsmsgfilepathovermaxpath
|
||
msgid ""
|
||
"The target name length (%d) is more than %d characters!\n"
|
||
"%s\n"
|
||
"Most programs will not be able to access a file/directory with such a long name!\n"
|
||
msgstr ""
|
||
"Длина целевого пути (%d) превышает %d символов!\n"
|
||
"%s\n"
|
||
"Большинство программ не смогут обратиться к файлу/каталогу с таким длинным именем!\n"
|
||
|
||
#: ulng.rsmsgfilereadonly
|
||
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
||
msgstr "Файл %s помечен как доступный только для чтения/скрытый/системный. Удалить?"
|
||
|
||
#: ulng.rsmsgfilereloadwarning
|
||
msgid "Are you sure you want to reload the current file and lose the changes?"
|
||
msgstr ""
|
||
"Все внесённые изменения будут потеряны!\n"
|
||
"Продолжить?\n"
|
||
|
||
#: ulng.rsmsgfilesizetoobig
|
||
msgid "The file size of \"%s\" is too big for destination file system!"
|
||
msgstr "Размер файла \"%s\" слишком большой для файловой системы получателя!"
|
||
|
||
#: ulng.rsmsgfolderexistsrwrt
|
||
msgid "Folder %s exists, merge?"
|
||
msgstr "Каталог %s существует, объединить?"
|
||
|
||
#: ulng.rsmsgfollowsymlink
|
||
msgid "Follow symlink \"%s\"?"
|
||
msgstr "Следовать ссылке \"%s\"?"
|
||
|
||
#: ulng.rsmsgfortextformattoimport
|
||
msgid "Select the text format to import"
|
||
msgstr "Выберите формат текста для импорта"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectories
|
||
msgid "Add %d selected dirs"
|
||
msgstr "Добавить %d выделенных каталога(ов)"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectory
|
||
msgid "Add selected dir: "
|
||
msgstr "Добавить выделенный: "
|
||
|
||
#: ulng.rsmsghotdiraddthisdirectory
|
||
msgid "Add current dir: "
|
||
msgstr "Добавить текущий: "
|
||
|
||
#: ulng.rsmsghotdircommandname
|
||
msgid "Do command"
|
||
msgstr "Выполнить команду"
|
||
|
||
#: ulng.rsmsghotdircommandsample
|
||
msgid "cm_somthing"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsghotdirconfighotlist
|
||
msgctxt "ulng.rsmsghotdirconfighotlist"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Настройка избранных каталогов"
|
||
|
||
#: ulng.rsmsghotdirdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
||
msgstr "Вы уверены, что хотите удалить все ваши избранные каталоги? (Нельзя будет отменить!)"
|
||
|
||
#: ulng.rsmsghotdirdemocommand
|
||
msgid "This will execute the following command:"
|
||
msgstr "Это запустит следующую команду:"
|
||
|
||
#: ulng.rsmsghotdirdemoname
|
||
msgid "This is hot dir named "
|
||
msgstr "Это избранный каталог по имени "
|
||
|
||
#: ulng.rsmsghotdirdemopath
|
||
msgid "This will change active frame to the following path:"
|
||
msgstr "Это изменит активную панель на следующий путь:"
|
||
|
||
#: ulng.rsmsghotdirdemotarget
|
||
msgid "And inactive frame would change to the following path:"
|
||
msgstr "И изменит неактивную панель на следующий путь:"
|
||
|
||
#: ulng.rsmsghotdirerrorbackuping
|
||
msgid "Error backuping entries..."
|
||
msgstr "Ошибка создания резервной копии..."
|
||
|
||
#: ulng.rsmsghotdirerrorexporting
|
||
msgid "Error exporting entries..."
|
||
msgstr "Ошибка экспорта объектов..."
|
||
|
||
#: ulng.rsmsghotdirexportall
|
||
msgid "Export all!"
|
||
msgstr "Экспортировать все"
|
||
|
||
#: ulng.rsmsghotdirexporthotlist
|
||
msgid "Export Directory Hotlist - Select the entries you want to export"
|
||
msgstr "Экспорт избранных каталогов - Выделите объекты, которые хотите экспортировать"
|
||
|
||
#: ulng.rsmsghotdirexportsel
|
||
msgid "Export selected"
|
||
msgstr "Только выделенные"
|
||
|
||
#: ulng.rsmsghotdirimportall
|
||
msgctxt "ulng.rsmsghotdirimportall"
|
||
msgid "Import all!"
|
||
msgstr "Импортировать все"
|
||
|
||
#: ulng.rsmsghotdirimporthotlist
|
||
msgid "Import Directory Hotlist - Select the entries you want to import"
|
||
msgstr "Импорт избранных каталогов - Выделите объекты, которые хотите импортировать"
|
||
|
||
#: ulng.rsmsghotdirimportsel
|
||
msgctxt "ulng.rsmsghotdirimportsel"
|
||
msgid "Import selected"
|
||
msgstr "Только выделенные"
|
||
|
||
#: ulng.rsmsghotdirjustpath
|
||
msgctxt "ulng.rsmsghotdirjustpath"
|
||
msgid "&Path:"
|
||
msgstr "Пут&ь:"
|
||
|
||
#: ulng.rsmsghotdirlocatehotlistfile
|
||
msgid "Locate \".hotlist\" file to import"
|
||
msgstr "Укажите файл \".hotlist\" для импорта"
|
||
|
||
#: ulng.rsmsghotdirname
|
||
msgid "Hotdir name"
|
||
msgstr "Имя записи"
|
||
|
||
#: ulng.rsmsghotdirnbnewentries
|
||
msgid "Number of new entries: %d"
|
||
msgstr "Число новых записей: %d"
|
||
|
||
#: ulng.rsmsghotdirnothingtoexport
|
||
msgid "Nothing selected to export!"
|
||
msgstr "Ничего не выбрано для экспорта!"
|
||
|
||
#: ulng.rsmsghotdirpath
|
||
msgid "Hotdir path"
|
||
msgstr "Путь избранного каталога"
|
||
|
||
#: ulng.rsmsghotdirreaddselecteddirectory
|
||
msgid "Re-Add selected dir: "
|
||
msgstr "Снова добавить выбранный: "
|
||
|
||
#: ulng.rsmsghotdirreaddthisdirectory
|
||
msgid "Re-Add current dir: "
|
||
msgstr "Снова добавить текущий: "
|
||
|
||
#: ulng.rsmsghotdirrestorewhat
|
||
msgid "Enter location and filename of Directory Hotlist to restore"
|
||
msgstr "Укажите место и имя файла избранных каталогов для восстановления"
|
||
|
||
#: ulng.rsmsghotdirsimplecommand
|
||
msgctxt "ulng.rsmsghotdirsimplecommand"
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: ulng.rsmsghotdirsimpleendofmenu
|
||
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
||
msgid "(end of sub menu)"
|
||
msgstr "(конец подменю)"
|
||
|
||
#: ulng.rsmsghotdirsimplemenu
|
||
msgctxt "ulng.rsmsghotdirsimplemenu"
|
||
msgid "Menu &name:"
|
||
msgstr "Имя &меню:"
|
||
|
||
#: ulng.rsmsghotdirsimplename
|
||
msgctxt "ulng.rsmsghotdirsimplename"
|
||
msgid "&Name:"
|
||
msgstr "И&мя:"
|
||
|
||
#: ulng.rsmsghotdirsimpleseparator
|
||
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
||
msgid "(separator)"
|
||
msgstr "(разделитель)"
|
||
|
||
#: ulng.rsmsghotdirsubmenuname
|
||
msgctxt "ulng.rsmsghotdirsubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Подменю"
|
||
|
||
#: ulng.rsmsghotdirtarget
|
||
msgid "Hotdir target"
|
||
msgstr "Путь избранного целевого каталога"
|
||
|
||
#: ulng.rsmsghotdirtiporderpath
|
||
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Задаёт порядок сортировки в активной панели после смены каталога"
|
||
|
||
#: ulng.rsmsghotdirtipordertarget
|
||
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Задаёт порядок сортировки в неактивной панели после смены каталога"
|
||
|
||
#: ulng.rsmsghotdirtipspecialdirbut
|
||
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
||
msgstr "Некоторые функции для выбора пути - относительный, абсолютный, спец. папки Windows, и т.д."
|
||
|
||
#: ulng.rsmsghotdirtotalbackuped
|
||
msgid ""
|
||
"Total entries saved: %d\n"
|
||
"\n"
|
||
"Backup filename: %s\n"
|
||
msgstr ""
|
||
"Всего объектов сохранено: %d\n"
|
||
"\n"
|
||
"Резервная копия: %s\n"
|
||
|
||
#: ulng.rsmsghotdirtotalexported
|
||
msgid "Total entries exported: "
|
||
msgstr "Всего объектов экспортировано: "
|
||
|
||
#: ulng.rsmsghotdirwhattodelete
|
||
msgid ""
|
||
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
||
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
||
msgstr ""
|
||
"Вы хотите удалить все элементы внутри подменю [%s]?\n"
|
||
"Ответ НЕТ удалит только разделители меню и оставит элементы внутри подменю.\n"
|
||
|
||
#: ulng.rsmsghotdirwheretosave
|
||
msgid "Enter location and filename where to save a Directory Hotlist file"
|
||
msgstr "Укажите место и имя для сохранения файла избранных каталогов"
|
||
|
||
#: ulng.rsmsgincorrectfilelength
|
||
msgid "Incorrect resulting filelength for file : \"%s\""
|
||
msgstr "Неверная длина файла назначения для файла : \"%s\""
|
||
|
||
#: ulng.rsmsginsertnextdisk
|
||
msgid ""
|
||
"Please insert next disk or something similar.\n"
|
||
"\n"
|
||
"It is to allow writing this file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Number of bytes still to write: %d\n"
|
||
msgstr ""
|
||
"Пожалуйста, вставьте следующий диск или другой носитель.\n"
|
||
"\n"
|
||
"Это позволит записать файл:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Число оставшихся для записи байт: %d\n"
|
||
|
||
#: ulng.rsmsginvalidcommandline
|
||
msgid "Error in command line"
|
||
msgstr "Ошибка в командной строке"
|
||
|
||
#: ulng.rsmsginvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Некорректное имя файла"
|
||
|
||
#: ulng.rsmsginvalidformatofconfigurationfile
|
||
msgid "Invalid format of configuration file"
|
||
msgstr "Неверный формат файла конфигурации"
|
||
|
||
#: ulng.rsmsginvalidhexnumber
|
||
msgid "Invalid hexadecimal number: \"%s\""
|
||
msgstr "Недопустимое шестнадцатеричное число: \"%s\""
|
||
|
||
#: ulng.rsmsginvalidpath
|
||
msgid "Invalid path"
|
||
msgstr "Некорректный путь"
|
||
|
||
#: ulng.rsmsginvalidpathlong
|
||
msgid "Path %s contains forbidden characters."
|
||
msgstr "Путь %s содержит запрещённые символы"
|
||
|
||
#: ulng.rsmsginvalidplugin
|
||
msgid "This is not a valid plugin!"
|
||
msgstr "Этот файл не является корректным плагином!"
|
||
|
||
#: ulng.rsmsginvalidpluginarchitecture
|
||
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
||
msgstr "Этот плагин собран для Double Commander для %s.%sОн не может работать с Double Commander для %s!"
|
||
|
||
#: ulng.rsmsginvalidquoting
|
||
msgid "Invalid quoting"
|
||
msgstr "Неправильное использование кавычек"
|
||
|
||
#: ulng.rsmsginvalidselection
|
||
msgid "Invalid selection."
|
||
msgstr "Некорректное выделение."
|
||
|
||
#: ulng.rsmsgloadingfilelist
|
||
msgid "Loading file list..."
|
||
msgstr "Загрузка списка файлов..."
|
||
|
||
#: ulng.rsmsglocatetcconfiguation
|
||
msgid "Locate TC configuration file (wincmd.ini)"
|
||
msgstr "Укажите файл конфигурации TC (wincmd.ini)"
|
||
|
||
#: ulng.rsmsglocatetcexecutable
|
||
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
||
msgstr "Укажите исполняемый файл TC (totalcmd.exe или totalcmd64.exe)"
|
||
|
||
#: ulng.rsmsglogcopy
|
||
msgid "Copy file %s"
|
||
msgstr "Копирование файла %s"
|
||
|
||
#: ulng.rsmsglogdelete
|
||
msgid "Delete file %s"
|
||
msgstr "Удаление файла %s"
|
||
|
||
#: ulng.rsmsglogerror
|
||
msgid "Error: "
|
||
msgstr "Ошибка: "
|
||
|
||
#: ulng.rsmsglogextcmdlaunch
|
||
msgid "Launch external"
|
||
msgstr "Запуск внешней команды"
|
||
|
||
#: ulng.rsmsglogextcmdresult
|
||
msgid "Result external"
|
||
msgstr "Результат внешней команды"
|
||
|
||
#: ulng.rsmsglogextract
|
||
msgid "Extract file %s"
|
||
msgstr "Распаковка файла %s"
|
||
|
||
#: ulng.rsmsgloginfo
|
||
msgid "Info: "
|
||
msgstr "Информация: "
|
||
|
||
#: ulng.rsmsgloglink
|
||
msgid "Create link %s"
|
||
msgstr "Создание ссылки %s"
|
||
|
||
#: ulng.rsmsglogmkdir
|
||
msgid "Create directory %s"
|
||
msgstr "Создание каталога %s"
|
||
|
||
#: ulng.rsmsglogmove
|
||
msgid "Move file %s"
|
||
msgstr "Перемещение файла %s"
|
||
|
||
#: ulng.rsmsglogpack
|
||
msgid "Pack to file %s"
|
||
msgstr "Упаковка в файл %s"
|
||
|
||
#: ulng.rsmsglogrmdir
|
||
msgid "Remove directory %s"
|
||
msgstr "Удаление каталога %s"
|
||
|
||
#: ulng.rsmsglogsuccess
|
||
msgid "Done: "
|
||
msgstr "Выполнено: "
|
||
|
||
#: ulng.rsmsglogsymlink
|
||
msgid "Create symlink %s"
|
||
msgstr "Создание символьной ссылки %s"
|
||
|
||
#: ulng.rsmsglogtest
|
||
msgid "Test file integrity %s"
|
||
msgstr "Проверка целостности файла %s"
|
||
|
||
#: ulng.rsmsglogwipe
|
||
msgid "Wipe file %s"
|
||
msgstr "Стирание файла %s"
|
||
|
||
#: ulng.rsmsglogwipedir
|
||
msgid "Wipe directory %s"
|
||
msgstr "Стирание каталога %s"
|
||
|
||
#: ulng.rsmsgmasterpassword
|
||
msgid "Master Password"
|
||
msgstr "Главный пароль:"
|
||
|
||
#: ulng.rsmsgmasterpasswordenter
|
||
msgid "Please enter the master password:"
|
||
msgstr "Введите главный пароль:"
|
||
|
||
#: ulng.rsmsgnewfile
|
||
msgid "New file"
|
||
msgstr "Новый файл"
|
||
|
||
#: ulng.rsmsgnextvolunpack
|
||
msgid "Next volume will be unpacked"
|
||
msgstr "Следующий том будет распакован"
|
||
|
||
#: ulng.rsmsgnofiles
|
||
msgid "No files"
|
||
msgstr "Нет файлов"
|
||
|
||
#: ulng.rsmsgnofilesselected
|
||
msgid "No files selected."
|
||
msgstr "Нет выделенных файлов."
|
||
|
||
#: ulng.rsmsgnofreespacecont
|
||
msgid "No enough free space on target drive, Continue?"
|
||
msgstr "Недостаточно места на получателе. Продолжить?"
|
||
|
||
#: ulng.rsmsgnofreespaceretry
|
||
msgid "No enough free space on target drive, Retry?"
|
||
msgstr "Недостаточно места на получателе. Повторить?"
|
||
|
||
#: ulng.rsmsgnotdelete
|
||
msgid "Can not delete file %s"
|
||
msgstr "Не удалось удалить файл %s"
|
||
|
||
#: ulng.rsmsgnotimplemented
|
||
msgid "Not implemented."
|
||
msgstr "Не реализовано."
|
||
|
||
#: ulng.rsmsgobjectnotexists
|
||
msgid "Object does not exist!"
|
||
msgstr "Объект не существует!"
|
||
|
||
#: ulng.rsmsgopeninanotherprogram
|
||
msgid "The action cannot be completed because the file is open in another program:"
|
||
msgstr "Действие не может быть выполнено, так как этот файл открыт в другой программе:"
|
||
|
||
#: ulng.rsmsgpanelpreview
|
||
msgctxt "ulng.rsmsgpanelpreview"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Ниже находится предварительный просмотр. Вы можете перемещать курсор и выбирать файлы, чтобы получить полное представление о выбранных настройках."
|
||
|
||
#: ulng.rsmsgpassword
|
||
msgid "Password:"
|
||
msgstr "Пароль:"
|
||
|
||
#: ulng.rsmsgpassworddiff
|
||
msgid "Passwords are different!"
|
||
msgstr "Пароли отличаются!"
|
||
|
||
#: ulng.rsmsgpasswordenter
|
||
msgid "Please enter the password:"
|
||
msgstr "Введите пароль:"
|
||
|
||
#: ulng.rsmsgpasswordfirewall
|
||
msgid "Password (Firewall):"
|
||
msgstr "Пароль (Firewall):"
|
||
|
||
#: ulng.rsmsgpasswordverify
|
||
msgid "Please re-enter the password for verification:"
|
||
msgstr "Повторите ввод пароля:"
|
||
|
||
#: ulng.rsmsgpopuphotdelete
|
||
msgid "&Delete %s"
|
||
msgstr "&Удалить %s"
|
||
|
||
#: ulng.rsmsgpresetalreadyexists
|
||
msgid "Preset \"%s\" already exists. Overwrite?"
|
||
msgstr "Шаблон \"%s\" существует. Перезаписать?"
|
||
|
||
#: ulng.rsmsgproblemexecutingcommand
|
||
msgid "Problem executing command (%s)"
|
||
msgstr "Проблема выполнения команды (%s)"
|
||
|
||
#: ulng.rsmsgprocessid
|
||
msgid "PID: %d"
|
||
msgstr "ИД процесса: %d"
|
||
|
||
#: ulng.rsmsgpromptaskingfilename
|
||
msgid "Filename for dropped text:"
|
||
msgstr "Имя файла для перетаскиваемого текста:"
|
||
|
||
#: ulng.rsmsgprovidethisfile
|
||
msgid "Please, make this file available. Retry?"
|
||
msgstr "Пожалуйста, сделайте этот файл доступным. Повторить?"
|
||
|
||
#: ulng.rsmsgrenamefavtabs
|
||
msgid "Enter new friendly name for this Favorite Tabs"
|
||
msgstr "Введите новое имя для этих избранных вкладок"
|
||
|
||
#: ulng.rsmsgrenamefavtabsmenu
|
||
msgid "Enter new name for this menu"
|
||
msgstr "Введите новое имя для этого меню"
|
||
|
||
#: ulng.rsmsgrenfldr
|
||
msgid "Rename/move %d selected files/directories?"
|
||
msgstr "Переименовать/переместить %d выбранных файлов/каталогов?"
|
||
|
||
#: ulng.rsmsgrensel
|
||
msgid "Rename/move selected \"%s\"?"
|
||
msgstr "Переименовать/переместить выбранный \"%s\"?"
|
||
|
||
#: ulng.rsmsgreplacethistext
|
||
msgid "Do you want to replace this text?"
|
||
msgstr "Заменить этот текст?"
|
||
|
||
#: ulng.rsmsgrestartforapplychanges
|
||
msgid "Please, restart Double Commander in order to apply changes"
|
||
msgstr "Перезапустите Double Commander для применения изменений"
|
||
|
||
#: ulng.rsmsgsekectfiletype
|
||
msgid "Select to which file type to add extension \"%s\""
|
||
msgstr "Выберите тип файла для добавления расширения \"%s\""
|
||
|
||
#: ulng.rsmsgselectedinfo
|
||
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
||
msgstr "Выделено: %s из %s, файлов: %d из %d, каталогов: %d из %d"
|
||
|
||
#: ulng.rsmsgselectexecutablefile
|
||
msgid "Select executable file for"
|
||
msgstr "Выберите исполняемый файл"
|
||
|
||
#: ulng.rsmsgselectonlychecksumfiles
|
||
msgid "Please select only checksum files!"
|
||
msgstr "Пожалуйста, выберите только файлы контрольных сумм!"
|
||
|
||
#: ulng.rsmsgsellocnextvol
|
||
msgid "Please select location of next volume"
|
||
msgstr "Укажите путь к следующему тому"
|
||
|
||
#: ulng.rsmsgsetvolumelabel
|
||
msgid "Set volume label"
|
||
msgstr "Изменение метки диска"
|
||
|
||
#: ulng.rsmsgspecialdir
|
||
msgid "Special Dirs"
|
||
msgstr "Специальные каталоги"
|
||
|
||
#: ulng.rsmsgspecialdiraddacti
|
||
msgid "Add path from active frame"
|
||
msgstr "Добавить путь из активной панели"
|
||
|
||
#: ulng.rsmsgspecialdiraddnonacti
|
||
msgid "Add path from inactive frame"
|
||
msgstr "Добавить путь из неактивной панели"
|
||
|
||
#: ulng.rsmsgspecialdirbrowssel
|
||
msgid "Browse and use selected path"
|
||
msgstr "Диалог выбора каталога"
|
||
|
||
#: ulng.rsmsgspecialdirenvvar
|
||
msgid "Use environment variable..."
|
||
msgstr "Использовать переменную окружения..."
|
||
|
||
#: ulng.rsmsgspecialdirgotodc
|
||
msgid "Go to Double Commander special path..."
|
||
msgstr "Каталог Double Commander..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoenvvar
|
||
msgid "Go to environment variable..."
|
||
msgstr "Переменная окружения..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoother
|
||
msgid "Go to other Windows special folder..."
|
||
msgstr "Другая специальная папка Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirgototc
|
||
msgid "Go to Windows special folder (TC)..."
|
||
msgstr "Специальная папка Windows (TC)..."
|
||
|
||
#: ulng.rsmsgspecialdirmakereltohotdir
|
||
msgid "Make relative to hotdir path"
|
||
msgstr "Сделать относительным к пути из избранных каталогов"
|
||
|
||
#: ulng.rsmsgspecialdirmkabso
|
||
msgid "Make path absolute"
|
||
msgstr "Сделать путь абсолютным"
|
||
|
||
#: ulng.rsmsgspecialdirmkdcrel
|
||
msgid "Make relative to Double Commander special path..."
|
||
msgstr "Сделать относительным к спец. папке DC..."
|
||
|
||
#: ulng.rsmsgspecialdirmkenvrel
|
||
msgid "Make relative to environment variable..."
|
||
msgstr "Сделать относительным к переменной окружения..."
|
||
|
||
#: ulng.rsmsgspecialdirmktctel
|
||
msgid "Make relative to Windows special folder (TC)..."
|
||
msgstr "Сделать относительным к спец. папке Windows (TC)..."
|
||
|
||
#: ulng.rsmsgspecialdirmkwnrel
|
||
msgid "Make relative to other Windows special folder..."
|
||
msgstr "Сделать относительным к другой спец. папке Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusedc
|
||
msgid "Use Double Commander special path..."
|
||
msgstr "Использовать специальные пути DC..."
|
||
|
||
#: ulng.rsmsgspecialdirusehotdir
|
||
msgid "Use hotdir path"
|
||
msgstr "Использовать путь из избранных каталогов"
|
||
|
||
#: ulng.rsmsgspecialdiruseother
|
||
msgid "Use other Windows special folder..."
|
||
msgstr "Использовать другую специальную папку Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusetc
|
||
msgid "Use Windows special folder (TC)..."
|
||
msgstr "Использовать специальную папку Windows (TC)..."
|
||
|
||
#: ulng.rsmsgtabforopeninginnewtab
|
||
msgid "This tab (%s) is locked! Open directory in another tab?"
|
||
msgstr "Вкладка (%s) заблокирована! Открыть каталог в другой вкладке?"
|
||
|
||
#: ulng.rsmsgtabrenamecaption
|
||
msgid "Rename tab"
|
||
msgstr "Переименовать вкладку"
|
||
|
||
#: ulng.rsmsgtabrenameprompt
|
||
msgid "New tab name:"
|
||
msgstr "Новое имя вкладки:"
|
||
|
||
#: ulng.rsmsgtargetdir
|
||
msgid "Target path:"
|
||
msgstr "Целевой путь:"
|
||
|
||
#: ulng.rsmsgtcconfignotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration file:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Ошибка! Не удалось найти файл конфигурации TC:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcexecutablenotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration executable:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Ошибка! Не удалось найти исполняемый файл TC:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcisrunning
|
||
msgid ""
|
||
"Error! TC is still running but it should be closed for this operation.\n"
|
||
"Close it and press OK or press CANCEL to abort.\n"
|
||
msgstr ""
|
||
"Ошибка! TC всё ещё запущен, но для этой операции он должен быть закрыт.\n"
|
||
"Закройте его и нажмите OK или нажмите ОТМЕНА для прекращения.\n"
|
||
|
||
#: ulng.rsmsgtctoolbarnotfound
|
||
msgid ""
|
||
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Ошибка! Не удалось найти каталог с панелями инструментов TC:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a TC Toolbar file"
|
||
msgstr "Укажите место и имя для сохранения файла панели инструментов TC"
|
||
|
||
#: ulng.rsmsgterminateprocess
|
||
msgid "WARNING: Terminating a process can cause undesired results including loss of data and system instability. The process will not be given the chance to save its state or data before it is terminated. Are you sure you want to terminate the process?"
|
||
msgstr "ВНИМАНИЕ! Завершение процесса может привести к нежелательным результатам, в том числе к потере данных или к нестабильной работе системы. Вы действительно хотите завершить процесс?"
|
||
|
||
#: ulng.rsmsgthisisnowinclipboard
|
||
msgid "\"%s\" is now in the clipboard"
|
||
msgstr "В буфер обмена скопировано: \"%s\""
|
||
|
||
#: ulng.rsmsgtitleextnotinfiletype
|
||
msgid "Extension of selected file is not in any recognized file types"
|
||
msgstr "Расширение выделенного файла отсутствует в каких-либо типах файлов"
|
||
|
||
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
||
msgid "Locate \".toolbar\" file to import"
|
||
msgstr "Укажите файл \".toolbar\" для импорта"
|
||
|
||
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
||
msgid "Locate \".BAR\" file to import"
|
||
msgstr "Укажите файл \".BAR\" для импорта"
|
||
|
||
#: ulng.rsmsgtoolbarrestorewhat
|
||
msgid "Enter location and filename of Toolbar to restore"
|
||
msgstr "Укажите место и имя файла панели инструментов для восстановления"
|
||
|
||
#: ulng.rsmsgtoolbarsaved
|
||
msgid ""
|
||
"Saved!\n"
|
||
"Toolbar filename: %s\n"
|
||
msgstr ""
|
||
"Сохранено!\n"
|
||
"Имя файла панели инструментов: %s\n"
|
||
|
||
#: ulng.rsmsgtoomanyfilesselected
|
||
msgid "Too many files selected."
|
||
msgstr "Выделено слишком много файлов"
|
||
|
||
#: ulng.rsmsgundeterminednumberoffile
|
||
msgid "Undetermined"
|
||
msgstr "Неопределённый"
|
||
|
||
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
||
msgid "ERROR: Unexpected Tree View Menu usage!"
|
||
msgstr "ОШИБКА: Неожиданное использование древовидного меню!"
|
||
|
||
#: ulng.rsmsgurl
|
||
msgid "URL:"
|
||
msgstr "URL:"
|
||
|
||
#: ulng.rsmsguserdidnotsetextension
|
||
msgid "<NO EXT>"
|
||
msgstr "<БЕЗ ТИПА>"
|
||
|
||
#: ulng.rsmsguserdidnotsetname
|
||
msgid "<NO NAME>"
|
||
msgstr "<БЕЗ ИМЕНИ>"
|
||
|
||
#: ulng.rsmsgusername
|
||
msgid "User name:"
|
||
msgstr "Имя пользователя:"
|
||
|
||
#: ulng.rsmsgusernamefirewall
|
||
msgid "User name (Firewall):"
|
||
msgstr "Имя пользователя (Firewall):"
|
||
|
||
#: ulng.rsmsgverify
|
||
msgid "VERIFICATION:"
|
||
msgstr "ПРОВЕРКА:"
|
||
|
||
#: ulng.rsmsgverifychecksum
|
||
msgid "Do you want to verify selected checksums?"
|
||
msgstr "Проверить выбранные контрольные суммы?"
|
||
|
||
#: ulng.rsmsgverifywrong
|
||
msgid "The target file is corrupted, checksum mismatch!"
|
||
msgstr "Целевой файл повреждён, не совпадает контрольная сумма!"
|
||
|
||
#: ulng.rsmsgvolumelabel
|
||
msgid "Volume label:"
|
||
msgstr "Метка диска:"
|
||
|
||
#: ulng.rsmsgvolumesizeenter
|
||
msgid "Please enter the volume size:"
|
||
msgstr "Введите размер тома:"
|
||
|
||
#: ulng.rsmsgwipefldr
|
||
msgid "Wipe %d selected files/directories?"
|
||
msgstr "Стереть %d выбранных файлов/каталогов?"
|
||
|
||
#: ulng.rsmsgwipesel
|
||
msgid "Wipe selected \"%s\"?"
|
||
msgstr "Стереть выбранный \"%s\"?"
|
||
|
||
#: ulng.rsmsgwithactionwith
|
||
msgid "with"
|
||
msgstr "с"
|
||
|
||
#: ulng.rsmsgwrongpasswordtryagain
|
||
msgid ""
|
||
"Wrong password!\n"
|
||
"Please try again!\n"
|
||
msgstr ""
|
||
"Неверный пароль!\n"
|
||
"Пожалуйста, попробуйте ещё раз!\n"
|
||
|
||
#: ulng.rsmulrenautorename
|
||
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
|
||
msgstr "Автоматически переименовывать в \"name (1).ext\", \"name (2).ext\" и т.д.?"
|
||
|
||
#: ulng.rsmulrenfilenamestylelist
|
||
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
||
msgstr "Без изменений;ПРОПИСНЫЕ;строчные;С прописной;Каждое Слово С Прописной;"
|
||
|
||
#: ulng.rsmulrenwarningduplicate
|
||
msgid "Warning, duplicate names!"
|
||
msgstr "Внимание, одинаковые имена!"
|
||
|
||
#: ulng.rsmulrenwronglinesnumber
|
||
msgid "File contains wrong number of lines: %d, should be %d!"
|
||
msgstr "В файле содержится неверное количество строк: %d, должно быть: %d!"
|
||
|
||
#: ulng.rsnewsearchclearfilteroptions
|
||
msgid "Keep;Clear;Prompt"
|
||
msgstr "Сохранить;Очистить;Спросить"
|
||
|
||
#: ulng.rsnoequivalentinternalcommand
|
||
msgid "No internal equivalent command"
|
||
msgstr "Нет эквивалентной внутренней команды"
|
||
|
||
#: ulng.rsnofindfileswindowyet
|
||
msgid "Sorry, no \"Find files\" window yet..."
|
||
msgstr "Извините, нет окон \"Поиск файлов\"..."
|
||
|
||
#: ulng.rsnootherfindfileswindowtoclose
|
||
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
||
msgstr "Извините, нет других окон \"Поиск файлов\"..."
|
||
|
||
#: ulng.rsopenwithdevelopment
|
||
msgid "Development"
|
||
msgstr "Разработка"
|
||
|
||
#: ulng.rsopenwitheducation
|
||
msgid "Education"
|
||
msgstr "Образование"
|
||
|
||
#: ulng.rsopenwithgames
|
||
msgid "Games"
|
||
msgstr "Игры"
|
||
|
||
#: ulng.rsopenwithgraphics
|
||
msgctxt "ulng.rsopenwithgraphics"
|
||
msgid "Graphics"
|
||
msgstr "Графика"
|
||
|
||
#: ulng.rsopenwithmultimedia
|
||
msgid "Multimedia"
|
||
msgstr "Мультимедиа"
|
||
|
||
#: ulng.rsopenwithnetwork
|
||
msgctxt "ulng.rsopenwithnetwork"
|
||
msgid "Network"
|
||
msgstr "Сеть"
|
||
|
||
#: ulng.rsopenwithoffice
|
||
msgid "Office"
|
||
msgstr "Офис"
|
||
|
||
#: ulng.rsopenwithother
|
||
msgctxt "ulng.rsopenwithother"
|
||
msgid "Other"
|
||
msgstr "Другое"
|
||
|
||
#: ulng.rsopenwithscience
|
||
msgid "Science"
|
||
msgstr "Наука"
|
||
|
||
#: ulng.rsopenwithsettings
|
||
msgid "Settings"
|
||
msgstr "Настройки"
|
||
|
||
#: ulng.rsopenwithsystem
|
||
msgctxt "ulng.rsopenwithsystem"
|
||
msgid "System"
|
||
msgstr "Система"
|
||
|
||
#: ulng.rsopenwithutility
|
||
msgid "Accessories"
|
||
msgstr "Инструменты"
|
||
|
||
#: ulng.rsoperaborted
|
||
msgid "Aborted"
|
||
msgstr "Прервано"
|
||
|
||
#: ulng.rsopercalculatingchecksum
|
||
msgid "Calculating checksum"
|
||
msgstr "Вычисление контрольной суммы"
|
||
|
||
#: ulng.rsopercalculatingchecksumin
|
||
msgid "Calculating checksum in \"%s\""
|
||
msgstr "Вычисление контрольной суммы \"%s\""
|
||
|
||
#: ulng.rsopercalculatingchecksumof
|
||
msgid "Calculating checksum of \"%s\""
|
||
msgstr "Вычисление контрольной суммы \"%s\""
|
||
|
||
#: ulng.rsopercalculatingstatictics
|
||
msgctxt "ulng.rsopercalculatingstatictics"
|
||
msgid "Calculating"
|
||
msgstr "Подсчёт"
|
||
|
||
#: ulng.rsopercalculatingstatisticsin
|
||
msgid "Calculating \"%s\""
|
||
msgstr "Вычисление \"%s\""
|
||
|
||
#: ulng.rsopercombining
|
||
msgid "Joining"
|
||
msgstr "Объединение"
|
||
|
||
#: ulng.rsopercombiningfromto
|
||
msgid "Joining files in \"%s\" to \"%s\""
|
||
msgstr "Объединение файлов \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsopercopying
|
||
msgid "Copying"
|
||
msgstr "Копирование"
|
||
|
||
#: ulng.rsopercopyingfromto
|
||
msgid "Copying from \"%s\" to \"%s\""
|
||
msgstr "Копирование из \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsopercopyingsomethingto
|
||
msgid "Copying \"%s\" to \"%s\""
|
||
msgstr "Копирование \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsopercreatingdirectory
|
||
msgid "Creating directory"
|
||
msgstr "Создание каталога"
|
||
|
||
#: ulng.rsopercreatingsomedirectory
|
||
msgid "Creating directory \"%s\""
|
||
msgstr "Создание каталога \"%s\""
|
||
|
||
#: ulng.rsoperdeleting
|
||
msgctxt "ulng.rsoperdeleting"
|
||
msgid "Deleting"
|
||
msgstr "Удаление"
|
||
|
||
#: ulng.rsoperdeletingin
|
||
msgid "Deleting in \"%s\""
|
||
msgstr "Удаление в \"%s\""
|
||
|
||
#: ulng.rsoperdeletingsomething
|
||
msgid "Deleting \"%s\""
|
||
msgstr "Удаление \"%s\""
|
||
|
||
#: ulng.rsoperexecuting
|
||
msgid "Executing"
|
||
msgstr "Выполнение"
|
||
|
||
#: ulng.rsoperexecutingsomething
|
||
msgid "Executing \"%s\""
|
||
msgstr "Выполнение \"%s\""
|
||
|
||
#: ulng.rsoperextracting
|
||
msgid "Extracting"
|
||
msgstr "Распаковка"
|
||
|
||
#: ulng.rsoperextractingfromto
|
||
msgid "Extracting from \"%s\" to \"%s\""
|
||
msgstr "Распаковка из \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsoperfinished
|
||
msgid "Finished"
|
||
msgstr "Завершено"
|
||
|
||
#: ulng.rsoperlisting
|
||
msgid "Listing"
|
||
msgstr "Список"
|
||
|
||
#: ulng.rsoperlistingin
|
||
msgid "Listing \"%s\""
|
||
msgstr "Список \"%s\""
|
||
|
||
#: ulng.rsopermoving
|
||
msgid "Moving"
|
||
msgstr "Перемещение"
|
||
|
||
#: ulng.rsopermovingfromto
|
||
msgid "Moving from \"%s\" to \"%s\""
|
||
msgstr "Перемещение из \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsopermovingsomethingto
|
||
msgid "Moving \"%s\" to \"%s\""
|
||
msgstr "Перемещение \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsopernotstarted
|
||
msgid "Not started"
|
||
msgstr "Не запущено"
|
||
|
||
#: ulng.rsoperpacking
|
||
msgid "Packing"
|
||
msgstr "Упаковка"
|
||
|
||
#: ulng.rsoperpackingfromto
|
||
msgid "Packing from \"%s\" to \"%s\""
|
||
msgstr "Упаковка из \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsoperpackingsomethingto
|
||
msgid "Packing \"%s\" to \"%s\""
|
||
msgstr "Упаковка \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsoperpaused
|
||
msgid "Paused"
|
||
msgstr "На паузе"
|
||
|
||
#: ulng.rsoperpausing
|
||
msgid "Pausing"
|
||
msgstr "Установка на паузу"
|
||
|
||
#: ulng.rsoperrunning
|
||
msgid "Running"
|
||
msgstr "Выполняется"
|
||
|
||
#: ulng.rsopersettingproperty
|
||
msgid "Setting property"
|
||
msgstr "Установка свойства"
|
||
|
||
#: ulng.rsopersettingpropertyin
|
||
msgid "Setting property in \"%s\""
|
||
msgstr "Установка свойства в \"%s\""
|
||
|
||
#: ulng.rsopersettingpropertyof
|
||
msgid "Setting property of \"%s\""
|
||
msgstr "Установка свойства на \"%s\""
|
||
|
||
#: ulng.rsopersplitting
|
||
msgid "Splitting"
|
||
msgstr "Разрезание"
|
||
|
||
#: ulng.rsopersplittingfromto
|
||
msgid "Splitting \"%s\" to \"%s\""
|
||
msgstr "Разрезание \"%s\" в \"%s\""
|
||
|
||
#: ulng.rsoperstarting
|
||
msgid "Starting"
|
||
msgstr "Запускается"
|
||
|
||
#: ulng.rsoperstopped
|
||
msgid "Stopped"
|
||
msgstr "Остановлено"
|
||
|
||
#: ulng.rsoperstopping
|
||
msgid "Stopping"
|
||
msgstr "Останавливается"
|
||
|
||
#: ulng.rsopertesting
|
||
msgid "Testing"
|
||
msgstr "Проверка"
|
||
|
||
#: ulng.rsopertestingin
|
||
msgid "Testing in \"%s\""
|
||
msgstr "Проверка в \"%s\""
|
||
|
||
#: ulng.rsopertestingsomething
|
||
msgid "Testing \"%s\""
|
||
msgstr "Проверка \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksum
|
||
msgid "Verifying checksum"
|
||
msgstr "Проверка контрольной суммы"
|
||
|
||
#: ulng.rsoperverifyingchecksumin
|
||
msgid "Verifying checksum in \"%s\""
|
||
msgstr "Проверка контрольной суммы в \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksumof
|
||
msgid "Verifying checksum of \"%s\""
|
||
msgstr "Проверка контрольной суммы из \"%s\""
|
||
|
||
#: ulng.rsoperwaitingforconnection
|
||
msgid "Waiting for access to file source"
|
||
msgstr "Ожидание ответа источника"
|
||
|
||
#: ulng.rsoperwaitingforfeedback
|
||
msgid "Waiting for user response"
|
||
msgstr "Ожидание ответа от пользователя"
|
||
|
||
#: ulng.rsoperwiping
|
||
msgid "Wiping"
|
||
msgstr "Стирание"
|
||
|
||
#: ulng.rsoperwipingin
|
||
msgid "Wiping in \"%s\""
|
||
msgstr "Стирание в \"%s\""
|
||
|
||
#: ulng.rsoperwipingsomething
|
||
msgid "Wiping \"%s\""
|
||
msgstr "Стирание \"%s\""
|
||
|
||
#: ulng.rsoperworking
|
||
msgid "Working"
|
||
msgstr "Работа"
|
||
|
||
#: ulng.rsoptaddfrommainpanel
|
||
msgid "Add at &beginning;Add at the end;Smart add"
|
||
msgstr "Добавить в &начало;Добавить в конец;\"Умное\" добавление"
|
||
|
||
#: ulng.rsoptaddingtooltipfiletype
|
||
msgid "Adding new tooltip file type"
|
||
msgstr "Добавление нового типа файлов"
|
||
|
||
#: ulng.rsoptarchiveconfiguresavetochange
|
||
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
|
||
msgstr "Для изменения редактируемых настроек архиватора нажмите \"Применить\" или \"Удалить\" для удаления"
|
||
|
||
#: ulng.rsoptarchiveradditonalcmd
|
||
msgid "Mode dependent, additional command"
|
||
msgstr "Зависит от режима, дополнение команд"
|
||
|
||
#: ulng.rsoptarchiveraddonlynotempty
|
||
msgid "Add if it is non-empty"
|
||
msgstr "Если не пустая"
|
||
|
||
#: ulng.rsoptarchiverarchivel
|
||
msgid "Archive File (long name)"
|
||
msgstr "Длинное имя архива"
|
||
|
||
#: ulng.rsoptarchiverarchiver
|
||
msgid "Select archiver executable"
|
||
msgstr "Выбрать исполняемый файл"
|
||
|
||
#: ulng.rsoptarchiverarchives
|
||
msgid "Archive file (short name)"
|
||
msgstr "Короткое имя архива"
|
||
|
||
#: ulng.rsoptarchiverchangeencoding
|
||
msgid "Change Archiver Listing Encoding"
|
||
msgstr "Переопределить кодировку вывода"
|
||
|
||
#: ulng.rsoptarchiverconfirmdelete
|
||
msgctxt "ulng.rsoptarchiverconfirmdelete"
|
||
msgid "Are you sure you want to delete: \"%s\"?"
|
||
msgstr "Вы уверены, что хотите удалить: \"%s\"?"
|
||
|
||
#: ulng.rsoptarchiverdefaultexportfilename
|
||
msgid "Exported Archiver Configuration"
|
||
msgstr "Экспортированные настройки архиватора"
|
||
|
||
#: ulng.rsoptarchivererrorlevel
|
||
msgid "errorlevel"
|
||
msgstr "<код завершения>"
|
||
|
||
#: ulng.rsoptarchiverexportcaption
|
||
msgid "Export archiver configuration"
|
||
msgstr "Экспорт настроек архиватора"
|
||
|
||
#: ulng.rsoptarchiverexportdone
|
||
msgctxt "ulng.rsoptarchiverexportdone"
|
||
msgid "Exportation of %d elements to file \"%s\" completed."
|
||
msgstr "Экспортирование завершено: %d в файл \"%s\"."
|
||
|
||
#: ulng.rsoptarchiverexportprompt
|
||
msgctxt "ulng.rsoptarchiverexportprompt"
|
||
msgid "Select the one(s) you want to export"
|
||
msgstr "Выберите архиватор(ы) для экспорта"
|
||
|
||
#: ulng.rsoptarchiverfilelistl
|
||
msgid "Filelist (long names)"
|
||
msgstr "Список с длинными именами файлов"
|
||
|
||
#: ulng.rsoptarchiverfilelists
|
||
msgid "Filelist (short names)"
|
||
msgstr "Список с короткими именами файлов"
|
||
|
||
#: ulng.rsoptarchiverimportcaption
|
||
msgid "Import archiver configuration"
|
||
msgstr "Импорт настроек архиватора"
|
||
|
||
#: ulng.rsoptarchiverimportdone
|
||
msgctxt "ulng.rsoptarchiverimportdone"
|
||
msgid "Importation of %d elements from file \"%s\" completed."
|
||
msgstr "Импортирование завершено: %d из файла \"%s\"."
|
||
|
||
#: ulng.rsoptarchiverimportfile
|
||
msgid "Select the file to import archiver configuration(s)"
|
||
msgstr "Выберите файл для импорта настроек архиватора(ов)"
|
||
|
||
#: ulng.rsoptarchiverimportprompt
|
||
msgctxt "ulng.rsoptarchiverimportprompt"
|
||
msgid "Select the one(s) you want to import"
|
||
msgstr "Выберите архиватор(ы) для импорта"
|
||
|
||
#: ulng.rsoptarchiverjustname
|
||
msgid "Use name only, without path"
|
||
msgstr "Использовать только имя, без пути"
|
||
|
||
#: ulng.rsoptarchiverjustpath
|
||
msgid "Use path only, without name"
|
||
msgstr "Использовать только путь, без имени"
|
||
|
||
#: ulng.rsoptarchiverprograml
|
||
msgid "Archive Program (long name)"
|
||
msgstr "Длинное имя архиватора"
|
||
|
||
#: ulng.rsoptarchiverprograms
|
||
msgid "Archive Program (short name)"
|
||
msgstr "Короткое имя архиватора"
|
||
|
||
#: ulng.rsoptarchiverquoteall
|
||
msgid "Quote all names"
|
||
msgstr "Заключать в кавычки все имена"
|
||
|
||
#: ulng.rsoptarchiverquotewithspace
|
||
msgid "Quote names with spaces"
|
||
msgstr "Заключать в кавычки имена с пробелами"
|
||
|
||
#: ulng.rsoptarchiversinglefprocess
|
||
msgid "Single filename to process"
|
||
msgstr "Имя одного файла для обработки"
|
||
|
||
#: ulng.rsoptarchivertargetsubdir
|
||
msgid "Target subdirecory"
|
||
msgstr "Целевая поддиректория архива"
|
||
|
||
#: ulng.rsoptarchiveruseansi
|
||
msgid "Use ANSI encoding"
|
||
msgstr "Использовать кодировку ANSI"
|
||
|
||
#: ulng.rsoptarchiveruseutf8
|
||
msgid "Use UTF8 encoding"
|
||
msgstr "Использовать кодировку UTF-8"
|
||
|
||
#: ulng.rsoptarchiverwheretosave
|
||
msgid "Enter location and filename where to save archiver configuration"
|
||
msgstr "Укажите место и имя файла для сохранения настроек архиватора(ов)"
|
||
|
||
#: ulng.rsoptarchivetypename
|
||
msgid "Archive type name:"
|
||
msgstr "Имя типа архива:"
|
||
|
||
#: ulng.rsoptassocpluginwith
|
||
msgid "Associate plugin \"%s\" with:"
|
||
msgstr "Связать плагин \"%s\" с расширением:"
|
||
|
||
#: ulng.rsoptautosizecolumn
|
||
msgid "First;Last;"
|
||
msgstr "Первой;Последней;"
|
||
|
||
#: ulng.rsoptconfigsortorder
|
||
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
||
msgstr "Классическая (по умолчанию);В алфавитном порядке (но язык первый)"
|
||
|
||
#: ulng.rsoptconfigtreestate
|
||
msgid "Full expand;Full collapse"
|
||
msgstr "Развернуть всё;Свернуть всё"
|
||
|
||
#: ulng.rsoptdifferframeposition
|
||
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
||
msgstr "Активная панель слева, неактивная справа;Левая панель слева, правая справа"
|
||
|
||
#: ulng.rsoptenterext
|
||
msgid "Enter extension"
|
||
msgstr "Введите расширение"
|
||
|
||
#: ulng.rsoptfavoritetabswheretoaddinlist
|
||
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
||
msgstr "Добавить в начало;Добавить в конец;По алфавиту"
|
||
|
||
#: ulng.rsoptfileoperationsprogresskind
|
||
msgid "separate window;minimized separate window;operations panel"
|
||
msgstr "отдельное окно;минимизировать отдельное окно;панель операций"
|
||
|
||
#: ulng.rsoptfilesizeformat
|
||
msgid "float;B;K;M;G"
|
||
msgstr "плавающий;байты;килобайты;мегабайты;гигабайты"
|
||
|
||
#: ulng.rsopthotkeysadddeleteshortcutlong
|
||
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
||
msgstr "Сочетание %s для cm_Delete будет зарегистрировано, поэтому оно может быть использовано обратным этой настройке."
|
||
|
||
#: ulng.rsopthotkeysaddhotkey
|
||
msgid "Add hotkey for %s"
|
||
msgstr "Добавить горячую клавишу для %s"
|
||
|
||
#: ulng.rsopthotkeysaddshortcutbutton
|
||
msgid "Add shortcut"
|
||
msgstr "Добавить сочетание"
|
||
|
||
#: ulng.rsopthotkeyscannotsetshortcut
|
||
msgid "Cannot set shortcut"
|
||
msgstr "Не удалось установить клавиатурное сочетание"
|
||
|
||
#: ulng.rsopthotkeyschangeshortcut
|
||
msgid "Change shortcut"
|
||
msgstr "Изменить сочетание"
|
||
|
||
#: ulng.rsopthotkeyscommand
|
||
msgctxt "ulng.rsopthotkeyscommand"
|
||
msgid "Command"
|
||
msgstr "Команда"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
||
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
||
msgstr "Сочетание %s для cm_Delete имеет параметр, который перекрывает эту настройку. Хотите изменить этот параметр для использования глобально?"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
||
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
||
msgstr "Сочетание %s для cm_Delete нуждается в изменении параметра для соответствия сочетанию %s. Хотите изменить это?"
|
||
|
||
#: ulng.rsopthotkeysdescription
|
||
msgctxt "ulng.rsopthotkeysdescription"
|
||
msgid "Description"
|
||
msgstr "Описание"
|
||
|
||
#: ulng.rsopthotkeysedithotkey
|
||
msgid "Edit hotkey for %s"
|
||
msgstr "Редактировать горячую клавишу для %s"
|
||
|
||
#: ulng.rsopthotkeysfixparameter
|
||
msgid "Fix parameter"
|
||
msgstr "Исправить параметр"
|
||
|
||
#: ulng.rsopthotkeyshotkey
|
||
msgctxt "ulng.rsopthotkeyshotkey"
|
||
msgid "Hotkey"
|
||
msgstr "Горячая клавиша"
|
||
|
||
#: ulng.rsopthotkeyshotkeys
|
||
msgctxt "ulng.rsopthotkeyshotkeys"
|
||
msgid "Hotkeys"
|
||
msgstr "Горячие клавиши"
|
||
|
||
#: ulng.rsopthotkeysnohotkey
|
||
msgid "<none>"
|
||
msgstr "<нет>"
|
||
|
||
#: ulng.rsopthotkeysparameters
|
||
msgctxt "ulng.rsopthotkeysparameters"
|
||
msgid "Parameters"
|
||
msgstr "Параметры"
|
||
|
||
#: ulng.rsopthotkeyssetdeleteshortcut
|
||
msgid "Set shortcut to delete file"
|
||
msgstr "Установить сочетание для удаления файла"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
||
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
||
msgstr "Чтобы эта настройка работала с сочетанием %s, сочетание %s должно быть назначено на cm_Delete, но оно уже назначено на %s. Хотите изменить это?"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
||
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
||
msgstr "Сочетание %s для cm_Delete - это сочетание клавиш, для которого не может быть назначена реверсивная клавиша Shift. Эта настройка может не работать."
|
||
|
||
#: ulng.rsopthotkeysshortcutused
|
||
msgid "Shortcut in use"
|
||
msgstr "Горячая клавиша уже используется"
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext1
|
||
msgid "Shortcut %s is already used."
|
||
msgstr "Горячая клавиша %s уже используется."
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext2
|
||
msgid "Change it to %s?"
|
||
msgstr "Изменить на %s?"
|
||
|
||
#: ulng.rsopthotkeysusedby
|
||
msgid "used for %s in %s"
|
||
msgstr "уже используется для %s в %s"
|
||
|
||
#: ulng.rsopthotkeysusedwithdifferentparams
|
||
msgid "used for this command but with different parameters"
|
||
msgstr "уже используется для этой команды, но с другими параметрами"
|
||
|
||
#: ulng.rsoptionseditorarchivers
|
||
msgctxt "ulng.rsoptionseditorarchivers"
|
||
msgid "Archivers"
|
||
msgstr "Архиваторы"
|
||
|
||
#: ulng.rsoptionseditorautorefresh
|
||
msgctxt "ulng.rsoptionseditorautorefresh"
|
||
msgid "Auto refresh"
|
||
msgstr "Автообновление"
|
||
|
||
#: ulng.rsoptionseditorbehavior
|
||
msgctxt "ulng.rsoptionseditorbehavior"
|
||
msgid "Behaviors"
|
||
msgstr "Поведение"
|
||
|
||
#: ulng.rsoptionseditorbriefview
|
||
msgctxt "ulng.rsoptionseditorbriefview"
|
||
msgid "Brief"
|
||
msgstr "Краткий"
|
||
|
||
#: ulng.rsoptionseditorcolors
|
||
msgctxt "ulng.rsoptionseditorcolors"
|
||
msgid "Colors"
|
||
msgstr "Цвета"
|
||
|
||
#: ulng.rsoptionseditorcolumnsview
|
||
msgctxt "ulng.rsoptionseditorcolumnsview"
|
||
msgid "Columns"
|
||
msgstr "Колонки"
|
||
|
||
#: ulng.rsoptionseditorconfiguration
|
||
msgctxt "ulng.rsoptionseditorconfiguration"
|
||
msgid "Configuration"
|
||
msgstr "Конфигурация"
|
||
|
||
#: ulng.rsoptionseditorcustomcolumns
|
||
msgid "Custom columns"
|
||
msgstr "Наборы колонок"
|
||
|
||
#: ulng.rsoptionseditordirectoryhotlist
|
||
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Избранные каталоги"
|
||
|
||
#: ulng.rsoptionseditordraganddrop
|
||
msgid "Drag & drop"
|
||
msgstr "Перетаскивание"
|
||
|
||
#: ulng.rsoptionseditordriveslistbutton
|
||
msgid "Drives list button"
|
||
msgstr "Кнопка списка дисков"
|
||
|
||
#: ulng.rsoptionseditorfavoritetabs
|
||
msgid "Favorite Tabs"
|
||
msgstr "Избранные вкладки"
|
||
|
||
#: ulng.rsoptionseditorfileassicextra
|
||
msgid "File associations extra"
|
||
msgstr "Файловые ассоциации (дополнительно)"
|
||
|
||
#: ulng.rsoptionseditorfileassoc
|
||
msgctxt "ulng.rsoptionseditorfileassoc"
|
||
msgid "File associations"
|
||
msgstr "Файловые ассоциации"
|
||
|
||
#: ulng.rsoptionseditorfilenewfiletypes
|
||
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
||
msgid "New"
|
||
msgstr "Новый"
|
||
|
||
#: ulng.rsoptionseditorfileoperations
|
||
msgctxt "ulng.rsoptionseditorfileoperations"
|
||
msgid "File operations"
|
||
msgstr "Файловые операции"
|
||
|
||
#: ulng.rsoptionseditorfilepanels
|
||
msgctxt "ulng.rsoptionseditorfilepanels"
|
||
msgid "File panels"
|
||
msgstr "Файловые панели"
|
||
|
||
#: ulng.rsoptionseditorfilesearch
|
||
msgctxt "ulng.rsoptionseditorfilesearch"
|
||
msgid "File search"
|
||
msgstr "Поиск файлов"
|
||
|
||
#: ulng.rsoptionseditorfilesviews
|
||
msgid "Files views"
|
||
msgstr "Список файлов"
|
||
|
||
#: ulng.rsoptionseditorfiletypes
|
||
msgctxt "ulng.rsoptionseditorfiletypes"
|
||
msgid "File types"
|
||
msgstr "Типы файлов"
|
||
|
||
#: ulng.rsoptionseditorfoldertabs
|
||
msgctxt "ulng.rsoptionseditorfoldertabs"
|
||
msgid "Folder tabs"
|
||
msgstr "Вкладки каталогов"
|
||
|
||
#: ulng.rsoptionseditorfoldertabsextra
|
||
msgid "Folder tabs extra"
|
||
msgstr "Вкладки каталогов (дополнительно)"
|
||
|
||
#: ulng.rsoptionseditorfonts
|
||
msgctxt "ulng.rsoptionseditorfonts"
|
||
msgid "Fonts"
|
||
msgstr "Шрифты"
|
||
|
||
#: ulng.rsoptionseditorhighlighters
|
||
msgid "Highlighters"
|
||
msgstr "Подсветка"
|
||
|
||
#: ulng.rsoptionseditorhotkeys
|
||
msgctxt "ulng.rsoptionseditorhotkeys"
|
||
msgid "Hot keys"
|
||
msgstr "Горячие клавиши"
|
||
|
||
#: ulng.rsoptionseditoricons
|
||
msgctxt "ulng.rsoptionseditoricons"
|
||
msgid "Icons"
|
||
msgstr "Значки"
|
||
|
||
#: ulng.rsoptionseditorignorelist
|
||
msgctxt "ulng.rsoptionseditorignorelist"
|
||
msgid "Ignore list"
|
||
msgstr "Список исключений"
|
||
|
||
#: ulng.rsoptionseditorkeyboard
|
||
msgid "Keys"
|
||
msgstr "Клавиши"
|
||
|
||
#: ulng.rsoptionseditorlanguage
|
||
msgctxt "ulng.rsoptionseditorlanguage"
|
||
msgid "Language"
|
||
msgstr "Язык"
|
||
|
||
#: ulng.rsoptionseditorlayout
|
||
msgctxt "ulng.rsoptionseditorlayout"
|
||
msgid "Layout"
|
||
msgstr "Вид окна"
|
||
|
||
#: ulng.rsoptionseditorlog
|
||
msgctxt "ulng.rsoptionseditorlog"
|
||
msgid "Log"
|
||
msgstr "Протокол"
|
||
|
||
#: ulng.rsoptionseditormiscellaneous
|
||
msgctxt "ulng.rsoptionseditormiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Разное"
|
||
|
||
#: ulng.rsoptionseditormouse
|
||
msgid "Mouse"
|
||
msgstr "Мышь"
|
||
|
||
#: ulng.rsoptionseditoroptionschanged
|
||
msgid ""
|
||
"Options have changed in \"%s\"\n"
|
||
"\n"
|
||
"Do you want to save modifications?\n"
|
||
msgstr ""
|
||
"Опции \"%s\" изменены.\n"
|
||
"\n"
|
||
"Хотите сохранить изменения?\n"
|
||
|
||
#: ulng.rsoptionseditorplugins
|
||
msgctxt "ulng.rsoptionseditorplugins"
|
||
msgid "Plugins"
|
||
msgstr "Плагины"
|
||
|
||
#: ulng.rsoptionseditorquicksearch
|
||
msgctxt "ulng.rsoptionseditorquicksearch"
|
||
msgid "Quick search/filter"
|
||
msgstr "Быстрый поиск/фильтр"
|
||
|
||
#: ulng.rsoptionseditorterminal
|
||
msgctxt "ulng.rsoptionseditorterminal"
|
||
msgid "Terminal"
|
||
msgstr "Терминал"
|
||
|
||
#: ulng.rsoptionseditortoolbar
|
||
msgid "Toolbar"
|
||
msgstr "Панель инструментов"
|
||
|
||
#: ulng.rsoptionseditortools
|
||
msgctxt "ulng.rsoptionseditortools"
|
||
msgid "Tools"
|
||
msgstr "Инструменты"
|
||
|
||
#: ulng.rsoptionseditortooltips
|
||
msgctxt "ulng.rsoptionseditortooltips"
|
||
msgid "Tooltips"
|
||
msgstr "Подсказки"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenu
|
||
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
||
msgid "Tree View Menu"
|
||
msgstr "Древовидное меню"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenucolors
|
||
msgid "Tree View Menu Colors"
|
||
msgstr "Цвета древовидного меню"
|
||
|
||
#: ulng.rsoptletters
|
||
msgid "None;Command Line;Quick Search;Quick Filter"
|
||
msgstr "Нет;Командная строка;Быстрый поиск;Быстрый фильтр"
|
||
|
||
#: ulng.rsoptmouseselectionbutton
|
||
msgid "Left button;Right button;"
|
||
msgstr "Левая клавиша;Правая клавиша;"
|
||
|
||
#: ulng.rsoptnewfilesposition
|
||
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
||
msgstr "сверху списка файлов;после каталогов (если каталоги отсортированы перед файлами);в отсортированной позиции;внизу списка файлов"
|
||
|
||
#: ulng.rsoptpluginalreadyassigned
|
||
msgid "Plugin %s is already assigned for the following extensions:"
|
||
msgstr "Плагин %s уже назначен для следующих расширений:"
|
||
|
||
#: ulng.rsoptplugindisable
|
||
msgid "D&isable"
|
||
msgstr "От&ключить"
|
||
|
||
#: ulng.rsoptpluginenable
|
||
msgctxt "ulng.rsoptpluginenable"
|
||
msgid "E&nable"
|
||
msgstr "&Включить"
|
||
|
||
#: ulng.rsoptpluginsactive
|
||
msgctxt "ulng.rsoptpluginsactive"
|
||
msgid "Active"
|
||
msgstr "Состояние"
|
||
|
||
#: ulng.rsoptpluginsdescription
|
||
msgctxt "ulng.rsoptpluginsdescription"
|
||
msgid "Description"
|
||
msgstr "Описание"
|
||
|
||
#: ulng.rsoptpluginsfilename
|
||
msgctxt "ulng.rsoptpluginsfilename"
|
||
msgid "File name"
|
||
msgstr "Имя файла"
|
||
|
||
#: ulng.rsoptpluginshowbyextension
|
||
msgid "By extension"
|
||
msgstr "Расширения"
|
||
|
||
#: ulng.rsoptpluginshowbyplugin
|
||
msgid "By Plugin"
|
||
msgstr "Плагины"
|
||
|
||
#: ulng.rsoptpluginsname
|
||
msgctxt "ulng.rsoptpluginsname"
|
||
msgid "Name"
|
||
msgstr "Имя"
|
||
|
||
#: ulng.rsoptpluginsortonlywhenbyextension
|
||
msgid "Sorting WCX plugins is only possible when showing plugins by extension!"
|
||
msgstr "Сортировка WCX-плагинов возможна только при показе плагинов по расширению!"
|
||
|
||
#: ulng.rsoptpluginsregisteredfor
|
||
msgctxt "ulng.rsoptpluginsregisteredfor"
|
||
msgid "Registered for"
|
||
msgstr "Ассоциация"
|
||
|
||
#: ulng.rsoptrenamingtooltipfiletype
|
||
msgid "Renaming tooltip file type"
|
||
msgstr "Переименование типа файлов"
|
||
|
||
#: ulng.rsoptsearchcase
|
||
msgid "&Sensitive;&Insensitive"
|
||
msgstr "&Чувствителен;Н&е чувствителен"
|
||
|
||
#: ulng.rsoptsearchitems
|
||
msgid "&Files;Di&rectories;Files a&nd Directories"
|
||
msgstr "&Файлы;Катало&ги;Ф&айлы и каталоги"
|
||
|
||
#: ulng.rsoptsearchopt
|
||
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
||
msgstr "Ск&рывать панель фильтра, когда она не в фокусе;Сохранять настройки, изменённые через панель фильтра"
|
||
|
||
#: ulng.rsoptsortcasesens
|
||
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
||
msgstr "не чувствителен к регистру;соответственно локальным установкам (аАбБгГ);сначала верхний регистр, потом нижний (АБВабв)"
|
||
|
||
#: ulng.rsoptsortfoldermode
|
||
msgid "sort by name and show first;sort like files and show first;sort like files"
|
||
msgstr "сортировать по имени и показывать первыми;сортировать как файлы и показывать первыми;сортировать как файлы"
|
||
|
||
#: ulng.rsoptsortmethod
|
||
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
||
msgstr "Алфавитная, с учётом особенностей языка;Естественная сортировка: алфавитно-числовая"
|
||
|
||
#: ulng.rsopttabsposition
|
||
msgid "Top;Bottom;"
|
||
msgstr "Вверху;Внизу;"
|
||
|
||
#: ulng.rsopttoolbarbuttontype
|
||
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
||
msgstr "Разд&елитель;Внутрення&я команда;Вне&шняя команда;Мен&ю"
|
||
|
||
#: ulng.rsopttooltipconfiguresavetochange
|
||
msgid "To change file type tooltip configuration, either APPLY or DELETE current editing one"
|
||
msgstr "Чтобы изменить настройки всплывающих подсказок ПРИМЕНИТЕ или УДАЛИТЕ текущие изменения"
|
||
|
||
#: ulng.rsopttooltipfiletype
|
||
msgid "Tooltip file type name:"
|
||
msgstr "Имя:"
|
||
|
||
#: ulng.rsopttooltipfiletypealreadyexists
|
||
msgid "\"%s\" already exists!"
|
||
msgstr "\"%s\" уже существует!"
|
||
|
||
#: ulng.rsopttooltipfiletypeconfirmdelete
|
||
msgctxt "ulng.rsopttooltipfiletypeconfirmdelete"
|
||
msgid "Are you sure you want to delete: \"%s\"?"
|
||
msgstr "Вы уверены, что хотите удалить: \"%s\"?"
|
||
|
||
#: ulng.rsopttooltipfiletypedefaultexportfilename
|
||
msgid "Exported tooltip file type configuration"
|
||
msgstr ""
|
||
|
||
#: ulng.rsopttooltipfiletypeexportcaption
|
||
msgid "Export tooltip file type configuration"
|
||
msgstr "Экспорт настроек подсказок"
|
||
|
||
#: ulng.rsopttooltipfiletypeexportdone
|
||
msgctxt "ulng.rsopttooltipfiletypeexportdone"
|
||
msgid "Exportation of %d elements to file \"%s\" completed."
|
||
msgstr "Экспортирование завершено: %d в файл \"%s\"."
|
||
|
||
#: ulng.rsopttooltipfiletypeexportprompt
|
||
msgctxt "ulng.rsopttooltipfiletypeexportprompt"
|
||
msgid "Select the one(s) you want to export"
|
||
msgstr "Выберите тип(ы) файлов для экспорта"
|
||
|
||
#: ulng.rsopttooltipfiletypeimportcaption
|
||
msgid "Import tooltip file type configuration"
|
||
msgstr "Импорт настроек подсказок"
|
||
|
||
#: ulng.rsopttooltipfiletypeimportdone
|
||
msgctxt "ulng.rsopttooltipfiletypeimportdone"
|
||
msgid "Importation of %d elements from file \"%s\" completed."
|
||
msgstr "Импортирование завершено: %d из файла \"%s\"."
|
||
|
||
#: ulng.rsopttooltipfiletypeimportfile
|
||
msgid "Select the file to import tooltip file type configuration(s)"
|
||
msgstr "Выберите файл для импорта настроек подсказок"
|
||
|
||
#: ulng.rsopttooltipfiletypeimportprompt
|
||
msgctxt "ulng.rsopttooltipfiletypeimportprompt"
|
||
msgid "Select the one(s) you want to import"
|
||
msgstr "Выберите тип(ы) файлов для импорта"
|
||
|
||
#: ulng.rsopttooltipfiletypewheretosave
|
||
msgid "Enter location and filename where to save tooltip file type configuration"
|
||
msgstr "Укажите место и имя файла для сохранения настроек подсказок"
|
||
|
||
#: ulng.rsopttooltipsfiletypename
|
||
msgid "Tooltip file type name"
|
||
msgstr "Имя"
|
||
|
||
#: ulng.rsopttypeofduplicatedrename
|
||
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
||
msgstr "Штатный - Копия (x) имяфайла.тип;Windows - имяфайла (x).тип;Другой - имяфайла(x).тип"
|
||
|
||
#: ulng.rsoptupdatedfilesposition
|
||
msgid "don't change position;use the same setting as for new files;to sorted position"
|
||
msgstr "не менять позицию;использовать то же, что и для новых файлов;в отсортированной позиции"
|
||
|
||
#: ulng.rspluginfilenamestylelist
|
||
msgid "With complete absolute path;Path relative to %COMMANDER_PATH%;Relative to the following"
|
||
msgstr "С полным абсолютным путём;С путём относительно %COMMANDER_PATH%;С путём относительно указанного"
|
||
|
||
#: ulng.rspluginsearchcontainscasesenstive
|
||
msgid "contains(case)"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchcontainsnotcase
|
||
msgid "contains"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchequalcasesensitive
|
||
msgid "=(case)"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchequalnotcase
|
||
msgctxt "ulng.rspluginsearchequalnotcase"
|
||
msgid "="
|
||
msgstr "="
|
||
|
||
#: ulng.rspluginsearchfieldnotfound
|
||
msgid "Field \"%s\" not found!"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchnotcontainscasesenstive
|
||
msgid "!contains(case)"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchnotcontainsnotcase
|
||
msgid "!contains"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchnotequacasesensitive
|
||
msgid "!=(case)"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchnotequalnotcase
|
||
msgctxt "ulng.rspluginsearchnotequalnotcase"
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: ulng.rspluginsearchpluginnotfound
|
||
msgid "Plugin \"%s\" not found!"
|
||
msgstr ""
|
||
|
||
#: ulng.rspluginsearchunitnotfound
|
||
msgid "Unit \"%s\" not found!"
|
||
msgstr ""
|
||
|
||
#: ulng.rspropscontains
|
||
msgid "Files: %d, folders: %d"
|
||
msgstr "Файлов: %d, папок: %d"
|
||
|
||
#: ulng.rspropserrchmod
|
||
msgid "Can not change access rights for \"%s\""
|
||
msgstr "Не удалось изменить права доступа для \"%s\""
|
||
|
||
#: ulng.rspropserrchown
|
||
msgid "Can not change owner for \"%s\""
|
||
msgstr "Не удалось изменить владельца для \"%s\""
|
||
|
||
#: ulng.rspropsfile
|
||
msgctxt "ulng.rspropsfile"
|
||
msgid "File"
|
||
msgstr "Файл"
|
||
|
||
#: ulng.rspropsfolder
|
||
msgctxt "ulng.rspropsfolder"
|
||
msgid "Directory"
|
||
msgstr "Каталог"
|
||
|
||
#: ulng.rspropsnmdpipe
|
||
msgid "Named pipe"
|
||
msgstr "Именованный канал"
|
||
|
||
#: ulng.rspropssocket
|
||
msgid "Socket"
|
||
msgstr "Сокет"
|
||
|
||
#: ulng.rspropsspblkdev
|
||
msgid "Special block device"
|
||
msgstr "Особое блочное устройство"
|
||
|
||
#: ulng.rspropsspchrdev
|
||
msgid "Special character device"
|
||
msgstr "Особое символьное устройство"
|
||
|
||
#: ulng.rspropssymlink
|
||
msgid "Symbolic link"
|
||
msgstr "Символьная ссылка"
|
||
|
||
#: ulng.rspropsunknowntype
|
||
msgid "Unknown type"
|
||
msgstr "Неизвестный тип"
|
||
|
||
#: ulng.rssearchresult
|
||
msgid "Search result"
|
||
msgstr "Результаты поиска"
|
||
|
||
#: ulng.rssearchstatus
|
||
msgid "SEARCH"
|
||
msgstr "ПОИСК"
|
||
|
||
#: ulng.rssearchtemplateunnamed
|
||
msgid "<unnamed template>"
|
||
msgstr "<безымянный шаблон>"
|
||
|
||
#: ulng.rssearchwithdsxplugininprogress
|
||
msgid ""
|
||
"A file search using DSX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Поиск файлов с DSX-плагином уже запущен.\n"
|
||
"Необходимо завершить его, прежде чем начать новый.\n"
|
||
|
||
#: ulng.rssearchwithwdxplugininprogress
|
||
msgid ""
|
||
"A file search using WDX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Поиск файлов с WDX-плагином уже запущен.\n"
|
||
"Необходимо завершить его, прежде чем начать новый.\n"
|
||
|
||
#: ulng.rsselectdir
|
||
msgid "Select a directory"
|
||
msgstr "Выберите каталог"
|
||
|
||
#: ulng.rsselectyoufindfileswindow
|
||
msgid "Select your window"
|
||
msgstr "Выберите окно"
|
||
|
||
#: ulng.rsshowhelpfor
|
||
msgid "&Show help for %s"
|
||
msgstr "Показат&ь %s в справке"
|
||
|
||
#: ulng.rssimplewordall
|
||
msgctxt "ulng.rssimplewordall"
|
||
msgid "All"
|
||
msgstr "Все"
|
||
|
||
#: ulng.rssimplewordcategory
|
||
msgctxt "ulng.rssimplewordcategory"
|
||
msgid "Category"
|
||
msgstr "Категория"
|
||
|
||
#: ulng.rssimplewordcolumnsingular
|
||
msgid "Column"
|
||
msgstr "Колонка"
|
||
|
||
#: ulng.rssimplewordcommand
|
||
msgctxt "ulng.rssimplewordcommand"
|
||
msgid "Command"
|
||
msgstr "Команда"
|
||
|
||
#: ulng.rssimplewordfalse
|
||
msgid "False"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordfilename
|
||
msgid "Filename"
|
||
msgstr "Имя файла"
|
||
|
||
#: ulng.rssimplewordfiles
|
||
msgid "files"
|
||
msgstr "файлы"
|
||
|
||
#: ulng.rssimplewordletter
|
||
msgid "Letter"
|
||
msgstr "Буква"
|
||
|
||
#: ulng.rssimplewordparameter
|
||
msgid "Param"
|
||
msgstr "Параметры"
|
||
|
||
#: ulng.rssimplewordresult
|
||
msgid "Result"
|
||
msgstr "Результат"
|
||
|
||
#: ulng.rssimplewordtrue
|
||
msgid "True"
|
||
msgstr ""
|
||
|
||
#: ulng.rssimplewordworkdir
|
||
msgid "WorkDir"
|
||
msgstr "Рабочий каталог"
|
||
|
||
#: ulng.rssizeunitbytes
|
||
msgid "Bytes"
|
||
msgstr "Байт"
|
||
|
||
#: ulng.rssizeunitgbytes
|
||
msgctxt "ulng.rssizeunitgbytes"
|
||
msgid "Gigabytes"
|
||
msgstr "Гигабайт"
|
||
|
||
#: ulng.rssizeunitkbytes
|
||
msgctxt "ulng.rssizeunitkbytes"
|
||
msgid "Kilobytes"
|
||
msgstr "Килобайт"
|
||
|
||
#: ulng.rssizeunitmbytes
|
||
msgctxt "ulng.rssizeunitmbytes"
|
||
msgid "Megabytes"
|
||
msgstr "Мегабайт"
|
||
|
||
#: ulng.rssizeunittbytes
|
||
msgid "Terabytes"
|
||
msgstr "Терабайт"
|
||
|
||
#: ulng.rsspacemsg
|
||
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
||
msgstr "Файлов: %d, Каталогов: %d, Размер: %s (%s байт)"
|
||
|
||
#: ulng.rsspliterrdirectory
|
||
msgid "Unable to create target directory!"
|
||
msgstr "Не удалось создать каталог назначения!"
|
||
|
||
#: ulng.rsspliterrfilesize
|
||
msgid "Incorrect file size format!"
|
||
msgstr "Неправильный формат размера файла!"
|
||
|
||
#: ulng.rsspliterrsplitfile
|
||
msgid "Unable to split the file!"
|
||
msgstr "Невозможно разрезать файл!"
|
||
|
||
#: ulng.rssplitmsgmanyparts
|
||
msgid "The number of parts is more than 100! Continue?"
|
||
msgstr "Количество частей больше 100! Продолжить?"
|
||
|
||
#: ulng.rssplitpredefinedsizes
|
||
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
msgstr "Автоматически;1457664 B - 3.5\" High Density 1.44 M;1213952 B - 5.25\" High Density 1.2 M;730112 B - 3.5\" Double Density 720 K;362496 B - 5.25\" Double Density 360 K;98078 KB - ZIP 100 MB;650 MB - CD 650 MB;700 MB - CD 700 MB;4482 MB - DVD+R"
|
||
|
||
#: ulng.rssplitseldir
|
||
msgid "Select directory:"
|
||
msgstr "Выберите каталог:"
|
||
|
||
#: ulng.rsstraccents
|
||
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
|
||
#: ulng.rsstraccentsstripped
|
||
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
|
||
#: ulng.rsstrpreviewjustpreview
|
||
msgid "Just preview"
|
||
msgstr "Только просмотр"
|
||
|
||
#: ulng.rsstrpreviewothers
|
||
msgid "Others"
|
||
msgstr "Другие"
|
||
|
||
#: ulng.rsstrpreviewsearchingletters
|
||
msgid "OU"
|
||
msgstr ""
|
||
|
||
#: ulng.rsstrpreviewsidenote
|
||
msgid "Side note"
|
||
msgstr "Примечание"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched1
|
||
msgid "Flat"
|
||
msgstr "Плоский"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched2
|
||
msgid "Limited"
|
||
msgstr "Ограниченный"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched3
|
||
msgid "Simple"
|
||
msgstr "Простой"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched1
|
||
msgid "Fabulous"
|
||
msgstr "Невероятное"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched2
|
||
msgid "Marvelous"
|
||
msgstr "Чудесное"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched3
|
||
msgid "Tremendous"
|
||
msgstr "Потрясающее"
|
||
|
||
#: ulng.rsstrtvmchoosedirhistory
|
||
msgid "Choose your directory from Dir History"
|
||
msgstr "Выберите каталог из истории каталогов"
|
||
|
||
#: ulng.rsstrtvmchoosefavoritetabs
|
||
msgid "Choose you Favorite Tabs:"
|
||
msgstr "Выберите избранные вкладки:"
|
||
|
||
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
||
msgid "Choose your command from Command Line History"
|
||
msgstr "Выберите команду из истории командной строки"
|
||
|
||
#: ulng.rsstrtvmchoosefrommainmenu
|
||
msgid "Choose your action from Main Menu"
|
||
msgstr "Выберите действие из главного меню"
|
||
|
||
#: ulng.rsstrtvmchoosefromtoolbar
|
||
msgid "Choose your action from Maintool bar"
|
||
msgstr "Выберите действие из панели инструментов"
|
||
|
||
#: ulng.rsstrtvmchoosehotdirectory
|
||
msgid "Choose your directory from Hot Directory:"
|
||
msgstr "Выберите каталог из избранных каталогов:"
|
||
|
||
#: ulng.rsstrtvmchooseviewhistory
|
||
msgid "Choose your directory from File View History"
|
||
msgstr "Выберите каталог из истории просмотренных файлов"
|
||
|
||
#: ulng.rsstrtvmchooseyourfileordir
|
||
msgid "Choose your file or your directory"
|
||
msgstr "Выберите ваш файл или каталог"
|
||
|
||
#: ulng.rssymerrcreate
|
||
msgid "Error creating symlink."
|
||
msgstr "Ошибка создания символьной ссылки."
|
||
|
||
#: ulng.rssyndefaulttext
|
||
msgctxt "ulng.rssyndefaulttext"
|
||
msgid "Default text"
|
||
msgstr "Текст по умолчанию"
|
||
|
||
#: ulng.rssynlangplaintext
|
||
msgctxt "ulng.rssynlangplaintext"
|
||
msgid "Plain text"
|
||
msgstr "Простой текст"
|
||
|
||
#: ulng.rstabsactionondoubleclickchoices
|
||
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
||
msgstr "Ничего не делать;Закрыть вкладку;Доступ к избранным вкладкам;Меню вкладок"
|
||
|
||
#: ulng.rstimeunitday
|
||
msgctxt "ulng.rstimeunitday"
|
||
msgid "Day(s)"
|
||
msgstr "Дня (дней)"
|
||
|
||
#: ulng.rstimeunithour
|
||
msgid "Hour(s)"
|
||
msgstr "Часа(ов)"
|
||
|
||
#: ulng.rstimeunitminute
|
||
msgid "Minute(s)"
|
||
msgstr "Минуты (минут)"
|
||
|
||
#: ulng.rstimeunitmonth
|
||
msgid "Month(s)"
|
||
msgstr "Месяца(ев)"
|
||
|
||
#: ulng.rstimeunitsecond
|
||
msgid "Second(s)"
|
||
msgstr "Секунды (секунд)"
|
||
|
||
#: ulng.rstimeunitweek
|
||
msgid "Week(s)"
|
||
msgstr "Недели (недель)"
|
||
|
||
#: ulng.rstimeunityear
|
||
msgid "Year(s)"
|
||
msgstr "Года (лет)"
|
||
|
||
#: ulng.rstitlerenamefavtabs
|
||
msgid "Rename Favorite Tabs"
|
||
msgstr "Переименовать избранные вкладки"
|
||
|
||
#: ulng.rstitlerenamefavtabsmenu
|
||
msgid "Rename Favorite Tabs sub-menu"
|
||
msgstr "Переименовать подменю избранных вкладок"
|
||
|
||
#: ulng.rstooldiffer
|
||
msgctxt "ulng.rstooldiffer"
|
||
msgid "Differ"
|
||
msgstr "Поиск различий"
|
||
|
||
#: ulng.rstooleditor
|
||
msgctxt "ulng.rstooleditor"
|
||
msgid "Editor"
|
||
msgstr "Редактор"
|
||
|
||
#: ulng.rstoolerroropeningdiffer
|
||
msgid "Error opening differ"
|
||
msgstr "Ошибка открытия программы сравнения"
|
||
|
||
#: ulng.rstoolerroropeningeditor
|
||
msgid "Error opening editor"
|
||
msgstr "Ошибка открытия редактора"
|
||
|
||
#: ulng.rstoolerroropeningterminal
|
||
msgid "Error opening terminal"
|
||
msgstr "Ошибка открытия терминала"
|
||
|
||
#: ulng.rstoolerroropeningviewer
|
||
msgid "Error opening viewer"
|
||
msgstr "Ошибка открытия программы просмотра"
|
||
|
||
#: ulng.rstoolterminal
|
||
msgctxt "ulng.rstoolterminal"
|
||
msgid "Terminal"
|
||
msgstr "Терминал"
|
||
|
||
#: ulng.rstooltiphidetimeoutlist
|
||
msgid "System default;1 sec;2 sec;3 sec;5 sec;10 sec;30 sec;1 min;Never hide"
|
||
msgstr "Значение из системы;1 сек;2 сек;3 сек;5 сек;10 сек;30 сек;1 мин;Никогда не скрывать"
|
||
|
||
#: ulng.rstooltipmodelist
|
||
msgid "Combine DC and system tooltip, DC first (legacy);Combine DC and system tooltip, system first;Show DC tooltip when possible and system when not;Show DC tooltip only;Show system tooltip only"
|
||
msgstr "Объединить подсказку DC и системную, сначала из DC;Объединить подсказку DC и системную, сначала системная;Показать подсказку DC, если возможно, и системную, если нет;Показать только подсказку DC;Показать только системную подсказку"
|
||
|
||
#: ulng.rstoolviewer
|
||
msgctxt "ulng.rstoolviewer"
|
||
msgid "Viewer"
|
||
msgstr "Просмотр"
|
||
|
||
#: ulng.rsunhandledexceptionmessage
|
||
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
||
msgstr "Пожалуйста, сообщите о данной ошибке на баг-трекер с описанием ваших действий и файлом:%sНажмите %s для продолжения работы или %s для выхода из программы."
|
||
|
||
#: ulng.rsvarbothpanelactivetoinactive
|
||
msgid "Both panels, from active to inactive"
|
||
msgstr "Обе панели, из активной в неактивную"
|
||
|
||
#: ulng.rsvarbothpanellefttoright
|
||
msgid "Both panels, from left to right"
|
||
msgstr "Обе панели, слева направо"
|
||
|
||
#: ulng.rsvarcurrentpath
|
||
msgid "Path of panel"
|
||
msgstr "Путь панели"
|
||
|
||
#: ulng.rsvarencloseelement
|
||
msgid "Enclose each name in brackets or what you want"
|
||
msgstr "Заключить каждое имя в квадратные скобки или что вы хотите"
|
||
|
||
#: ulng.rsvarfilenamenoext
|
||
msgid "Just filename, no extension"
|
||
msgstr "Только имя файла, без расширения"
|
||
|
||
#: ulng.rsvarfullpath
|
||
msgid "Complete filename (path+filename)"
|
||
msgstr "Полное имя файла (путь + имя файла)"
|
||
|
||
#: ulng.rsvarhelpwith
|
||
msgid "Help with \"%\" variables"
|
||
msgstr "Помощь с переменными \"%\""
|
||
|
||
#: ulng.rsvarinputparam
|
||
msgid "Will request request user to enter a parameter with a default suggested value"
|
||
msgstr "Запрос ввода параметра со значением по умолчанию"
|
||
|
||
#: ulng.rsvarleftpanel
|
||
msgid "Left panel"
|
||
msgstr "Левая панель"
|
||
|
||
#: ulng.rsvarlistfilename
|
||
msgid "Temporary filename of list of filenames"
|
||
msgstr "Временный файл со списком имён файлов"
|
||
|
||
#: ulng.rsvarlistfullfilename
|
||
msgid "Temporary filename of list of complete filenames (path+filename)"
|
||
msgstr "Временный файл со списком полных имён файлов (путь+имя файла)"
|
||
|
||
#: ulng.rsvarlistinutf16
|
||
msgid "Filenames in list in UTF-16 with BOM"
|
||
msgstr "Список в UTF-16LE с BOM"
|
||
|
||
#: ulng.rsvarlistinutf16quoted
|
||
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
||
msgstr "Список в UTF-16LE с BOM, имена заключены в кавычки"
|
||
|
||
#: ulng.rsvarlistinutf8
|
||
msgid "Filenames in list in UTF-8"
|
||
msgstr "Список в UTF-8"
|
||
|
||
#: ulng.rsvarlistinutf8quoted
|
||
msgid "Filenames in list in UTF-8, inside double quotes"
|
||
msgstr "Список в UTF-8, имена заключены в кавычки"
|
||
|
||
#: ulng.rsvarlistrelativefilename
|
||
msgid "Temporary filename of list of filenames with relative path"
|
||
msgstr "Временный файл со списком имён файлов с относительным путем"
|
||
|
||
#: ulng.rsvaronlyextension
|
||
msgid "Only file extension"
|
||
msgstr "Только расширение файла"
|
||
|
||
#: ulng.rsvaronlyfilename
|
||
msgid "Only filename"
|
||
msgstr "Только имя файла"
|
||
|
||
#: ulng.rsvarotherexamples
|
||
msgid "Other example of what's possible"
|
||
msgstr "Прочие возможные примеры"
|
||
|
||
#: ulng.rsvarpath
|
||
msgid "Path, without ending delimiter"
|
||
msgstr "Путь без разделителя в конце"
|
||
|
||
#: ulng.rsvarpercentchangetopound
|
||
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
||
msgstr "Отсюда и до конца строки указателем переменной с процентами будет знак \"#\""
|
||
|
||
#: ulng.rsvarpercentsign
|
||
msgid "Return the percent sign"
|
||
msgstr "Возвращает знак процента"
|
||
|
||
#: ulng.rsvarpoundchangetopercent
|
||
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
||
msgstr "Обратно, отсюда и до конца строки указателем переменной с процентами будет знак \"%\""
|
||
|
||
#: ulng.rsvarprependelement
|
||
msgid "Prepend each name with \"-a \" or what you want"
|
||
msgstr "Представить каждое имя в виде \"-a \" или как вы хотите"
|
||
|
||
#: ulng.rsvarpromptuserforparam
|
||
msgid "%[Prompt user for param;Default value proposed]"
|
||
msgstr "%[Запрос;Значение по умолчанию]"
|
||
|
||
#: ulng.rsvarrelativepathandfilename
|
||
msgid "Filename with relative path"
|
||
msgstr "Имя файла с относительным путем"
|
||
|
||
#: ulng.rsvarrightpanel
|
||
msgid "Right panel"
|
||
msgstr "Правая панель"
|
||
|
||
#: ulng.rsvarsecondelementrightpanel
|
||
msgid "Full path of second selected file in right panel"
|
||
msgstr "Полный путь второго выбранного файла в правой панели"
|
||
|
||
#: ulng.rsvarshowcommandprior
|
||
msgid "Show command prior execute"
|
||
msgstr "До выполнения показать команду"
|
||
|
||
#: ulng.rsvarsimplemessage
|
||
msgid "%[Simple message]"
|
||
msgstr "%[Простое сообщение]"
|
||
|
||
#: ulng.rsvarsimpleshowmessage
|
||
msgid "Will show a simple message"
|
||
msgstr "Будет показано простое сообщение"
|
||
|
||
#: ulng.rsvarsourcepanel
|
||
msgid "Active panel (source)"
|
||
msgstr "Активная панель (источник)"
|
||
|
||
#: ulng.rsvartargetpanel
|
||
msgid "Inactive panel (target)"
|
||
msgstr "Неактивная панель (назначение)"
|
||
|
||
#: ulng.rsvarwillbequoted
|
||
msgid "Filenames will be quoted from here (default)"
|
||
msgstr "Имена файлов будут взяты в кавычки (по умолчанию)"
|
||
|
||
#: ulng.rsvarwilldointerminal
|
||
msgid "Command will be done in terminal, remaining opened at the end"
|
||
msgstr "Команда будет выполнена в терминале, терминал останется открытым"
|
||
|
||
#: ulng.rsvarwillhaveendingdelimiter
|
||
msgid "Paths will have ending delimiter"
|
||
msgstr "Пути с разделителем в конце"
|
||
|
||
#: ulng.rsvarwillnotbequoted
|
||
msgid "Filenames will not be quoted from here"
|
||
msgstr "Имена файлов не будут взяты в кавычки"
|
||
|
||
#: ulng.rsvarwillnotdointerminal
|
||
msgid "Command will be done in terminal, closed at the end"
|
||
msgstr "Команда будет выполнена в терминале, после этого терминал будет закрыт"
|
||
|
||
#: ulng.rsvarwillnothaveendingdelimiter
|
||
msgid "Paths will not have ending delimiter (default)"
|
||
msgstr "Пути без разделителя в конце (по умолчанию)"
|
||
|
||
#: ulng.rsvfsnetwork
|
||
msgctxt "ulng.rsvfsnetwork"
|
||
msgid "Network"
|
||
msgstr "Сеть"
|
||
|
||
#: ulng.rsviewabouttext
|
||
msgid "Internal Viewer of Double Commander."
|
||
msgstr "Внутренняя программа просмотра Double Commander"
|
||
|
||
#: ulng.rsviewbadquality
|
||
msgid "Bad Quality"
|
||
msgstr "Некорректное качество"
|
||
|
||
#: ulng.rsviewencoding
|
||
msgctxt "ulng.rsviewencoding"
|
||
msgid "Encoding"
|
||
msgstr "Кодировка"
|
||
|
||
#: ulng.rsviewimagetype
|
||
msgid "Image Type"
|
||
msgstr "Тип файла"
|
||
|
||
#: ulng.rsviewnewsize
|
||
msgctxt "ulng.rsviewnewsize"
|
||
msgid "New Size"
|
||
msgstr "Новый размер"
|
||
|
||
#: ulng.rsviewnotfound
|
||
msgid "%s not found!"
|
||
msgstr "%s не найден!"
|
||
|
||
#: ulng.rsviewpainttoolslist
|
||
msgid "Pen;Rect;Ellipse"
|
||
msgstr "Карандаш;Прямоугольник;Эллипс"
|
||
|
||
#: ulng.rsviewwithexternalviewer
|
||
msgid "with external viewer"
|
||
msgstr "во внешнем просмотрщике"
|
||
|
||
#: ulng.rsviewwithinternalviewer
|
||
msgid "with internal viewer"
|
||
msgstr "во встроенном просмотрщике"
|
||
|
||
#: ulng.rsxreplacements
|
||
msgid "Number of replacement: %d"
|
||
msgstr "Число замен: %d"
|
||
|
||
#: ulng.rszeroreplacement
|
||
msgid "No replacement took place."
|
||
msgstr "Замена не состоялась."
|
||
|