doublecmd/language/doublecmd.bg.po
2017-07-22 17:31:00 +00:00

12460 lines
348 KiB
Text
Raw Blame History

This file contains ambiguous Unicode characters

This file contains Unicode characters that might be confused with other characters. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2017-07-17 08:36+0300\n"
"Last-Translator: sstpr@narod.ru\n"
"Language-Team: Language <sstpr@narod.ru>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Language: bg\n"
"X-Native-Language: български\n"
"X-Generator: Poedit 1.8.9\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Сравняване... %d%% (ESC за отказ)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Дясно: Изтриване на %d файл(а)"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Намерини файлове: %d (еднакви: %d, различни: %d, неповтарящи отляво: %d, неповтарящи отдясно: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Отляво надясно: Презапис на %d файл с общ размер %d байта"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Отдясно наляво: Презапис на %d файл с общ размер %d байта"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Избор на шаблон..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Проверка на свободното &пространство"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Презапис на &принадлежностите"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Презапис на &собствеността"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Презапис на &разрешенията"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Презапис на &времето и датата"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Поправяне на в&ръзките"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
msgid "Drop readonly fla&g"
msgstr "Изоставяне на стяга „само за четене“"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Из&ключване на празните папки"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "&Следване на връзките"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "Запазване на &място"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Действие, при невъзможност за задаване на време, принадлежности и т.н."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Когато &папката съществува"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When &file exists"
msgstr "Когато &файлът съществува"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<няма шаблон>"
#: tfrmabout.btnclose.caption
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Затваряне"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Запомняне"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "За"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Постройка"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Домашна страница:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Преработка"
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Издание"
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "О&чистване"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Изберете принадлежности"
#: tfrmattributesedit.cbarchive.caption
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
msgid "&Archive"
msgstr "&Архив"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Уп&лътнен"
#: tfrmattributesedit.cbdirectory.caption
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
msgid "&Directory"
msgstr "&Папка"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "&Криптиран"
#: tfrmattributesedit.cbhidden.caption
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
msgid "&Hidden"
msgstr "С&крит"
#: tfrmattributesedit.cbreadonly.caption
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
msgid "Read o&nly"
msgstr "Само за &четене"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr ""
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr ""
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Лепкав"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr ""
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Мека връзка"
#: tfrmattributesedit.cbsystem.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "&Системен"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Временен"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Принадлежности по NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Об щи принадлежности"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Разряда:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Група"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Друго:"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Собственик"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Изпълнение"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Запис"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Като &текст:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Четене"
#: tfrmchecksumcalc.caption
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Изчисляване на проверочен сбор..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr ""
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "Съз&даване на отделни проверочни сборове за всички файлове"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "&Съхраняване на файла/овете с проверочните сборове в:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Затваряне"
#: tfrmchecksumverify.caption
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Сверяване на проверочен сбор..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "&Добавяне"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "&Закачане"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "Из&триване"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "Об&работка"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Управител на свързванията"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Закачане към:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "&Добавяне към опашка"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "Въз&можности"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "&Съхраняване на настройките като подразбирани"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Презапис на файл(ове)"
#: tfrmcopydlg.mnunewqueue.caption
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Нова опашка"
#: tfrmcopydlg.mnuqueue1.caption
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Опашка 1"
#: tfrmcopydlg.mnuqueue2.caption
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Опашка 2"
#: tfrmcopydlg.mnuqueue3.caption
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Опашка 3"
#: tfrmcopydlg.mnuqueue4.caption
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Опашка 4"
#: tfrmcopydlg.mnuqueue5.caption
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Опашка 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Запис на описанието"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Бележки за файл/папка"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "Про&мяна на бележката за:"
#: tfrmdescredit.lblencoding.caption
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "&Знаков набор:"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "За"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Автоматично сравняване"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Двоичен режим"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Отказ"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Отказ"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Замяна в дясното крило със съдържанието от лявото"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Замяна в дясното крило със съдържанието от лявото"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Замяна в лявото крило със съдържанието от дясното"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Замяна в лявото крило със съдържанието от дясното"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Запомняне"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Изрязване"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Изтриване"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Поставяне"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Връщане"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Избор на вси&чко"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Отмяна"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "Из&ход"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Първа разлика"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "tfrmdiffer.actfirstdifference.hint"
msgid "First Difference"
msgstr "Първа разлика"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Пренебрегване на ГЛавноСТта"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Пренебрегване на празните знаци"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Съгласувано превъртане"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Последна разлика"
#: tfrmdiffer.actlastdifference.hint
msgctxt "tfrmdiffer.actlastdifference.hint"
msgid "Last Difference"
msgstr "Последна разлика"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Изтъкване на разликите в редовете"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Следваща разлика"
#: tfrmdiffer.actnextdifference.hint
msgctxt "tfrmdiffer.actnextdifference.hint"
msgid "Next Difference"
msgstr "Следваща разлика"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Отваряне в лявото крило..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Отваряне в дясното крило..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr ""
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Предходна разлика"
#: tfrmdiffer.actprevdifference.hint
msgctxt "tfrmdiffer.actprevdifference.hint"
msgid "Previous Difference"
msgstr "Предходна разлика"
#: tfrmdiffer.actreload.caption
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
msgid "&Reload"
msgstr "&Презареждане"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Презареждане"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Съхраняване"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Съхраняване"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Съхраняване като..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Съхраняване като..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Съхраняване на съдържанието на лявото крило"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Съхраняване на съдържанието на лявото крило"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Съхраняване на съдържанието на лявото крило като..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Съхраняване на съдържанието на лявото крило като..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Съхраняване на съдържанието на дясното крило"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Съхраняване на съдържанието на дясното крило"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Съхраняване на съдържанието на дясното крило като..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Съхраняване на съдържанието на дясното крило като..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Сравняване"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Сравняване"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Знаков набор"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Знаков набор"
#: tfrmdiffer.caption
msgctxt "TFRMDIFFER.CAPTION"
msgid "Compare files"
msgstr "Сравняване на файлове"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Ляво"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "&Дясно"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Действия"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "Об&работка"
#: tfrmdiffer.mnuencoding.caption
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "&Знаков набор"
#: tfrmdiffer.mnufile.caption
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "&Файл"
#: tfrmdiffer.mnuoptions.caption
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
msgid "&Options"
msgstr "Въз&можности"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr ""
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr ""
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
msgctxt "tfrmedithotkey.cghkcontrols.caption"
msgid "Only for these controls"
msgstr ""
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr ""
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr ""
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "За"
#: tfrmeditor.actabout.hint
msgctxt "tfrmeditor.actabout.hint"
msgid "About"
msgstr "За"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Настройка"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Настройка"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Запомняне"
#: tfrmeditor.acteditcopy.hint
msgctxt "tfrmeditor.acteditcopy.hint"
msgid "Copy"
msgstr "Запомняне"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Изрязване"
#: tfrmeditor.acteditcut.hint
msgctxt "tfrmeditor.acteditcut.hint"
msgid "Cut"
msgstr "Изрязване"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Изтриване"
#: tfrmeditor.acteditdelete.hint
msgctxt "tfrmeditor.acteditdelete.hint"
msgid "Delete"
msgstr "Изтриване"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Търсене"
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Търсене"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Намиране на следващо:"
#: tfrmeditor.acteditfindnext.hint
msgctxt "tfrmeditor.acteditfindnext.hint"
msgid "Find next"
msgstr "Намиране на следващо:"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Намиране на предходно:"
#: tfrmeditor.acteditgotoline.caption
msgctxt "tfrmeditor.acteditgotoline.caption"
msgid "Goto Line..."
msgstr "Отиване на ред..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Мак (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "tfrmeditor.acteditlineendcr.hint"
msgid "Mac (CR)"
msgstr "Мак (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Юникс (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "tfrmeditor.acteditlineendlf.hint"
msgid "Unix (LF)"
msgstr "Юникс (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Поставяне"
#: tfrmeditor.acteditpaste.hint
msgctxt "tfrmeditor.acteditpaste.hint"
msgid "Paste"
msgstr "Поставяне"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Връщане"
#: tfrmeditor.acteditredo.hint
msgctxt "tfrmeditor.acteditredo.hint"
msgid "Redo"
msgstr "Връщане"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Замяна"
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Замяна"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Избор на вси&чки"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Избор на всички"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Отмяна"
#: tfrmeditor.acteditundo.hint
msgctxt "tfrmeditor.acteditundo.hint"
msgid "Undo"
msgstr "Отмяна"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Затваряне"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Затваряне"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "Из&ход"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Изход"
#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "&Нов"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Нов"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Отваряне"
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Отваряне"
#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Съхраняване"
#: tfrmeditor.actfilesave.hint
msgctxt "tfrmeditor.actfilesave.hint"
msgid "Save"
msgstr "Съхраняване"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Съхраняване &като..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Съхраняване &като"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Съ&храняване на всички"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Съхраняване на всички"
#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr "Обработчик"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "Помо&щ"
#: tfrmeditor.menuitem1.caption
#, fuzzy
msgctxt "tfrmeditor.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Обработка"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Знаков набор"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Отваряне като"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Съхраняване като"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Файл"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Синтактично подчертаване"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Край на реда"
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n5.caption
msgctxt "TFRMEDITOR.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&Добре"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
msgid "C&ase sensitivity"
msgstr "Отчитане на &глаВноСТта"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
msgid "S&earch from caret"
msgstr "Търсене на&долу"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "&Обичайни изрази"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
msgid "Selected &text only"
msgstr "Само избрания &текст"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
msgid "&Whole words only"
msgstr "&Само цели думи"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
msgid "Option"
msgstr "Възможност"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
msgid "&Replace with:"
msgstr "&Замяна с:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
msgid "&Search for:"
msgstr "&Търсене от:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
msgid "Direction"
msgstr "Посока"
#: tfrmextractdlg.caption
msgctxt "TFRMEXTRACTDLG.CAPTION"
msgid "Unpack files"
msgstr "Извличане на файлове"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Разгъване на имената на пътищата, ако са съхранени във файловете"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Разгъване на всеки архив в отделна папка (според името на архива)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "&Замяна на съществуващите файлове"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Извличане на файл в:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "&Извличане на файловете, отговарящи на пресяването"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "&Парола за кодираните файлове"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Затваряне"
#: tfrmfileexecuteyourself.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
msgid "Wait..."
msgstr "Изчакване..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Файлово име:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "От:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr ""
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "В &крилото"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "Показване на вси&чки"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Текущо действие:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "От:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "В:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Затваряне"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "Задаване на &свойства"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr ""
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Пропускане на &този файл"
#: tfrmfileproperties.caption
msgctxt "TFRMFILEPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Свойства"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr ""
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Лепкав"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr ""
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Собственик"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Разряда:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Група"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Друго:"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Собственик"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Текст:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "tfrmfileproperties.lblcontains.caption"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Съдържа:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Изпълнение"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Файлово име"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Файлово име"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Път:"
#: tfrmfileproperties.lblgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
msgid "&Group"
msgstr "&Група"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Последно използване:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Последна промяна:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Последна промяна на състоянието:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Осмично:"
#: tfrmfileproperties.lblownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
msgid "O&wner"
msgstr "Со&бственик"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Запис"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Размер:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Мека връзка към:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Вид:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Четене"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Име"
#: tfrmfileproperties.sgimage.columns[1].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr ""
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Принадлежности"
#: tfrmfileproperties.tsimage.caption
msgid "Image"
msgstr ""
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Свойства"
#: tfrmfinddlg.actcancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "Отказ"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr ""
#: tfrmfinddlg.actclose.caption
#, fuzzy
#| msgid "Close"
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "Затваряне"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr ""
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr ""
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
#, fuzzy
#| msgid "Go to file"
msgid "&Go to file"
msgstr "Отиване до файл"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Търсене на данни"
#: tfrmfinddlg.actlastsearch.caption
#, fuzzy
#| msgid "Last search"
msgid "&Last search"
msgstr "Последно търсене"
#: tfrmfinddlg.actnewsearch.caption
#, fuzzy
#| msgid "New search"
msgid "&New search"
msgstr "Ново търсене"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Отиване на страница „Разширени‟"
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Отиване на страница „Зареждане/съхраняване‟"
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Отиване на страница „Приставки‟"
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Отиване на страница „Резултат‟"
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Отиване на страница „Обичайна‟"
#: tfrmfinddlg.actstart.caption
#, fuzzy
#| msgid "Start"
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "Начало"
#: tfrmfinddlg.actview.caption
#, fuzzy
#| msgid "View"
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "Изглед"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Добавяне"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "Помо&щ"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Съхраняване"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "Из&триване"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "За&реждане"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "&Съхраняване"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr ""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr ""
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr ""
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Търсене на файлове"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Отчитане на глАВноСТта"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "Дата &от:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Дата &до:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "Файлов &размер от:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Файлов раз&мер до:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "Търсене в &архиви"
#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "Търсене във файл"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgctxt "tfrmfinddlg.cbfollowsymlinks.caption"
msgid "Follow s&ymlinks"
msgstr "Следване на &меките връзки"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "Намиране на файлове НЕсъдържащи текста"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Не по- &стар от:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Отворени подпрозорци"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Търсене за &част от името"
#: tfrmfinddlg.cbregexp.caption
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "&Обичайни изрази"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "За&мяна с"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr ""
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr ""
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "Време &от:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "Време &до:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "Използване на приставка за търсене:"
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr ""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr ""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr ""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Папки"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Файлове"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Търсене на данни"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Прин&адлежности:"
#: tfrmfinddlg.lblencoding.caption
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
msgid "Encodin&g:"
msgstr "Знаков &набор:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "Изключване на &подпапките"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Изключване на &файловете"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "Файл"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Започване в &папка"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Търсене на по&дпапки:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "Пре&дишни търсения:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Отваряне в нов подпрозорец/ци"
#: tfrmfinddlg.mioptions.caption
#, fuzzy
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Възможности"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "изтриване от списъка"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.miseparator1.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.miseparator2.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Показване на всички намерени предмети"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Показване в обработчика"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Показване в прегледа"
#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Преглед"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Разширени"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Зареждане/ Съхраняване"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Приставки"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Намерено"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Обичайно"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Търсене"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Търсене"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "Отчитане на &глаВНостТА"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Създаване на твърда връзка"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Съществуваща &цел, към която да сочи връзката"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "&Име на връзката"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr ""
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr ""
#: tfrmhotdirexportimport.caption
msgctxt "tfrmhotdirexportimport.caption"
msgid "Select the entries your want to import"
msgstr ""
#: tfrmhotdirexportimport.lbhint.caption
msgctxt "tfrmhotdirexportimport.lbhint.caption"
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr ""
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr ""
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgctxt "TFRMLINKER.CAPTION"
msgid "Linker"
msgstr "Сглобяване на файл"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Съхраняване в..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Предмет"
#: tfrmlinker.lblfilename.caption
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "Файлово &име"
#: tfrmlinker.spbtndown.caption
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "На&долу"
#: tfrmlinker.spbtndown.hint
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
msgid "Down"
msgstr "Надолу"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "Пре&махване"
#: tfrmlinker.spbtnrem.hint
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "Из&триване"
#: tfrmlinker.spbtnup.caption
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "На&горе"
#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Нагоре"
#: tfrmmain.actabout.caption
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
msgid "&About"
msgstr "&За"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Добавяне името на файла в командния ред"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Добавяне на пътя и файловото име в командния ред"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Преписване на пътя в реда управление"
#: tfrmmain.actbriefview.caption
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr "Съкратен"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Съкратен изглед"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Изчисляване на &заетото място..."
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Смяна на папката"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Отиване в домашната папка"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Папка нагоре"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "В основната папка"
#: tfrmmain.actchecksumcalc.caption
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "Изчисляване на проверочен &сбор..."
#: tfrmmain.actchecksumverify.caption
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "&Потвърждаване на проверочен сбор..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Изчистване на дневника"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Изчистване на прозореца на дневника"
#: tfrmmain.actclosealltabs.caption
msgctxt "tfrmmain.actclosealltabs.caption"
msgid "Close &All Tabs"
msgstr "Затваряне на вси&чки подпрозорци"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Затваряне на повтарящите се подпрозорци"
#: tfrmmain.actclosetab.caption
msgctxt "tfrmmain.actclosetab.caption"
msgid "&Close Tab"
msgstr "&Затваряне на подпрозореца"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr ""
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr ""
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr ""
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr ""
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Пълен"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Стълбов изглед"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Сравняване по &съдържание"
#: tfrmmain.actcomparedirectories.caption
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
msgid "Compare Directories"
msgstr "Сравняване на папките"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Сравняване на папките"
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Настройка на предпочитаните папки"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Настройка на предпочитаните подпрозорци"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Настройка на подпрозорците за папките"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr ""
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Лента с пособия..."
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Настройка на дървовидния изглед"
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Показване на изскачащ изборник"
#: tfrmmain.actcopy.caption
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Презапис"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Презапис на всички подпрозорци от другата страна"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Запомняне на всички из§брани стълбове"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Запомняне на файловото/ите име/на и пълния &път"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Запомняне на &файловото/ите име/на в кошницата"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Презапис на файловете без искане на потвърждение"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr ""
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Запомняне на пълния път на избрания файл(ове)"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Презапис в същото крило"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "Запомняне"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "&Показване на заетото място"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Изрязване"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr ""
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Изтриване"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "Дневник на папката"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "&Бързодостъпни папки"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr ""
#: tfrmmain.actedit.caption
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Обработка"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Промяна на &бележката..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Обработка на нов файл"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Обработка на полето за пътя над файловия списък"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Размяна на &крилата"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "Из&ход"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "Из&вличане на файлове..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Настройка на файловите об&вързвания..."
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "С&глобяване на файлове..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Показване на файловите &свойства"
#: tfrmmain.actfilespliter.caption
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
msgid "Spl&it File..."
msgstr "Раз&дробяване на файл"
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "&Плосък изглед"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Сочене на реда за управление"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr ""
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr ""
#: tfrmmain.acthardlink.caption
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
msgid "Create &Hard Link..."
msgstr "Създаване на &твърда връзка..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "Съ&държание"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "&Водоравно подреждане на крилата"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Клавиатура"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr ""
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr ""
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Ляво &= дясно"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr ""
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Първо се отваря лявото крило"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr ""
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr ""
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr ""
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr ""
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr ""
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr ""
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr ""
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "Зареждане на подпрозорци от списък с предпочитания"
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Зареждане на отбелязването от ко&шницата"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "&Зареждане на отбелязването от файл"
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "&Зареждане на подпрозорци от файл"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "&Нова папка"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Избор на всички със същото раз&ширение"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "О&бръщане на избора"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "Избор на вси&чки"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "С&немане на избора от група"
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "Избор на &група"
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "С&немане на избора от всички"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Смаляване на прозореца"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "&Множествено преименуване"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Зака&чане към мрежа..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "&Разкачане от мрежа"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Бързо зака&чане към мрежа..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Нов подпрозорец"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Преминаване на следва&щия подпрозорец"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Отваряне"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Опит за отваряне на файл"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Отваряне на файл за ленти с пособия"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Отваряне на &папката в нов подпрозорец"
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
msgid "Open &VFS List"
msgstr "Отваряне на &VFS списък"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "Преглед на &действията"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "Въз&можности..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "Сбиване на файлове..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Задаване на положението на разделителя"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "Поставяне"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Преминаване към пред&ходния подпрозорец"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Бързо пресяване"
#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Бързо търсене"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "Крило за &бърз преглед"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "О&пресняване"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Презареждане на последния зареден списък с предпочитания"
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Местене"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Местене/ преименуване без искане на потвърждение"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Преименуване"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "Пре&именуване на подпрозореца"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Съхраняване на текущите подпрозорци в последния зареден списък с предпочитания"
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "Въз&становяване на отбелязването"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "О&бръщане на реда"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Съкратен преглед в дясното крило"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr ""
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Десен &= Ляв"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr ""
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Първо се отваря дясното крило"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr ""
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr ""
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr ""
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr ""
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr ""
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr ""
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr ""
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Отваряне на &терминала"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Съхраняване на текущите подпрозорци в нов списък с предпочитания"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Съхраняване на от&белязването"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Съхраняване на отбелязването във &файл"
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "&Съхраняване на подпрозорците във файл"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Търсене..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr ""
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr ""
#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "Промяна на &принадлежностите..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Заключен, с отваряне на папките в нови подпрозор&ци"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Обикновен"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Заключен"
#: tfrmmain.actsettaboptionpathresets.caption
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
msgid "Locked with &Directory Changes Allowed"
msgstr "Заключен, с разрешена смяна на &папката"
#: tfrmmain.actshellexecute.caption
msgctxt "tfrmmain.actshellexecute.caption"
msgid "Open"
msgstr "Отваряне"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr ""
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Показване на изборници на копчетата"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Показване на дневник на реда управление"
#: tfrmmain.actshowmainmenu.caption
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Изборник"
#: tfrmmain.actshowsysfiles.caption
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "Показване на &скрити/ системни файлове"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Подреждане по &принадлежности"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Подреждане по &дата"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Подреждане по раз&ширение"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Подреждане по &име"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Подреждане по раз&мер"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr ""
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Включване/ изключване на пренебрегването"
#: tfrmmain.actsymlink.caption
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "Създаване на &мека връзка..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr "Съгласуване на папки..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Цел &= източник"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "&Проверка на архив(и)"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Миниатюри"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Изглед с миниатюри"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr ""
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Прехвърляне на папката под показалеца в левия прозорец"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Прехвърляне на папката под показалеца в десния прозорец"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "Крило за &дървовиден изглед"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr ""
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Снемане на избора на всички със същото раз&ширение"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Преглед"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Показване на списъка на посетените пътища в дейния преглед"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Към следващата точка от дневника"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Към предходната точка от дневника"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr ""
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Посещаване на мрежовото място на Double Commander"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Унищожаване"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr ""
#: tfrmmain.btnf10.caption
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Изход"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Папка"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Изтриване"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Терминал"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr ""
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr ""
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Отиване в домашната папка"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Отиване в основната папка"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Отива е по-горната папка"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Бързодостъпни папки"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr ""
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "tfrmmain.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Път"
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Отказ"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Презапис..."
#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Създаване на връзка..."
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline10.caption
msgctxt "tfrmmain.miline10.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline11.caption
msgctxt "tfrmmain.miline11.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline21.caption
msgctxt "tfrmmain.miline21.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline23.caption
msgctxt "tfrmmain.miline23.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline26.caption
msgctxt "tfrmmain.miline26.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline33.caption
msgctxt "tfrmmain.miline33.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline37.caption
msgctxt "TFRMMAIN.MILINE37.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline38.caption
msgctxt "tfrmmain.miline38.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline39.caption
msgctxt "tfrmmain.miline39.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline40.caption
msgctxt "tfrmmain.miline40.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline50.caption
msgctxt "tfrmmain.miline50.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline55.caption
#, fuzzy
msgctxt "tfrmmain.miline55.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Изчистване"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Запомняне"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Скриване"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Избор на всички"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Преместване..."
#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Създаване на мека взръзка..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Възможности за подпрозорците"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "Из&ход"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Показване"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "tfrmmain.mnualloperstart.caption"
msgid "Start"
msgstr "Начало"
#: tfrmmain.mnualloperstop.caption
msgctxt "tfrmmain.mnualloperstop.caption"
msgid "Cancel"
msgstr "Отказ"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Заповеди"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "&Настройка"
#: tfrmmain.mnucontextline1.caption
msgctxt "tfrmmain.mnucontextline1.caption"
msgid "-"
msgstr "-"
#: tfrmmain.mnucontextline2.caption
msgctxt "tfrmmain.mnucontextline2.caption"
msgid "-"
msgstr "-"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Предпочитани"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Файлове"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "Помо&щ"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Избор"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Мрежа"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Изглед"
#: tfrmmain.mnutaboptions.caption
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "Въз&можности на подпрозорците"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Подпрозорци"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr ""
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Запомняне"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Изрязване"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Изтриване"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Обработка"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Поставяне"
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&Добре"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr ""
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr ""
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr ""
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr ""
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr ""
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr ""
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Подсказка\""
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Помощ"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Клавишно съчетание"
#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Добавяне"
#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "Помо&щ"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "За&даване..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Отчитане на глАВноСТта"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr ""
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr ""
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Създаване на нова папка"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "Напишете &име за новата папка:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "TFRMMODVIEW.CAPTION"
msgid "New Size"
msgstr "Нова размер"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Височина:"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgctxt "tfrmmodview.lblpath2.caption"
msgid "2"
msgstr ""
#: tfrmmodview.lblpath3.caption
msgctxt "tfrmmodview.lblpath3.caption"
msgid "3"
msgstr ""
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr ""
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr ""
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Качество на уплътняване в jpg"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Ширина:"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr ""
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr ""
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr ""
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr ""
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr ""
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr ""
#: tfrmmodview.tequality.text
msgid "80"
msgstr ""
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Ширина"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Затваряне"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "Из&триване"
#: tfrmmultirename.btnedit.caption
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "Об&работка"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "За&реждане"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "Пре&именуване"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Очистване на вси&чки"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Съхраняване"
#: tfrmmultirename.caption
msgctxt "tfrmmultirename.caption"
msgid "MultiRename"
msgstr "Множествено преименуване"
#: tfrmmultirename.cblog.caption
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "&Разрешаване"
#: tfrmmultirename.cbregexp.caption
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "&Обичайни изрази"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "Използване на &заместване"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Разширение"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Брояч"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Търсене &и замяна"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Име на дневника"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Имена"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Предустановки"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "Раз&ширение"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "&Търсене..."
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "Про&междутък"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "Файлово &име"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "За&мяна..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "&Начална стойност"
#: tfrmmultirename.lbwidth.caption
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "&Ширина"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Брояч"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Ден"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Ден (2 цифри)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr ""
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr ""
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Знак na положение x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Знак от положение x на y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Час"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Час (2 цифри)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Минута"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Минута (2 цифри)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Месец"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Месец (2 цифри)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Име на месеца (кратко, например „ян‟)"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMM] Име на месеца (кратко, например „януари‟)"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Име"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Знак на положение x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Знаци от положение x до положение y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Време..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Разширение..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Име..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Приставка"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Секунда"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Секунда (2 цифри)"
#: tfrmmultirename.miyear.caption
#, fuzzy
#| msgid "[Y] Year"
msgid "[Y] Year (2 digits)"
msgstr "[Y] Година"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Година (4 цифри)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Промяна на имената"
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Зареждане на имената от файл..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
msgid "Old File Name"
msgstr "Сегашно име"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
msgid "New File Name"
msgstr "Бъдещо име"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
msgid "File Path"
msgstr "Път"
#: tfrmmultirenamewait.caption
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr ""
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr ""
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr ""
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr ""
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr ""
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr ""
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr ""
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr ""
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr ""
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr ""
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr ""
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr ""
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr ""
#: tfrmoptions.btnapply.caption
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
msgid "&Apply"
msgstr "&Прилагане"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Възможности"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Изберете някоя от подстраниците, тази не съдържа настройки."
#: tfrmoptionsarchivers.btnautoconfig.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNAUTOCONFIG.CAPTION"
msgid "A&uto Configure"
msgstr ""
#: tfrmoptionsarchivers.btnmultiarcadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
msgid "A&dd"
msgstr "&Добавяне"
#: tfrmoptionsarchivers.btnmultiarcapply.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCAPPLY.CAPTION"
msgid "A&pply"
msgstr "&Прилагане"
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCDELETE.CAPTION"
msgid "D&elete"
msgstr "Из&триване"
#: tfrmoptionsarchivers.btnmultiarcrename.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
msgid "&Rename"
msgstr "Пре&махване"
#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCDEBUG.CAPTION"
msgid "De&bug mode"
msgstr "Режим за про&следяване на недъзи"
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCENABLED.CAPTION"
msgid "E&nabled"
msgstr "&Включен"
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCOUTPUT.CAPTION"
msgid "S&how console output"
msgstr "Показване на изхода към &конзолата"
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
msgid "Options"
msgstr "Възможности"
#: tfrmoptionsarchivers.lblarchiveadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEADD.CAPTION"
msgid "Add&ing:"
msgstr "&Добавяне:"
#: tfrmoptionsarchivers.lblarchiveextension.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTENSION.CAPTION"
msgid "E&xtension:"
msgstr "Раз&ширение:"
#: tfrmoptionsarchivers.lblarchiveextract.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTRACT.CAPTION"
msgid "Ex&tract:"
msgstr "Из&вличане:"
#: tfrmoptionsarchivers.lblarchivelist.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELIST.CAPTION"
msgid "&List:"
msgstr "&Списък:"
#: tfrmoptionsarchivers.lblarchivelistend.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTEND.CAPTION"
msgid "Listing &finish (optional):"
msgstr "&Край на списъка (избираемо):"
#: tfrmoptionsarchivers.lblarchivelistformat.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTFORMAT.CAPTION"
msgid "Listing for&mat:"
msgstr "Из&писване на списъка:"
#: tfrmoptionsarchivers.lblarchiveliststart.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTSTART.CAPTION"
msgid "Listin&g start (optional):"
msgstr "&Начало на списъка (избираемо):"
#: tfrmoptionsarchivers.lblarchiver.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVER.CAPTION"
msgid "Arc&hiver:"
msgstr "&Архиватор:"
#: tfrmoptionsarchivers.lbldescription.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLDESCRIPTION.CAPTION"
msgid "De&scription:"
msgstr "О&писание:"
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
msgid "Additional"
msgstr "Допълнителни"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
msgid "General"
msgstr "Общи"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
msgid "When &size, date or attributes change"
msgstr "При промяна на раз&мера, датата и принадлежностите"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "За следните &пътища и подпапките им:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
msgid "When &files are created, deleted or renamed"
msgstr "При съз&даване, изтриване или преименуване на файлове"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
msgid "When application is in the &background"
msgstr "Когато приложението е на &заден план"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
msgid "Disable auto-refresh"
msgstr "Без самоопресняване"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
msgid "Refresh file list"
msgstr "Опресняване на файловия списък"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
msgid "Al&ways show tray icon"
msgstr "Винаги да се показва значе в &уведомителката"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Автоматично с&криване на разкачените устройства"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
msgid "Mo&ve icon to system tray when minimized"
msgstr "Смаляване в уведомителката"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
msgid "A&llow only one copy of DC at a time"
msgstr "Позволено е само &едно пускане на DC наведнъж"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr ""
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "&Черен списък на устройствата"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Ширина на стълбовете"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Показване на файловите разширения"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "под&равнени (с ТАБ)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "веднага &зад файловото име"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr ""
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
#, fuzzy
#| msgid "Cut text to column width"
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBCUTTEXTTOCOLWIDTH.CAPTION"
msgid "Cut &text to column width"
msgstr "Подрязване на &текста до ширината на стълба"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
#, fuzzy
#| msgid "Horizontal lines"
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDHORZLINE.CAPTION"
msgid "&Horizontal lines"
msgstr "Водоравни черти"
#: tfrmoptionscolumnsview.cbgridvertline.caption
#, fuzzy
#| msgid "Vertical lines"
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDVERTLINE.CAPTION"
msgid "&Vertical lines"
msgstr "Отвесни черти"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
#, fuzzy
#| msgid "Auto fill columns"
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CHKAUTOFILLCOLUMNS.CAPTION"
msgid "A&uto fill columns"
msgstr "Самопопълване на стълбовете"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Показване на решетка"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr ""
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.LBLAUTOSIZECOLUMN.CAPTION"
msgid "Auto si&ze column:"
msgstr "Самооразмеряване на стълба:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "&Прилагане"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "Об&работка"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
#, fuzzy
#| msgid "Command line history"
msgctxt "TFRMOPTIONSCONFIGURATION.CBCMDLINEHISTORY.CAPTION"
msgid "Co&mmand line history"
msgstr "Дневник на реда управление"
#: tfrmoptionsconfiguration.cbdirhistory.caption
#, fuzzy
#| msgid "Directory history"
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
msgid "&Directory history"
msgstr "Дневник на папката"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
#, fuzzy
#| msgid "File mask history"
msgctxt "TFRMOPTIONSCONFIGURATION.CBFILEMASKHISTORY.CAPTION"
msgid "&File mask history"
msgstr "Дневник на търсените файловете"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
#, fuzzy
#| msgid "Save configuration"
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSAVECONFIGURATION.CAPTION"
msgid "Sa&ve configuration"
msgstr "Запис на настройките"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
#, fuzzy
#| msgid "Search/Replace history"
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSEARCHREPLACEHISTORY.CAPTION"
msgid "Searc&h/Replace history"
msgstr "Дневник на търсенията/ замените"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Папки"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgctxt "TFRMOPTIONSCONFIGURATION.GBLOCCONFIGFILES.CAPTION"
msgid "Location of configuration files"
msgstr "Положение на настроечните файлове"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.GBSAVEONEXIT.CAPTION"
msgid "Save on exit"
msgstr "Запис при изход"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgctxt "TFRMOPTIONSCONFIGURATION.LBLCMDLINECONFIGDIR.CAPTION"
msgid "Set on command line"
msgstr ""
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
#, fuzzy
#| msgid "Program directory (portable version)"
msgctxt "TFRMOPTIONSCONFIGURATION.RBPROGRAMDIR.CAPTION"
msgid "P&rogram directory (portable version)"
msgstr "Папката на приложението (преносима версия)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
#, fuzzy
#| msgid "User home directory"
msgctxt "TFRMOPTIONSCONFIGURATION.RBUSERHOMEDIR.CAPTION"
msgid "&User home directory"
msgstr "Домашна папка на потребителя"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Всички"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "Из&триване"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr ""
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Нов"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr ""
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr ""
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Преименуване"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Съхраняване като"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "Съхраняване"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Позволяване на надцветка"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr ""
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "Общи"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Обрамчване на показалеца"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr ""
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr ""
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "Подцветка:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Подцветка 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
#, fuzzy
#| msgid "Con&figure columns for file system:"
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCONFIGCOLUMNS.CAPTION"
msgid "Con&figure columns view:"
msgstr "Настройка на стълбовете за файлова уредба:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr ""
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "Цвят на показалеца:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Текст на показалеца:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Шрифт:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Размер:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "Цвят на текста:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "Цвят на отбелязване:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr ""
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Добавяне на стълб"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Положение на крилото след сравнението"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Изтриване на избрания предмет"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
#, fuzzy
#| msgid "Add..."
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Добавяне..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
#, fuzzy
#| msgid "Backup..."
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Запасяване..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
#, fuzzy
#| msgid "Delete..."
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Изтриване..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
#, fuzzy
#| msgid "Export..."
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Изнасяне..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
#, fuzzy
#| msgid "Help"
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "Помощ"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
#, fuzzy
#| msgid "Import..."
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Внасяне..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
#, fuzzy
#| msgid "Insert..."
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Вмъкване..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
#, fuzzy
#| msgid "Miscellaneous..."
msgid "&Miscellaneous..."
msgstr "Разни..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
msgid "Some functions to select appropriate target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnsort.caption
#, fuzzy
#| msgid "Sort..."
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Подреждане..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
#, fuzzy
#| msgid "When adding directory, add also target"
msgid "&When adding directory, add also target"
msgstr "При добавяне на папка, да се добавя и цел"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
#, fuzzy
#| msgid "Always expand tree"
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Дървото да се разгъва винаги"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
#, fuzzy
#| msgid "Show only valid environment variables"
msgid "Show only &valid environment variables"
msgstr "Показване само на важащи променливи на средата"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
#, fuzzy
#| msgid "In popup, show [path also]"
msgid "In pop&up, show [path also]"
msgstr "В изкачащия прозорец да се показва [и пътят]"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Име, а-я"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
msgid "Name, a-z"
msgstr "Име, я-а"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Любими папки (пренареждат се чрез завлачване)"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Други възможности"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
msgid "Name:"
msgstr "Име"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
msgid "Path:"
msgstr "Път:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
#, fuzzy
#| msgid "Target:"
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
msgid "&Target:"
msgstr "Цел"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to &configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr ""
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr ""
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "&Питащ прозорец при пускане"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "При завличане в &крилата:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Поставяне на предпочитания формат на върха на списъка"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr ""
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr ""
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Показване на &файловата уредба"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Показване на &свободното място"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Показване на &етикет"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Списък на устройствата"
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Поставяне на показалеца след края на реда"
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Показване на неизобразимите знаци"
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Възможности на вътрешния обработчик"
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "&Подцветка"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
msgid "Bac&kground"
msgstr "&Подцветка"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Очистване"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
msgid "Save"
msgstr "Съхраняване"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Свосйтва на предметите"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Цвят на &шрифта"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
msgid "Fo&reground"
msgstr "&Подцветка"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr ""
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Използване (и обработка) на &обща разцветка"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Използване на &местна разцветка"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "Полу&чер"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
msgid "In&vert"
msgstr "&Обърнат"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
msgid "O&ff"
msgstr "&Изкл"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
msgid "O&n"
msgstr "&Вкл"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Курсив"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
msgid "In&vert"
msgstr "&Обърнат"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
msgid "O&ff"
msgstr "&Изкл"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
msgid "O&n"
msgstr "&Вкл"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "&Зачертан"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
msgid "In&vert"
msgstr "&Обърнат"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
msgid "O&ff"
msgstr "&Изкл"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
msgid "O&n"
msgstr "&Вкл"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "Под&чертан"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "&Обърнат"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "&Изкл"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "&Вкл"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr "Добавяне..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr "Изтриване..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Внасяне/ изнасяне"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr "Вмъкване..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Преименуване"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr "Подреждане..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr "Дървото да се разгъва винаги"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Не"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr ""
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr "Други възможности"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Изрязване"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr "Изтриване на избрания предмет"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr ""
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsfavoritetabs.mipasteselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Поставяне"
#: tfrmoptionsfavoritetabs.mirename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Преименуване"
#: tfrmoptionsfavoritetabs.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr ""
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Добавяне"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "&Add"
msgstr "&Добавяне"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
#, fuzzy
#| msgid "Add"
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "Добавяне"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr ""
#: tfrmoptionsfileassoc.btndownact.caption
#, fuzzy
#| msgid "Down"
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "&Down"
msgstr "Надолу"
#: tfrmoptionsfileassoc.btneditext.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edit"
msgstr "Обработка"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btnremoveact.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
msgid "Remo&ve"
msgstr "Премахване"
#: tfrmoptionsfileassoc.btnremoveext.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
msgid "Re&move"
msgstr "Премахване"
#: tfrmoptionsfileassoc.btnremovetype.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "Премахване"
#: tfrmoptionsfileassoc.btnrenametype.caption
#, fuzzy
#| msgid "Rename"
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "Премахване"
#: tfrmoptionsfileassoc.btnupact.caption
#, fuzzy
#| msgid "Up"
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "Нагоре"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr ""
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr ""
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Действия"
#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
msgid "Extensions"
msgstr "Разширения"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Могат да бъдат подредени със завлачване"
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Видове файлове"
#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
msgid "Icon"
msgstr "Значе"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Действията могат да бъдат подредени със завлачване"
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Разширенията могат да бъдат подредени със завлачване"
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Видовете на файловете могат да бъдат подредени със завлачване"
#: tfrmoptionsfileassoc.lblaction.caption
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
msgid "Action name:"
msgstr "Име на действието:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "&Command:"
msgstr "&Заповед:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Клю&чове:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "&Пусков път:"
#: tfrmoptionsfileassoc.menuitem1.caption
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr ""
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr ""
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Обработка"
#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
msgid "Open in Editor"
msgstr "Отваряне в обработчика"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Обработка с..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
msgid "Get output from command"
msgstr "Получаване на изхода от командата"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr ""
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr ""
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Отваряне"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Отваряне с..."
#: tfrmoptionsfileassoc.miseparator.caption
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgctxt "tfrmoptionsfileassoc.mishell.caption"
msgid "Run in terminal"
msgstr "Пускане в терминал"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Преглед"
#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
msgid "Open in Viewer"
msgstr "Отваряне в прегледа"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Преглеждане с..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr ""
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Настройка на файловите обвързвания"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr ""
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr ""
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr ""
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Действие „пре&запис‟"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Действие „&изтриване‟"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDELETETOTRASH.CAPTION"
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Изтриване в &кошчето (Shift обръща настройката)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr ""
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
msgid "D&rop readonly flag"
msgstr "Изоставяне на стяга „само за &четене“"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "Действие „пре&местване‟"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBPROCESSCOMMENTS.CAPTION"
msgid "&Process comments with files/folders"
msgstr "Об&работка на бележките заедно с файловете/папките"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBRENAMESELONLYNAME.CAPTION"
msgid "Select &file name without extension when renaming"
msgstr "Избор само на файловото &име при преименуване (без разширението)"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSHOWCOPYTABSELECTPANEL.CAPTION"
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Показване на &крило за избор на подпрозорци в прозореца за презапис/местене"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSKIPFILEOPERROR.CAPTION"
msgid "S&kip file operations errors and write them to log window"
msgstr "Грешките при работа с файлове се &прескачат и се записват дневниковия прозорец"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Изпълняване на действия"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr ""
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr ""
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr ""
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLWIPEPASSNUMBER.CAPTION"
msgid "&Number of wipe passes:"
msgstr "Брой на &повторенията:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Връщане на подразбираните настройки на DC"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Позволяване на надцветка"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEFRAMECURSOR.CAPTION"
msgid "Use &Frame Cursor"
msgstr "Използване на о&граждащ показалец"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Използване на &преливащ указател"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEINVERTEDSELECTION.CAPTION"
msgid "U&se Inverted Selection"
msgstr "Използване на &обърнато избиране"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Обрамчване на показалеца"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
msgid "Drive Free Space Indicator"
msgstr "Указател за свободното място"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR.CAPTION"
msgid "Bac&kground:"
msgstr "Подц&ветка:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
msgid "Backg&round 2:"
msgstr "Подцветка &2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
msgid "C&ursor Color:"
msgstr "Цвят на &показалеца:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
msgid "Cursor Te&xt:"
msgstr "&Текст на показалеца:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEPANELBRIGHTNESS.CAPTION"
msgid "&Brightness level of inactive panel"
msgstr "&Яркост на бездейното крило"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "&Подцветка на указателя"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "&Основен цвят на указателя"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
msgid "&Mark Color:"
msgstr "Цвят на от&белязване:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
msgid "T&ext Color:"
msgstr "Цвят на &текста:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.cbpartialnamesearch.caption"
msgid "&Search for part of file name"
msgstr "Търсене за &част от файловото име"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.dbtextsearch.caption"
msgid "Text search in files"
msgstr "Търсене на текст във файловете"
#: tfrmoptionsfilesearch.gbfilesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Файлово търсене"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgctxt "tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption"
msgid "Default search template:"
msgstr ""
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.rbusemmapinsearch.caption"
msgid "Use memory mapping for search te&xt in files"
msgstr "Разпределено в паметта търсене на &текст във файловете"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.rbusestreaminsearch.caption"
msgid "&Use stream for search text in files"
msgstr "&Поточно търсене на текст във файловете"
#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "&Добавяне"
#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "Помо&щ"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "Файловият списък да не се зарежда до задействане на попрозореца"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBDIRBRACKETS.CAPTION"
msgid "S&how square brackets around directories"
msgstr "Показване на средни &скоби около папките"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr ""
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Преименуване на място, при двойно цъкане върху файл"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
msgid "Load &file list in separate thread"
msgstr "Зареждане на &файловите списъци в отделна нишка"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
msgid "Load icons af&ter file list"
msgstr "Зареждане на значетата &след файловия списък"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
msgid "Show s&ystem and hidden files"
msgstr "Показване на &скрити/ системни файлове"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSPACEMOVESDOWN.CAPTION"
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "При избор на файлове с <&Интервал> се преминава на следващия файл (като с <Insert>)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgid "Use an independant attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Изписване"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgctxt "TFRMOPTIONSFILESVIEWS.GBSORTING.CAPTION"
msgid "Sorting"
msgstr "Подреждане"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Отчитане на &гЛАВносТтА"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Неправилен начин на изписване"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgctxt "TFRMOPTIONSFILESVIEWS.LBLDATETIMEFORMAT.CAPTION"
msgid "&Date and time format:"
msgstr "Изписване на &датата и времето:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Изписване на файловите &размери:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "&Вмъкване на нови файлове:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Подреждане на &папките:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgctxt "TFRMOPTIONSFILESVIEWS.LBLSORTMETHOD.CAPTION"
msgid "&Sort method:"
msgstr "Начин на под&реждане:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "Преместване на об&новените файлове:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "&Добавяне"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "&Прилагане"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "Из&триване"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Шаблон..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.GBFILETYPESCOLORS.CAPTION"
msgid "File types colors (sort by drag&&drop)"
msgstr "Оцветяване на файловете според вида им (подреждане със за&влачване)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYATTR.CAPTION"
msgid "Category a&ttributes:"
msgstr "&Принадлежности на раздела:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYCOLOR.CAPTION"
msgid "Category co&lor:"
msgstr "&Цвят на раздела:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
msgid "Category &mask:"
msgstr "Раз&ширения на раздела:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
msgid "Category &name:"
msgstr "&Име на раздела:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "Шрифт на &конзолата"
#: tfrmoptionsfonts.lbleditorfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
msgid "&Editor font"
msgstr "Шрифт на об&работчика"
#: tfrmoptionsfonts.lbllogfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
msgid "&Log font"
msgstr "&Шрифт на дневника"
#: tfrmoptionsfonts.lblmainfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
msgid "Main &font"
msgstr "&Основен шрифт"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr ""
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr ""
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
msgid "Viewer&Book Font"
msgstr "Шрифт на &книгоподобния изглед"
#: tfrmoptionsfonts.lblviewerfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
msgid "&Viewer font"
msgstr "Шрифт на &прегледа"
#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Добавяне на клавишно &съчетание"
#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Запомняне"
#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Изтриване"
#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "Из&триване на клавишно съчетание"
#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "Про&мяна на клавишно съчетание"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Преименуване"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
msgid "&Filter"
msgstr "Пре&сяване:"
#: tfrmoptionshotkeys.lblcategories.caption
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
msgid "C&ategories:"
msgstr "Раз&дели:"
#: tfrmoptionshotkeys.lblcommands.caption
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
msgid "Co&mmands:"
msgstr "&Заповеди:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
msgid "&Shortcut files:"
msgstr ""
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Заповед"
#: tfrmoptionshotkeys.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "За следните &пътища и подпапките им:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr ""
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
msgid "Show o&verlay icons, e.g. for links"
msgstr "Показване на &наслоени значета, например за връзки"
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Забраняване на особени значета"
#: tfrmoptionsicons.gbiconssize.caption
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
msgid " Icon size "
msgstr "Размер на значетата"
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
msgid " Show icons to the left of the filename "
msgstr ""
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
msgid "A&ll"
msgstr "&Всички"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
msgid "All associated + &EXE/LNK (slow)"
msgstr "Всички свързани + &EXE/LNK (бавно)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
msgid "&No icons"
msgstr "&Без значета"
#: tfrmoptionsicons.rbiconsshowstandard.caption
#, fuzzy
#| msgid "&Only standard icons"
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
msgid "Only &standard icons"
msgstr "&Само обичайните значета"
#: tfrmoptionsignorelist.btnaddsel.caption
#, fuzzy
#| msgid "&Add selected names"
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
msgid "A&dd selected names"
msgstr "&Добавяне на избраните имена"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
msgid "Add selected names with &full path"
msgstr "Добавяне на избраните имена с пълните пътища"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Пренебрегване (скриване) на следните файлове и папки:"
#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
msgid "&Save in:"
msgstr "&Съхраняване в:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "&Лявата и дясната стрелка сменят папките (като в Lynx)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Набиране"
#: tfrmoptionskeyboard.lblalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
msgid "Alt+L&etters:"
msgstr "Alt+&букви:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+&Alt+букви:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
msgid "&Letters:"
msgstr "&Букви:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
msgid "&Flat buttons"
msgstr "&Плоски бутони"
#: tfrmoptionslayout.cbflatinterface.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
msgid "Flat i&nterface"
msgstr "&Плосък облик"
#: tfrmoptionslayout.cbflattoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
msgid "Flat b&uttons"
msgstr "&Плоски бутони"
#: tfrmoptionslayout.cbfreespaceind.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
msgid "Show fr&ee space indicator on drive label"
msgstr "Показване на указател за &свободно място в етикета на устройството"
#: tfrmoptionslayout.cblogwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
msgid "Show lo&g window"
msgstr "Прозорец на &дневника"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
msgid "Show panel of operation in background"
msgstr "Показване на крилото за действия на заден план"
#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
msgid "Show common progress in menu bar"
msgstr "Показване на общия ход в лентата на изборника"
#: tfrmoptionslayout.cbshowcmdline.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
msgid "Show command l&ine"
msgstr "Показване на &ред за управление"
#: tfrmoptionslayout.cbshowcurdir.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
msgid "Show current director&y"
msgstr "Показване на &текущата папка"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
msgid "Show &drive buttons"
msgstr "Показване на &бутони за устройствата"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
msgid "Show free s&pace label"
msgstr ""
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr ""
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
msgid "Show function &key buttons"
msgstr "Показване на &служебни бутони"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
msgid "Show &main menu"
msgstr "Показване на главния изборник"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
msgid "Show tool&bar"
msgstr "Показване на лента с &бутони"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr ""
#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
msgid "Show &status bar"
msgstr "Показване на лента на &състоянието"
#: tfrmoptionslayout.cbshowtabheader.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
msgid "S&how tabstop header"
msgstr "Заглавия на &подпрозорците"
#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
msgid "Sho&w folder tabs"
msgstr "Показване на &подстраници за папките"
#: tfrmoptionslayout.cbtermwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
msgid "Show te&rminal window"
msgstr "Показване на &терминален прозорец"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Показване на &две ленти с устройствата (неизменна ширина, над файловите прозорци)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
msgid " Screen layout "
msgstr "Екранна подредба"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr ""
#: tfrmoptionslog.cblogarcop.caption
#, fuzzy
#| msgid "Pack/Unpack"
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
msgid "&Pack/Unpack"
msgstr "Сгъване/ разгъване"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr ""
#: tfrmoptionslog.cblogcpmvln.caption
#, fuzzy
#| msgid "Copy/Move/Create link/symlink"
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
msgid "Cop&y/Move/Create link/symlink"
msgstr "Презапис/Преместване/Създаване на връзка/мека връзка"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "Из&триване"
#: tfrmoptionslog.cblogdirop.caption
#, fuzzy
#| msgid "Create/Delete directories"
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
msgid "Crea&te/Delete directories"
msgstr "Създаване/ изтриване на папки"
#: tfrmoptionslog.cblogerrors.caption
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
msgid "Log &errors"
msgstr "Записване на &грешките"
#: tfrmoptionslog.cblogfile.caption
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
msgid "C&reate a log file:"
msgstr "&Водене на дневник"
#: tfrmoptionslog.cbloginfo.caption
#, fuzzy
#| msgid "Log information messages"
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
msgid "Log &information messages"
msgstr "Записване на осведомяващите съобщения"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr ""
#: tfrmoptionslog.cblogsuccess.caption
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
msgid "Log &successful operations"
msgstr "Записване на &успешните действия"
#: tfrmoptionslog.cblogvfs.caption
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
msgid "&File system plugins"
msgstr "Приставки за файлови &уредби"
#: tfrmoptionslog.gblogfile.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
msgid "File operation log file"
msgstr "Дневник на действията с файлове"
#: tfrmoptionslog.gblogfileop.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILEOP.CAPTION"
msgid "Log operations"
msgstr "Дневник на действията"
#: tfrmoptionslog.gblogfilestatus.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILESTATUS.CAPTION"
msgid "Operation status"
msgstr "Ход на действието"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Изтриване на миниатюрите за изчезнали файлове"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr "Преглед на дневника на файловото съдържание"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
msgid "Create new with the encoding:"
msgstr ""
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "При смяна на устройството, да се отива в &основната папка"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Показване на &предупреждения (само с копче „Добре“)"
#: tfrmoptionsmisc.chkthumbsave.caption
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
msgid "&Save thumbnails in cache"
msgstr "&Съхраняване на миниатюрите"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
msgid "Thumbnails"
msgstr "Миниатюри"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr ""
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr ""
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
msgid "Default encoding:"
msgstr ""
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr ""
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr ""
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr ""
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "точки"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr ""
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr ""
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Избиране с мишката"
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Превъртане"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Избиране"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Режим"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "&Ред по ред"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Ред по ред с местене на &показалеца"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Страница по страница"
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "&Добавяне"
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "&Настройка"
#: tfrmoptionsplugins.btnenableplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
msgid "E&nable"
msgstr "&Разрешаване"
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "Пре&махване"
#: tfrmoptionsplugins.btntweakplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
msgid "&Tweak"
msgstr "&Настройка"
#: tfrmoptionsplugins.lbldsxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Приставките за &търсене позволяват изполването на заместващ алгоритъм за търсене или на въшни пособия от рода на „locate“ и т.н."
#: tfrmoptionsplugins.lblwcxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
msgid "Pack&er plugins are used to work with archives"
msgstr "У&плътняващите приставки се използват за работа със сбивки (архиви)."
#: tfrmoptionsplugins.lblwdxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Приставките за &съдържание позволяват показването на допълнителни подробности за файловете, от рода на mp3 означители или свосйтв ана изображения във файловите списъци. Могат да се използват и при търсене и в пособието за множествено преименуване."
#: tfrmoptionsplugins.lblwfxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Приставките за &файлови уредби позволяват достъп до дискове, недостъпни от работната уредба или до външи устройства като Palm и PocketPC."
#: tfrmoptionsplugins.lblwlxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Приставките за пре&глед позволяват показването на файлови формати от рода на изображения, таблици, бази от данни и т.н. в прегеда (F3, Ctrl+Q)"
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
msgid "Active"
msgstr "Деен"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr "Приставка"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
msgid "Registered for"
msgstr "Записано на"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr "Файлово име"
#: tfrmoptionsplugins.tsdsx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
msgid "&Search plugins (.DSX)"
msgstr "Приставки за &търсене (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
msgid "Pac&ker plugins (.WCX)"
msgstr "Приставки за &архивиране (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
msgid "Content pl&ugins (.WDX)"
msgstr "Приставки за &съдържание (.WDX)"
#: tfrmoptionsplugins.tswfx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
msgid "F&ile system plugins (.WFX)"
msgstr "Приставки за &файлови уредби (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
msgid "&Viewer plugins (.WLX)"
msgstr "Приставки за &преглед (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
msgid "&Beginning (name must start with first typed character)"
msgstr "&Начало (името трябва да започва с първия набран знак)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "&Край (последният знак преди точката . трябва да съвпада)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Възможности"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.GBEXACTNAMEMATCH.CAPTION"
msgid "Exact name match"
msgstr "Точно съвпадение на имената"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr ""
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr ""
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr ""
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Задействане на целевото &крило при цъкане на някой от подпрозорците му"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
msgid "&Show tab header also when there is only one tab"
msgstr "Показване на &заглавки на подпрозорците, дори когато има само един"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr ""
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
msgid "Con&firm close all tabs"
msgstr "&Искане на потвърждение при затваряне на всички подпрозорци"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr ""
#: tfrmoptionstabs.cbtabslimitoption.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
msgid "&Limit tab title length to"
msgstr "&Ширина на заглавията на подстраниците до:"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
msgid "Show locked tabs &with an asterisk *"
msgstr "Означаване на заключените подпрозорци със звездичка *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
msgid "&Tabs on multiple lines"
msgstr "Многоредово разположение на &подстраниците"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&Up отваря нов подпрозорец на преден план"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
msgid "Open &new tabs near current tab"
msgstr "Отваряне на &новите подпрозорци до текущия"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr ""
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
msgid "Show ta&b close button"
msgstr ""
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr ""
#: tfrmoptionstabs.gbtabs.caption
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
msgid "Folder tabs headers"
msgstr "Заглавки на подстраниците на папките"
#: tfrmoptionstabs.lblchar.caption
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
msgid "characters"
msgstr "знака"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr ""
#: tfrmoptionstabs.lbltabsposition.caption
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
msgid "Ta&bs position"
msgstr ""
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Не"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr ""
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr ""
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr ""
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr ""
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr ""
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Заповед:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Ключове:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Заповед:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Ключове:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Заповед:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Ключове:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgctxt "tfrmoptionstoolbar.btnclonebutton.caption"
msgid "C&lone button"
msgstr "Удвояване"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
msgid "&Delete"
msgstr "Из&триване"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgctxt "tfrmoptionstoolbar.btnedithotkey.caption"
msgid "Edit hot&key"
msgstr "Об&работка"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgctxt "tfrmoptionstoolbar.btninsertbutton.caption"
msgid "&Insert new button"
msgstr "&Добавяне на бутон"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr ""
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr ""
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgctxt "tfrmoptionstoolbar.btnremovehotkey.caption"
msgid "Remove hotke&y"
msgstr "Премахване на клавишно съ&четание"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr ""
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "Плоски бутони"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Докладване на грешки в заповедите"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr ""
#: tfrmoptionstoolbar.gbgroupbox.caption
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
msgid "Appearance"
msgstr "Облик"
#: tfrmoptionstoolbar.lblbarsize.caption
msgctxt "tfrmoptionstoolbar.lblbarsize.caption"
msgid "&Bar size:"
msgstr "&Размер на лентата:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblexternalcommand.caption"
msgid "Comman&d:"
msgstr "&Заповед:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Клю&чове:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr "Помощ"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Клавишно съчетание:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgctxt "tfrmoptionstoolbar.lbliconfile.caption"
msgid "Ico&n:"
msgstr "&Значе:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgctxt "tfrmoptionstoolbar.lbliconsize.caption"
msgid "Icon si&ze:"
msgstr "Размер на &значетата:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "&Заповед"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "&Ключове"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "&Пусков път:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgctxt "tfrmoptionstoolbar.lbltooltip.caption"
msgid "&Tooltip:"
msgstr "&Подсказка:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr ""
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "за външна заповед"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "за вътрешна заповед"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "за разделител"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "за под-лента"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr "Запасяване..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr "Изнасяне..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Текущата лента..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "във файл за лента с пособия (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "във файла .BAR за TC (запазване на съществуващия)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "във файла .BAR за TC (изтриване на съществуващия)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "във „wincmd.ini‟ за TC (запазване на съществуващия)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "във „wincmd.ini‟ за TC (изтриване на съществуващия)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "във файл за лента с пособия (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "във файла .BAR за TC (запазване на съществуващия)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "във файла .BAR за TC (изтриване на съществуващия)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "в „wincmd.ini‟ за TC (запазване на съществуващия)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "в „wincmd.ini‟ за TC (изтриване на съществуващия)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "точно след избрания предмет"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr "като първи предмет"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr "като последен предмет"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "точно преди избрания предмет"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr "Внасяне..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "точно след избрания предмет"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr "като първи предмет"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr "като последен предмет"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "точно преди избрания предмет"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr "Търсене и замяна..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "точно след избрания предмет"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "като първи предмет"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "като последен предмет"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "точно преди избрания предмет"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr ""
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr ""
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr "точно след избрания предмет"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr "като първи предмет"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr "като последен предмет"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr "точно преди избрания предмет"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Вид на бутона"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSKEEPTERMINALOPEN.CAPTION"
msgid "&Keep terminal window open after executing program"
msgstr "Прозорецът на терминала остава &отворен след изпълнение на приложението"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSRUNINTERMINAL.CAPTION"
msgid "&Execute in terminal"
msgstr "Изпълняване в &терминал"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgctxt "TFRMOPTIONSTOOLBASE.CBTOOLSUSEEXTERNALPROGRAM.CAPTION"
msgid "&Use external program"
msgstr "Ползване на &външно приложение"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPARAMETERS.CAPTION"
msgid "A&dditional parameters"
msgstr "&Допълнителни ключове"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgctxt "TFRMOPTIONSTOOLBASE.LBLTOOLSPATH.CAPTION"
msgid "&Path to program to execute"
msgstr "&Път към приложението"
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "&Добавяне"
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "&Прилагане"
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "Из&триване"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Шаблон..."
#: tfrmoptionstooltips.chkshowtooltip.caption
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
msgid "&Show tooltip for files in the file panel"
msgstr "Показване на &подсказки"
#: tfrmoptionstooltips.gbcustomfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
msgid "Custom fields by file type"
msgstr "Нагласени полета според вида на файла"
#: tfrmoptionstooltips.lblfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Подсказки според раз&дела"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Раз&ширения на раздела:"
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "&Име на раздела:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Подцветка:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Цвят на показалеца:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Цвят на намерения текст:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Цвят на текста под показалеца:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Обичаен цвят на текста:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Обичаен цвят на текста под показалеца:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgctxt "TFRMOPTIONSVIEWER.GBVIEWERBOOKMODE.CAPTION"
msgid "Viewer Book Mode"
msgstr "Книговиден изглед на прегледа"
#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
msgid "Example"
msgstr "Пример"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgctxt "TFRMOPTIONSVIEWER.LBLBACKGROUNDCOLORVIEWERBOOK.CAPTION"
msgid "&Background color in book viewer"
msgstr "&Подцветка на книговидния преглед"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgctxt "TFRMOPTIONSVIEWER.LBLFONTCOLORVIEWERBOOK.CAPTION"
msgid "&Font color in book viewer"
msgstr "Цвят на &шрифта на книговидния преглед"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgctxt "TFRMOPTIONSVIEWER.LBLNUMBERCOLUMNSVIEWER.CAPTION"
msgid "&Number of columns in book viewer"
msgstr "Брой на &стълбовете в книговидния преглед"
#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "&Настройка"
#: tfrmpackdlg.caption
msgctxt "TFRMPACKDLG.CAPTION"
msgid "Pack files"
msgstr "Сбиване на файлове"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Създаване на разделни архиви, по &един на файл/папка"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Създаване на саморазгъващ се файл"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "&Криптиране"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Пре&местване в архив"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Многотомов архив"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "&Първо да се поставя в TAR"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "&Сбиване и на имената на пътищата (само вложено)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Сбиване на фал(овете) във файл:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Сбивачка"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Затваряне"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Разгъване на вси&чки и изпълняване"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "&Разгъване и изпълняване"
#: tfrmpackinfodlg.caption
msgctxt "TFRMPACKINFODLG.CAPTION"
msgid "Properties of packed file"
msgstr "Свойства на сбития файл"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Принадлежности:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Степен на уплътняване:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Дата:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Способ:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Първоначален размер:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Файл:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Размер след сбиване:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Сбивачка:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Време:"
#: tfrmquicksearch.btncancel.caption
msgctxt "tfrmquicksearch.btncancel.caption"
msgid "X"
msgstr ""
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr ""
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr ""
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr ""
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Отчитане на глАВноСТта"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr ""
#: tfrmquicksearch.sbdirectories.hint
#, fuzzy
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Папки"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr ""
#: tfrmquicksearch.sbfiles.hint
#, fuzzy
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Файлове"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr ""
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr ""
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr ""
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr ""
#: tfrmquicksearch.tglfilter.caption
msgctxt "tfrmquicksearch.tglfilter.caption"
msgid "Filter"
msgstr "Пресяване"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr ""
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr ""
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr ""
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Приставка"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Поле"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr ""
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr ""
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr ""
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Отказ"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "&Затваряне"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "Помо&щ"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
msgid "&OK"
msgstr "&Добре"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr ""
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmsetfileproperties.caption
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
msgid "Change attributes"
msgstr "Промяна на принадлежностите"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr ""
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Лепкав"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr ""
#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "Архив"
#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Саздаден:"
#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "Скрит"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Ползван:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Променен:"
#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "Само за четене"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Включително подпапките"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "Системен"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr ""
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Принадлежности"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Принадлежности"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Разряда:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Група"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(сиво = непроменено, отметнато = включено)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Друго:"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Собственик"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Словесно представяне:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Изпълнение"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(сиво = непроменено, отметнато = включено)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Осмично:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Запис"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Четене"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmsplitter.caption
msgctxt "TFRMSPLITTER.CAPTION"
msgid "Splitter"
msgstr "Разделител"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr ""
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Файлово име"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Размер и брой на частите"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "&Целева папка"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr ""
"Файлов &\n"
"източник\n"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "&Брой на частите"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&байта"
#: tfrmsplitter.rbtngigab.caption
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr "&гигабайта"
#: tfrmsplitter.rbtnkilob.caption
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr "&килобайта"
#: tfrmsplitter.rbtnmegab.caption
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr "&мегабайта"
#: tfrmstartingsplash.caption
msgctxt "tfrmstartingsplash.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "tfrmstartingsplash.lblbuild.caption"
msgid "Build"
msgstr "Постройка"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr ""
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr ""
#: tfrmstartingsplash.lblrevision.caption
msgctxt "tfrmstartingsplash.lblrevision.caption"
msgid "Revision"
msgstr "Преработка"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "tfrmstartingsplash.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "tfrmstartingsplash.lblversion.caption"
msgid "Version"
msgstr "Издание"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Създаване на мека връзка"
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Съществуваща &цел, към която да сочи връзката"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "&Име на връзката"
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
msgid "Close"
msgstr "Затваряне"
#: tfrmsyncdirsdlg.btncompare.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
msgid "Compare"
msgstr "Сравняване"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr ""
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr ""
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr ""
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr ""
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr ""
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Подпапки"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Показване:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Име"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Размер"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Дата"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Дата"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Размер"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Име"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(в главния прозорец)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Сравняване"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr ""
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr ""
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "повтарящи"
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr ""
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Натиснете „Сравняване‟ за начало"
#: tfrmsyncdirsperformdlg.caption
msgctxt "tfrmsyncdirsperformdlg.caption"
msgid "Synchronize"
msgstr "Съгласуване"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr ""
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr "Търсене с отчитане на глАВноСТта"
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr ""
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr ""
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr "Търсене без отчитане на глАВноСТта"
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
#, fuzzy
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr "Настройка на дървовидния изглед"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "Добавяне на &ново"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Отказ"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "Про&мяна"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Под&разбирано"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Добре"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "Пре&махване"
#: tfrmtweakplugin.caption
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
msgid "Tweak plugin"
msgstr "Настройка на приставката"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Разпознаване на &архивите според съдържанието"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Възможно е из&триването на файлове"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Поддържа кодиране:"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Показване като обичайни файлове (скриване на значето на архиватора)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Поддръжка на сбиване в &паметта"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Възможна е про&мяната на съществуващи архиви"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "Архивът може да съдържа &много файлове"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Възможно е създаването на &нови архиви"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "Поддръжка на &питащ прозорец с възможности"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Позволяване на &търсене на текст в архиви"
#: tfrmtweakplugin.lbldescription.caption
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "О&писание:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "Раз&познавателен низ:"
#: tfrmtweakplugin.lblextension.caption
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "Раз&ширение:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Знамена:"
#: tfrmtweakplugin.lblname.caption
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "&Име"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "&Приставка:"
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "&Приставка:"
#: tfrmviewer.actabout.caption
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
msgid "About Viewer..."
msgstr "За прегледа..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Показване на прозорец „За приложението‟"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
msgid "Copy File"
msgstr "Презапис на файла"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Презапис на файла"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Запомняне в кошницата"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr ""
#: tfrmviewer.actdeletefile.caption
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
msgid "Delete File"
msgstr "Изтриване на файла"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Изтриване на файла"
#: tfrmviewer.actexitviewer.caption
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "Из&ход"
#: tfrmviewer.actfind.caption
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Търсене"
#: tfrmviewer.actfindnext.caption
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Намиране на следващото"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr "Намиране на предходна поява"
#: tfrmviewer.actfullscreen.caption
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Цял екран"
#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr "В средата на прозореца"
#: tfrmviewer.actloadnextfile.caption
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
msgid "&Next"
msgstr "На&пред"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Зареждане на следващия файл"
#: tfrmviewer.actloadprevfile.caption
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
msgid "&Previous"
msgstr "На&зад"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Зареждане на предходния файл"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr ""
#: tfrmviewer.actmirrorhorz.hint
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr ""
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr ""
#: tfrmviewer.actmovefile.caption
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
msgid "Move File"
msgstr ""
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr ""
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Преглед"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Презареждане"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Презареждане на текущия файл"
#: tfrmviewer.actrotate180.caption
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
msgid "+ 180"
msgstr "+180"
#: tfrmviewer.actrotate180.hint
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
msgid "Rotate 180 degrees"
msgstr "Завъртане на 180 °"
#: tfrmviewer.actrotate270.caption
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
msgid "- 90"
msgstr "-90"
#: tfrmviewer.actrotate270.hint
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
msgid "Rotate -90 degrees"
msgstr "Завъртане на -90 °"
#: tfrmviewer.actrotate90.caption
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
msgid "+ 90"
msgstr "+90"
#: tfrmviewer.actrotate90.hint
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
msgid "Rotate +90 degrees"
msgstr "Завъртане на +90 °"
#: tfrmviewer.actsave.caption
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Съхраняване"
#: tfrmviewer.actsaveas.caption
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
msgid "Save As..."
msgstr "Съхраняване като..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Съхраняване на файла като..."
#: tfrmviewer.actscreenshot.caption
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Снимка на екрана"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "Забавяне 3 секунди"
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "Забавяне 5 секунди"
#: tfrmviewer.actselectall.caption
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Избор на всички"
#: tfrmviewer.actshowasbin.caption
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "&Двоично изобразяване"
#: tfrmviewer.actshowasbook.caption
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "Изобразяване като &книга"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr "Изобразяване като &десетични числа"
#: tfrmviewer.actshowashex.caption
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "&Шестнадесетично изобразяване"
#: tfrmviewer.actshowastext.caption
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "&Словесно изобразяване"
#: tfrmviewer.actshowaswraptext.caption
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "Изобразяване като &редоделен текст"
#: tfrmviewer.actshowgraphics.caption
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Графики"
#: tfrmviewer.actshowplugins.caption
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Приставки"
#: tfrmviewer.actstretchimage.caption
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
msgid "Stretch"
msgstr "Разпъване"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Разпъване на изображението"
#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr "Разпъване само на големите изображения"
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr ""
#: tfrmviewer.actzoomin.caption
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Увеличаване"
#: tfrmviewer.actzoomout.caption
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Смаляване"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Запомняне"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Запомняне"
#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Орязване"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Изтриване"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Изтриване"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Цял екран"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr ""
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Изтъкване"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Преместване"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Преместване"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr ""
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr ""
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr ""
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Червени очи"
#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Преоразмеряване"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Отмяна"
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Преглед"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr ""
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr ""
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Изтъкване"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr ""
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr ""
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Преглед"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "За"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Обработка"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Знаков набор"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Файл"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "Из&ображение"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Разпечатване..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Завъртане"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Снимка на екрана"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Преглед"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Избор на всички"
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Когато файлът съществува"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Когато файлът съществува"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Презапис на &времето и датата"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr ""
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Когато файлът съществува"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr ""
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Ширина"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr ""
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Отмяна на текущото действие"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr ""
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr ""
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr ""
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr ""
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Липсващи:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr ""
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr ""
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr ""
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr ""
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr ""
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr ""
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr ""
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr ""
#: ulng.rscolattr
msgid "Attr"
msgstr "Принад"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Дата"
#: ulng.rscolext
msgid "Ext"
msgstr "Разш"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Име"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Размер"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Подравняване"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Надпис"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Изтриване"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Съдържание на полето"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Преместване"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Ширина"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Нагласяване на стълбове:"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr ""
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr ""
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Презапис (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr ""
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr ""
#: ulng.rsdiffadds
msgid " Adds: "
msgstr ""
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr ""
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr ""
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr " Съвпадения: "
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr ""
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "&Отказ"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "Всички"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Довършване"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "Само&преименуване на целевите файлове"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Отказ"
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Продължаване"
#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "За&мяна"
#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "Замяна на вси&чки"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "Из&ход от приложението"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr ""
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Прене&брегване на всички"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Не"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "&Няма"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&Добре"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "&Други"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Замяна"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Замяна &Всички"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Замяна на всички по-&големи"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Замяна на всички по-&стари"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Замяна на всички по-&малки"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Пре&именуване"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "Под&новяване"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Нов &опит"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Пропускане"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "П&ропускане на всички"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Да"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Презапис на на файл(ове)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Преместване на на файл(ове)"
#: ulng.rsdlgoppause
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "За&държане"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&Начало"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Опашка"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Скорост %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Скорост %s/s, оставащо време %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<няма етикет>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<няма носител>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Вътрешният преглед на Double Commander."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Отиване на ред:"
#: ulng.rseditgotolinetitle
msgctxt "ulng.rseditgotolinetitle"
msgid "Goto Line"
msgstr "Отиване на ред"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "нов.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Файлово име:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Отваряне на файл"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "На&зад"
#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Търсене"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "На&пред"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Замяна"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "в външен обработчик"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "в вътрешен обработчик"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr ""
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr ""
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr ""
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr ""
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Не;Да"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
#, fuzzy
#| msgid "Ask;Overwrite;Copy into;Skip"
msgid "Ask;Merge;Skip"
msgstr "Питане;Замяна;Презапис в;Пропускане"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Питане;Замяна;Презапис на по-старите;Пропускане"
#: ulng.rsfileopsetpropertyerroroptions
msgctxt "ulng.rsfileopsetpropertyerroroptions"
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Питане;Да не се задава повече;Пренебрегване на грешките"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "ПРЕСЯВАНЕ"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Задаване на шаблон"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s равнище/а"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "всички (неограничена дълбочина)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "само текущата папка"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Не съществува папка %s!"
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Намерени: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr ""
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Име на шаблона:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Обходени: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Претърсване"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Търсене на файлове"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr ""
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Начало"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Свободни %s от %s байта"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s байта свободни"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Дата/време на използване"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Принадлежности"
#: ulng.rsfunccomment
msgctxt "ulng.rsfunccomment"
msgid "Comment"
msgstr "Бележка"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Уплътнен размер"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Дата/време на съзадаване"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Разширение"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Група"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Промяна на дата/време"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Връзка към"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Дата/време на промяна"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Име"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Името без разширението"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Собственик"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Път"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Размер"
#: ulng.rsfunctype
msgid "Type"
msgstr "Вид"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Грешка при създаване на твърда връзка."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr ""
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Прозорец за презапис и местене"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Сравнител"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Прозорец за промяна на забележки"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Обработчик"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Търсене на файлове"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Основен"
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Преглед"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr ""
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Признак за смяна на избора"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Избор на маска"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Входна маска:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr ""
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr ""
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Настройка на нагласените стълбове"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Задайте ново име за стълбовете"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Действия"
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Разкачане на мрежово устройство..."
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Обработка"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Изваждане"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Извличане тук..."
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Прикачане на мрежово устройство..."
#: ulng.rsmnumount
msgid "Mount"
msgstr "Прикачане"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Нов"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Няма носители"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Отваряне"
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Отваряне с"
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Друго..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Сбиване на файлове тук..."
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Подреждане по"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Разкачане"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Преглед"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Сметка:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr ""
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr ""
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr ""
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Смяната на папката на [%s] бе неуспешно!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Премахване на бездейните подпрозорци?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr ""
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr ""
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr ""
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr ""
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Презапис на %d избраните папки/файлове?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Да бъде ли презаписан избраният файл „%s“?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr ""
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr ""
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr ""
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr ""
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Да бъдат ли изтрити %d-те избрани папки/файла?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Да бъдат ли изтрити %d-те избрани папки/файла?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Да бъде ли изтрит избраният „%s‟?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Да бъде ли изтрит избраният „%s‟ в кошчето?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr ""
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Дискът не е на разположение"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr ""
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Въведете разширение:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Въведете име:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr ""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Грешка CRC в данните на архива"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Данните са лоши"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Неуспешно свързване към сървър: „%s‟"
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Неуспешен презапис на файл „%s‟ в „%s‟"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Вече съществува папка с име „%s‟."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Не се поддържа дата %s"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Папка %s съществува!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Действието е прекъснато от потребителя"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Грешка при затваряне на файла"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Създаването на файла е невъзможно"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Файловете в архива свършиха"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Отварянето на съществуващия файл е невъзможно"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Грешка при четене на файл"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Грешка при запис във файла"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Създаването на папка %s е невъзможно!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Неправилна връзка"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Не са намерени файлове"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Недостатъчно памет"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Действието не се поддържа!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr ""
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr ""
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr ""
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr ""
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr ""
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr ""
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr ""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr ""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr ""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr ""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Буферът е много малък"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Твърде много файлове за сбиване"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Форматът на архива е непознат"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr ""
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr ""
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr ""
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr ""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Файлът %s е променен. Да бъде ли съхранен?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s байта, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Замяна на:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Съществува файл %s. Да бъде ли заменен?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "С файла"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Файлът \"%s\" не е открит."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr ""
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr ""
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr ""
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr ""
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "Вече съществува %s, замяна?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Следване на мека връзка \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Добавяне на %dизбрани папки"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr ""
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Добавяне на текущата папка: "
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr ""
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr ""
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Настройка на любимите папки"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Убеден ли сте, че искате да изтриете всички попълнения от списъка на любимите папки? Възстановяването на списъка е невъзможно! "
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Ще се изпълни следната заповед"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr ""
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr ""
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr ""
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Грешка при запасяването..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Грешка при изнасянето..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Изнасяне на всички"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Изнасяне на списъка с любимите папки- изберете кои да се изнесат"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Изнасяне на избраните"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Внасяне на всички"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Внасяне на списъка с любимите папки- изберете кои да се внесат"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Внасяне на избраните"
#: ulng.rsmsghotdirjustpath
#, fuzzy
#| msgid "Path"
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Път"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr ""
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr ""
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr ""
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr ""
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr ""
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr ""
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr ""
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr ""
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Заповед:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr ""
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr ""
#: ulng.rsmsghotdirsimplename
#, fuzzy
#| msgid "Name:"
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Име"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr ""
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr ""
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr ""
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr ""
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr ""
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr ""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr ""
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Неправилно файлово име"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr ""
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Неправилен път"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr ""
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Това не е поддържана приставка!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr ""
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Неправилно цитиране"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Неправилно избиране"
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Зареждане на списък с файлове..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr ""
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr ""
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Презапис на файл %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Изтриване на файл %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Грешка:"
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr ""
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Извличане на файл %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Сведения:"
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Създаване на връзка %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Създаване на папка %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Преместване на файл %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Сбиване във файл %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Изтриване на папка %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Готово:"
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Създаване на мека връзка %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr ""
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Унищожаване на файл „%s‟"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Унищожаване на папка „%s‟"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Главна парола"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr ""
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Нов файл"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Ще бъде разгънат следвашия том"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Няма файлове"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Няма избрани файлове."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Недостатъчно място на целевата папка. Да продължа ли?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Недостатъчно място на целевата папка. Да опитам ли пак?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Невъзможно е изтриването на %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr ""
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Парола:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Паролите не съвпадат!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Въведете парола:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Парола (защитна стена):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Повторете паролата, за да я потвърдите:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Изтриване на %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr ""
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr ""
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr ""
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr ""
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Задайте ново име за този изборник"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Преименуване/местене на %d избраните папки/файлове?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Преименуване/местене на избрания \"%s\"?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Презапуснете Double Commander, за да влязат промените в сила"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr ""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Избрани: %s от %s, файлове: %d от %d, папки: %d от %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Избиране на изпълним файл за"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr ""
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Посочете местоположението на следващия том"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Слагане име на тома"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Особени папки"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr ""
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr ""
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr ""
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr ""
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr ""
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr ""
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr ""
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr ""
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr ""
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr ""
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr ""
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr ""
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr ""
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Избрани са прекалено много файлове"
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr ""
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr ""
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr ""
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Потребителско име:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr ""
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Етикет на тома:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Въведете размер на тома:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Унищожаване на %d избрани файла/папки?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Унищожаване на избрания „%s‟?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "с"
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Без промяна; ВИСША; низша; Първият знак главен; Първият Знак На Всяка Дума Главен;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Прекъснато"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr ""
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr ""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr ""
#: ulng.rsopercalculatingstatictics
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "Изчисляване"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Изчисляване „%s‟"
#: ulng.rsopercombining
msgid "Joining"
msgstr "Сглобяване"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr ""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Презаписване"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Презапис от „%s‟ в „%s‟"
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Презапис на „%s‟ в „%s‟"
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Създаване на папка"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Създаване на папка „%s‟"
#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "Изтриване"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Изтриване в „%s‟"
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Изтриване на „%s‟"
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Изпълняване"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Изпълняване на „%s‟"
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Извличане"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Извличане от „%s‟ в „%s‟"
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Приключено"
#: ulng.rsoperlisting
msgid "Listing"
msgstr ""
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr ""
#: ulng.rsopermoving
msgid "Moving"
msgstr "Преместване"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Преместване от „%s‟ в „%s‟"
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Преместване на „%s‟ в „%s‟"
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Незапочнато"
#: ulng.rsoperpacking
msgid "Packing"
msgstr ""
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Задържано"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Задържане"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Работещо"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Задаване на свойство"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Задаване на свойство в „%s‟"
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Задаване на свойство на „%s‟"
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Нацепване"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Нацепване на „%s‟ в „%s‟"
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Започване"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Спряно"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Спиране"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Проверка"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Проверка в „%s‟"
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Проверка на „%s‟"
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr ""
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr ""
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr ""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Изчакване на достъп до изходния файл"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Чакане на отговор от потребителя"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Унищожаване"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Унищожаване в „%s‟"
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Унищожаване на „%s‟"
#: ulng.rsoperworking
msgid "Working"
msgstr "Работи"
#: ulng.rsoptaddfrommainpanel
#, fuzzy
#| msgid "Add at beginning;Add at the end;Smart add"
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Добавяне в началото;Добавяне в края;Умно добавяне"
#: ulng.rsoptarchivedelete
msgctxt "ulng.rsoptarchivedelete"
msgid "Delete:"
msgstr "Изтриване:"
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Извличане без път:"
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr ""
#: ulng.rsoptarchiveid
msgctxt "ulng.rsoptarchiveid"
msgid "ID:"
msgstr ""
#: ulng.rsoptarchiveidpos
msgctxt "ulng.rsoptarchiveidpos"
msgid "ID Position:"
msgstr ""
#: ulng.rsoptarchiveidseekrange
msgctxt "ulng.rsoptarchiveidseekrange"
msgid "ID Seek Range:"
msgstr ""
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr ""
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr ""
#: ulng.rsoptarchiveselfextract
msgctxt "ulng.rsoptarchiveselfextract"
msgid "Create self extracting archive:"
msgstr "Създаване на саморазгъващ се архив:"
#: ulng.rsoptarchivetest
msgctxt "ulng.rsoptarchivetest"
msgid "Test:"
msgstr "Проверка:"
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Име на вида архив:"
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Стойност"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Обвързване на приставка \"%s\" с:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Първи;Последен"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Дейното крило- отляво, бездейното- отдясно (наследствено); Лявото крило- отляво, дясното- отдясно"
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Забраняване"
#: ulng.rsoptenable
msgctxt "ulng.rsoptenable"
msgid "Enable"
msgstr "Разрешаване"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Въведете разширение"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr ""
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr ""
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "плаващ;Б;К;М;Г"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr ""
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr ""
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr ""
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr ""
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Промяна на съчетанието"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Заповед"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr ""
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr ""
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Описание"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Про&мяна на клавишно съчетание за %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr ""
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Клавишно съчетание"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Клавишни съчетания"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<няма>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Ключове"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr ""
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr ""
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr ""
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr ""
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr ""
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr ""
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr ""
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr ""
#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Архиватори"
#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Самоопресняване"
#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Поведения"
#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr "Съкратен"
#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Цветове"
#: ulng.rsoptionseditorcolumnsview
msgctxt "ulng.rsoptionseditorcolumnsview"
msgid "Columns"
msgstr "Стълбове"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Настройка"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Нагласени стълбове"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Бързодостъпни папки"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Завлачване"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Копче със списък на устройствата"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Предпочитани подпрозорци"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Допълнителни възможности на файловите обвързвания"
#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Файлови обвързвания"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Нов размер"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Действия с файлове"
#: ulng.rsoptionseditorfilepanels
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Файлови крила"
#: ulng.rsoptionseditorfilesearch
#, fuzzy
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Файлово търсене"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Файлов изглед"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Видове файлове"
#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Папкови подпрозорци"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Допълнителни настройки на подпрозорците"
#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Шрифтове"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Оцветяване"
#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Клавишни съчетания"
#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Значета"
#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Пренебрегвания"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Клавиши"
#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Език"
#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr "Подредба"
#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Дневник"
#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Разни"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Мишка"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Приставки"
#: ulng.rsoptionseditorquicksearch
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Бързо търсене/пресяване"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Терминал"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Лента с пособия"
#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Пособия"
#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Подсказки"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr ""
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr ""
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Няма;Ред за управление;Бързо търсене;Бързо пресяване"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Ляво цъкало;Дясно цъкало;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr ""
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Приставката %s вече свързана със следното разширение:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Деен"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Файлово име"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Име"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Записано на"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&с отчитане на глАВноСТта;&без отчитане на глАВноСТта;"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Файлове;&Папки;Файлове &и папки"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr ""
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "Без отчитане на глАВноСТта;Според местните настройки (аАбБвВ);първо главните, после редовните(АБВабв)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "по име и показване най-отгоре;като файлове и показване най-отгоре;като файлове"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Азбучно, с отчитане на ударенията;Естествено: азбучно и числено"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Отгоре;Отдолу"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "Раз&делител;&Вътрешна заповед;Въ&ншна заповед;&Изборник"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr ""
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "без пренареждане;според настройките за новите файлове;подреждане"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Файлове: %d, папки: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr ""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr ""
#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "Файл"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Папка"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Наименована тръба"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Гнездо"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Нарочно блоково устройство"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Нарочно знаково устройство"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Мека връзка"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Неизвестен вид"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Намерени"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr ""
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr ""
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Избор на папка"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr ""
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Всички"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr ""
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr ""
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Заповед"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr ""
#: ulng.rssimplewordfiles
msgid "files"
msgstr ""
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr ""
#: ulng.rssimplewordresult
msgid "Result"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr ""
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "байта"
#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr "гигабайта"
#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr "килобайта"
#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr "мегабайта"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "терабайта"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Файлове: %d, папки: %d, размер: %s (%s байта)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Създаването на целевата папка е невъзможно!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Неправилно изписване на файловия размер!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Неуспешно раздробяване на файла!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr ""
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Изберете папка:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr ""
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr ""
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Грешка при създаване на мека връзка."
#: ulng.rssyndefaulttext
msgctxt "ulng.rssyndefaulttext"
msgid "Default text"
msgstr ""
#: ulng.rssynlangplaintext
msgctxt "ulng.rssynlangplaintext"
msgid "Plain text"
msgstr ""
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr ""
#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Ден/ дни"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "час(а)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "минута/и"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "месец(а)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "секунда/и"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "седмица/и"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "година/и"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr ""
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr ""
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Сравнител"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Обработчик"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr ""
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr ""
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr ""
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr ""
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Терминал"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Преглед"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr ""
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr ""
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr ""
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr ""
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr ""
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr ""
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr ""
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr ""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr ""
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr ""
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr ""
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr ""
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr ""
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr ""
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr ""
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr ""
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr ""
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr ""
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr ""
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr ""
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr ""
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr ""
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr ""
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr ""
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr ""
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr ""
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr ""
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr ""
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr ""
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr ""
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr ""
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr ""
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr ""
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr ""
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Мрежа"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Вътрешен преглед на Double Commander"
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Ниско качество"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Знаков набор"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Вид на изображението"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Нов размер"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s не е открит!"
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "с външен преглед"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "с вътрешен преглед"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr ""
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr ""