doublecmd/language/doublecmd.sk.po

13247 lines
334 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.6.0 beta\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2012-05-08 18:30+0300\n"
"PO-Revision-Date: 2015-03-16 20:20+0100\n"
"Last-Translator: Rastislav Vojtek <rastislav.vojtek@enel.com>\n"
"Language-Team: Slovenský <sk@li.org>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Slovenčina\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr ""
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr ""
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr ""
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr ""
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Vyber šablónu"
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
#, fuzzy
#| msgid "Check free space"
msgid "C&heck free space"
msgstr "Kontrolovať voľné miesto"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Kopírovať atribút&y"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Kopírovať vlastníka"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopírov&ať dátum/čas"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
#, fuzzy
#| msgid "Correct links"
msgid "Correct lin&ks"
msgstr "Opraviť od&kazy"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
#, fuzzy
#| msgid "Drop readonly flag"
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
msgid "Drop readonly fla&g"
msgstr "Zahodiť znak len na čítanie"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Vynechať prázdne adresáre"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
#, fuzzy
#| msgid "Follow links"
msgid "Fo&llow links"
msgstr "Nas&ledovať odkazy"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "Vyh&radený priestor"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Čo urobiť, ak nemôžem nastaviť súboru čas, atribúty a pod."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Použi šablónu súboru"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
#, fuzzy
#| msgid "When directory exists"
msgid "When dir&ectory exists"
msgstr "Ak adresár &existuje"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
#, fuzzy
#| msgid "When file exists"
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When &file exists"
msgstr "Ak súbor existuje"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Ak sa nedá nastaviť vlastnosť"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr ""
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr "&Zavrieť"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Kopírovať do schránky"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "O programe"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Build"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Domovská stránka:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revízia"
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Verzia"
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Reset"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Zvoľte atribúty"
#: tfrmattributesedit.cbarchive.caption
#, fuzzy
#| msgid "Archive"
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
msgid "&Archive"
msgstr "Archivovať"
#: tfrmattributesedit.cbcompressed.caption
#, fuzzy
#| msgid "Compressed"
msgid "Co&mpressed"
msgstr "Komprimovaný"
#: tfrmattributesedit.cbdirectory.caption
#, fuzzy
#| msgid "Directory"
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
msgid "&Directory"
msgstr "Adresár"
#: tfrmattributesedit.cbencrypted.caption
#, fuzzy
#| msgid "Encrypted"
msgid "&Encrypted"
msgstr "Šifrovaný"
#: tfrmattributesedit.cbhidden.caption
#, fuzzy
#| msgid "Hidden"
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
msgid "&Hidden"
msgstr "Skrytý"
#: tfrmattributesedit.cbreadonly.caption
#, fuzzy
#| msgid "Read only"
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
msgid "Read o&nly"
msgstr "Len na čítanie"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
#, fuzzy
#| msgid "Sparse"
msgid "S&parse"
msgstr "Riedky"
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Sticky"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
#, fuzzy
#| msgid "Symlink"
msgid "&Symlink"
msgstr "&Symbolický link"
#: tfrmattributesedit.cbsystem.caption
#, fuzzy
#| msgid "System"
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "S&ystémový"
#: tfrmattributesedit.cbtemporary.caption
#, fuzzy
#| msgid "Temporary"
msgid "&Temporary"
msgstr "Dočasný"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "NTFS atribúty"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Všeobecné atribúty"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitov:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Skupina"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ostatní"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlastník"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Spustiť"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čítanie"
#: tfrmattributesedit.lbltextattrs.caption
#, fuzzy
#| msgid "As text:"
msgid "As te&xt:"
msgstr "Ako te&xt:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zápis"
#: tfrmchecksumcalc.caption
#, fuzzy
#| msgid "Calculate check sum..."
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Výpočet kontrolného súčtu..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr ""
#: tfrmchecksumcalc.cbseparatefile.caption
#, fuzzy
#| msgid "Create separate checksum file for each file"
msgid "C&reate separate checksum file for each file"
msgstr "Vytvo&riť samostatný MD5/SHA1 pre každý súbor"
#: tfrmchecksumcalc.lblsaveto.caption
#, fuzzy
#| msgid "&Save check sum file(s) to:"
msgid "&Save checksum file(s) to:"
msgstr "Uložiť &súbor(y) s kontrolným súčtom do:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavrieť"
#: tfrmchecksumverify.caption
#, fuzzy
#| msgid "Verify check sum..."
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Overiť kontrolný súčet..."
#: tfrmconnectionmanager.btnadd.caption
#, fuzzy
#| msgid "Add"
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "Pri&dať"
#: tfrmconnectionmanager.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmconnectionmanager.btnconnect.caption
#, fuzzy
#| msgid "Connect"
msgid "C&onnect"
msgstr "Prip&ojiť"
#: tfrmconnectionmanager.btndelete.caption
#, fuzzy
#| msgid "Delete"
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "Vymazať"
#: tfrmconnectionmanager.btnedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Upraviť"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Správca pripojení"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Pripojiť k:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "Pri&daj do fronty"
#: tfrmcopydlg.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "Voľby"
#: tfrmcopydlg.btnsaveoptions.caption
#, fuzzy
#| msgid "Save these options as default"
msgid "Sa&ve these options as default"
msgstr "Uložiť tieto &voľby ako východzie"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Kopírovať súbor(y)"
#: tfrmcopydlg.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Nový rad"
#: tfrmcopydlg.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Rad 1"
#: tfrmcopydlg.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Rad 2"
#: tfrmcopydlg.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Rad 3"
#: tfrmcopydlg.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Rad 4"
#: tfrmcopydlg.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Rad 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr ""
#: tfrmdescredit.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Komentár k súboru/adresáru"
#: tfrmdescredit.lbleditcommentfor.caption
#, fuzzy
#| msgid "Edit comment for:"
msgid "E&dit comment for:"
msgstr "Upraviť komentár k:"
#: tfrmdescredit.lblencoding.caption
#, fuzzy
#| msgid "Encoding:"
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "Zakódovani&e:"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programe"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Automaticky porovnať"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Binárny mód"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Zrušiť"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Zrušiť"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Kopírovať blok vpravo"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Kopírovať blok vpravo"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Kopírovať blok vľavo"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Kopírovať blok vľavo"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Vystrihnúť"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Vymazať"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Vložiť"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Opakovať"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Vybr&ať všetko"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Späť"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "&Koniec"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Prvý rozdiel"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "tfrmdiffer.actfirstdifference.hint"
msgid "First Difference"
msgstr "Prvý rozdiel"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Ignorovať veľkosť písmien"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Ignorovať prázdne znaky"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Skrolovať bez prerušenia"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Posledný rozdiel"
#: tfrmdiffer.actlastdifference.hint
msgctxt "tfrmdiffer.actlastdifference.hint"
msgid "Last Difference"
msgstr "Posledný rozdiel"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Rozdiely riadkov"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Ďalší rozdiel"
#: tfrmdiffer.actnextdifference.hint
msgctxt "tfrmdiffer.actnextdifference.hint"
msgid "Next Difference"
msgstr "Ďalší rozdiel"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Otvoriť ľavý"
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Otvoriť pravý"
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Vyfarbiť pozadie"
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Predchádzajúci rozdiel"
#: tfrmdiffer.actprevdifference.hint
msgctxt "tfrmdiffer.actprevdifference.hint"
msgid "Previous Difference"
msgstr "Predchádzajúci rozdiel"
#: tfrmdiffer.actreload.caption
#, fuzzy
#| msgid "Reload"
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
msgid "&Reload"
msgstr "Obnoviť"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Obnoviť"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Uložiť"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Uložiť"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Uložiť ako..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Uložiť ako..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Uložiť ľavý"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Uložiť ľavý"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Uložiť ľavý ako..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Uložiť ľavý ako..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Uložiť pravý"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Uložiť pravý"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Uložiť pravý ako..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Uložiť pravý ako..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Porovnať"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Porovnať"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Kódovanie"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Kódovanie"
#: tfrmdiffer.caption
msgctxt "tfrmdiffer.caption"
msgid "Compare files"
msgstr "Porovnať súbory"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
#, fuzzy
#| msgid "Left"
msgid "&Left"
msgstr "Vľavo"
#: tfrmdiffer.miencodingright.caption
#, fuzzy
#| msgid "Right"
msgid "&Right"
msgstr "Vpravo"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Akcie"
#: tfrmdiffer.mnuedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Upraviť"
#: tfrmdiffer.mnuencoding.caption
#, fuzzy
#| msgid "Encoding"
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "Kódovanie"
#: tfrmdiffer.mnufile.caption
#, fuzzy
#| msgid "File"
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "Súbor"
#: tfrmdiffer.mnuoptions.caption
#, fuzzy
#| msgid "Options"
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
msgid "&Options"
msgstr "&Nastavenia"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Pridaj novú skratku k sekvencii"
#: tfrmedithotkey.btncancel.caption
msgctxt "tfrmedithotkey.btncancel.caption"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmedithotkey.btnok.caption
msgctxt "tfrmedithotkey.btnok.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Zmazať poslednú skratku zo sekvencie"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr "Iba pre toto riadenie"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parametre (každý v samostatnom riadku):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Klávesové skratky"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programe"
#: tfrmeditor.actabout.hint
msgctxt "tfrmeditor.actabout.hint"
msgid "About"
msgstr "O programe"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Konfigurácia"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Umiestnenie konfigurácie"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmeditor.acteditcopy.hint
msgctxt "tfrmeditor.acteditcopy.hint"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Vystrihnúť"
#: tfrmeditor.acteditcut.hint
msgctxt "tfrmeditor.acteditcut.hint"
msgid "Cut"
msgstr "Vystrihnúť"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Vymazať"
#: tfrmeditor.acteditdelete.hint
msgctxt "tfrmeditor.acteditdelete.hint"
msgid "Delete"
msgstr "Vymazať"
#: tfrmeditor.acteditfind.caption
#, fuzzy
#| msgid "&Find "
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Hľadať"
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Hľadať"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Hľadať ďalší"
#: tfrmeditor.acteditfindnext.hint
msgctxt "tfrmeditor.acteditfindnext.hint"
msgid "Find next"
msgstr "Hľadať ďalší"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr ""
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr ""
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr ""
#: tfrmeditor.acteditlineendcr.hint
msgctxt "tfrmeditor.acteditlineendcr.hint"
msgid "Mac (CR)"
msgstr ""
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr ""
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
msgid "Windows (CRLF)"
msgstr ""
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr ""
#: tfrmeditor.acteditlineendlf.hint
msgctxt "tfrmeditor.acteditlineendlf.hint"
msgid "Unix (LF)"
msgstr ""
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Vložiť"
#: tfrmeditor.acteditpaste.hint
msgctxt "tfrmeditor.acteditpaste.hint"
msgid "Paste"
msgstr "Vložiť"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Opakovať"
#: tfrmeditor.acteditredo.hint
msgctxt "tfrmeditor.acteditredo.hint"
msgid "Redo"
msgstr "Opakovať"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Nahradiť"
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Nahradiť"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Vybrať &Všetko"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Vybrať všetko"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Späť"
#: tfrmeditor.acteditundo.hint
msgctxt "tfrmeditor.acteditundo.hint"
msgid "Undo"
msgstr "Zpäť"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavrieť"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Zavrieť"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Koniec"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Koniec"
#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "&Nový"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Nový"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Otvoriť"
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Otvoriť"
#: tfrmeditor.actfilesave.caption
#, fuzzy
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Uložiť"
#: tfrmeditor.actfilesave.hint
msgctxt "tfrmeditor.actfilesave.hint"
msgid "Save"
msgstr "Uložiť"
#: tfrmeditor.actfilesaveas.caption
#, fuzzy
#| msgid "Save &As.."
msgid "Save &As..."
msgstr "Uložiť &ako.."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Uložiť ako"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "&Uložiť Všetko"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Uložiť všetko"
#: tfrmeditor.caption
msgctxt "TFRMEDITOR.CAPTION"
msgid "Editor"
msgstr "Editor"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "&Pomoc"
#: tfrmeditor.menuitem1.caption
#, fuzzy
msgctxt "tfrmeditor.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editovať"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Kó&dovanie"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Otvoriť ako"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Uložiť ako"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Súbor"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Zvýrazňovanie syntaxu"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Koniec riadku"
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n5.caption
msgctxt "tfrmeditor.n5.caption"
msgid "-"
msgstr "-"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
msgid "C&ase sensitivity"
msgstr "&Rozlišovať veľkosť"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
#, fuzzy
#| msgid "Search from &caret"
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
msgid "S&earch from caret"
msgstr "Hľadať od &striešky"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "&Regulárne výrazy"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
msgid "Selected &text only"
msgstr "Len vybraný &text"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
msgid "&Whole words only"
msgstr "&Len celé slová"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
msgid "Option"
msgstr "Voľba"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
msgid "&Replace with:"
msgstr "&Nahradiť týmto:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
msgid "&Search for:"
msgstr "&Vyhľadať:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
msgid "Direction"
msgstr "Smer"
#: tfrmextractdlg.caption
msgctxt "tfrmextractdlg.caption"
msgid "Unpack files"
msgstr "Rozbaliť súbory"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Rozbaliť aj s cestou, ak je uložená"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Rozbaliť do oddelených po&dzložiek (podľa názvu archívu)"
#: tfrmextractdlg.cboverwrite.caption
#, fuzzy
#| msgid "&Overwrite existing files"
msgid "O&verwrite existing files"
msgstr "&Prepísať existujúca súbory"
#: tfrmextractdlg.lblextractto.caption
#, fuzzy
#| msgid "To the directory:"
msgid "To the &directory:"
msgstr "Rozbaliť súbory do:"
#: tfrmextractdlg.lblfilemask.caption
#, fuzzy
#| msgid "Extract files matching file mask:"
msgid "&Extract files matching file mask:"
msgstr "&Súbory na rozbalenie:"
#: tfrmextractdlg.lblpassword.caption
#, fuzzy
#| msgid "Password for encrypted files:"
msgid "&Password for encrypted files:"
msgstr "Heslo pre šifrované súbory:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavrieť"
#: tfrmfileexecuteyourself.caption
msgctxt "tfrmfileexecuteyourself.caption"
msgid "Wait..."
msgstr "Čakaj..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Meno súboru"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "Od:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Kliknite na Zavrieť, až keď bude možné zmazať dočasné súbory."
#: tfrmfileop.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "Na panel"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "Pohľad všetko"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Aktuálna operácia:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Od:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Do:"
#: tfrmfileproperties.btnclose.caption
#, fuzzy
#| msgid "Close"
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Zavrieť"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "Nastav vlastnosti"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Nastav na všetky vybrané súbory"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Preskoč tento súbor"
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr "Vlastnosti"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Sticky"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Vlastník"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitov:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Skupina"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ostatní"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlastník"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
#, fuzzy
#| msgid "Representation in text:"
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Textovo:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "tfrmfileproperties.lblcontains.caption"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Obsahuje:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Spustiť"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Názov súboru"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Názov súboru"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Cesta:"
#: tfrmfileproperties.lblgroupstr.caption
#, fuzzy
#| msgid "Group"
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
msgid "&Group"
msgstr "Skupina"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Posledný prístup:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Posledná zmena:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Posledná zmena stavu:"
#: tfrmfileproperties.lbloctal.caption
#, fuzzy
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Číselne:"
#: tfrmfileproperties.lblownerstr.caption
#, fuzzy
#| msgid "Owner"
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
msgid "O&wner"
msgstr "Vlastník"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čítanie"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Veľkosť:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
#, fuzzy
#| msgid "Symlink:"
msgid "Symlink to:"
msgstr "Zástupca:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
#, fuzzy
msgid "Type:"
msgstr "Typ:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zápis"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Meno"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Hodnota"
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atribúty"
#: tfrmfileproperties.tsimage.caption
msgid "Image"
msgstr ""
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Vlastnosti"
#: tfrmfinddlg.actcancel.caption
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "&Zrušiť"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "&Zavrieť"
#: tfrmfinddlg.actclose.caption
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "Zavrieť"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Upraviť"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "&Výsledok do okna"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Choď na súbor"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Vyhľadávať v obsahu"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Posledné vyhľadávanie"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Nové hľadanie"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr ""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr ""
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr ""
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr ""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr ""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Start"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "Z&obraziť"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Prid&ať"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Pomoc"
#: tfrmfinddlg.btnsavetemplate.caption
#, fuzzy
#| msgid "Save"
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Uložiť"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Vymazať"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "&Načítať"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "&Uložiť"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Ulož s \"Start in directory\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Ak je uložené potom \"Start in directory\" bude obnovené pri nahrávaní šablóny. Použiť pri oprave hľadania na určený adresár."
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Použi šablónu"
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Hľadať súbory"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Rozl&išovať veľkosť"
#: tfrmfinddlg.cbdatefrom.caption
#, fuzzy
#| msgid "Date From:"
msgid "&Date from:"
msgstr "&Dátum od:"
#: tfrmfinddlg.cbdateto.caption
#, fuzzy
#| msgid "Date To:"
msgid "Dat&e to:"
msgstr "Dátum do:"
#: tfrmfinddlg.cbfilesizefrom.caption
#, fuzzy
#| msgid "Size from:"
msgid "S&ize from:"
msgstr "Veľkosť od:"
#: tfrmfinddlg.cbfilesizeto.caption
#, fuzzy
#| msgid "Size to:"
msgid "Si&ze to:"
msgstr "Veľkosť do:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr ""
#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "Vyhľadať &text"
#: tfrmfinddlg.cbfollowsymlinks.caption
#, fuzzy
#| msgid "Follow symlinks"
msgctxt "tfrmfinddlg.cbfollowsymlinks.caption"
msgid "Follow s&ymlinks"
msgstr "Nasledovať symlinky"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "Hľadať súbory NE&obsahujúce text"
#: tfrmfinddlg.cbnotolderthan.caption
#, fuzzy
#| msgid "Not older than:"
msgid "N&ot older than:"
msgstr "Nie staršie ako:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr ""
#: tfrmfinddlg.cbpartialnamesearch.caption
#, fuzzy
#| msgid "Search for part of file name "
msgid "Searc&h for part of file name"
msgstr "Hľadať časť mena"
#: tfrmfinddlg.cbregexp.caption
#, fuzzy
#| msgid "&Regular expressions"
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "&Regulárne výrazy"
#: tfrmfinddlg.cbreplacetext.caption
#, fuzzy
#| msgid "Re&place text"
msgid "Re&place by"
msgstr "Nahradiť text"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Vybrané adresáre a súbory"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr ""
#: tfrmfinddlg.cbtimefrom.caption
#, fuzzy
#| msgid "Time from:"
msgid "&Time from:"
msgstr "Čas od:"
#: tfrmfinddlg.cbtimeto.caption
#, fuzzy
#| msgid "Time to:"
msgid "Ti&me to:"
msgstr "Čas do:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "Po&užiť vyhľadávací zásuvný modul:"
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Zadaj mená adresárov, ktoré by mali byť vynechané z vyhľadávania oddelené \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Zadaj mená súborov, ktoré by mali byť vynechané z vyhľadávania oddelené \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Zadaj mená súborov oddelené \";\""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Adresáre"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Súbory"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Vyhľadávať v obsahu"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Atribúty"
#: tfrmfinddlg.lblencoding.caption
#, fuzzy
#| msgid "Encoding:"
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
msgid "Encodin&g:"
msgstr "Kódovanie:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "V&ynechať podadresáre"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Vynechať súbory"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "&Súborová maska"
#: tfrmfinddlg.lblfindpathstart.caption
#, fuzzy
#| msgid "&Start in directory"
msgid "Start in &directory"
msgstr "&Adresárová maska"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Prehľadať po&dadresáre:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Predchádzajúce hľadania:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr ""
#: tfrmfinddlg.mioptions.caption
#, fuzzy
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Nastavenia"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Odobrať zo zoznamu"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.miseparator1.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.miseparator2.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Ukázať všetky nájdené položky"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr ""
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Zobraziť v prehliadači"
#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Zobraziť"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Rozšírené"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Načítať/Uložiť"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Zásuvné moduly"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Výsledky"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Normálne"
#: tfrmfindview.btnclose.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmfindview.btnfind.caption
#, fuzzy
#| msgid "Find"
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "Hľadať"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Hľadať"
#: tfrmfindview.cbcasesens.caption
#, fuzzy
#| msgid "Case sensitive"
msgid "C&ase sensitive"
msgstr "Rozlišovat veľkosť"
#: tfrmhardlink.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmhardlink.caption
#, fuzzy
#| msgid "Create hardlink"
msgid "Create hard link"
msgstr "Vytvoriť hardlink"
#: tfrmhardlink.lblexistingfile.caption
#, fuzzy
#| msgid "Destination that the link will point to"
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Cieľ (kam bude odkaz ukazovať)"
#: tfrmhardlink.lbllinktocreate.caption
#, fuzzy
#| msgid "Link name"
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Názov odkazu"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr ""
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr ""
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr ""
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr ""
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr ""
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgctxt "tfrmlinker.caption"
msgid "Linker"
msgstr "Spojovač súborov"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Uložiť do..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Položka"
#: tfrmlinker.lblfilename.caption
#, fuzzy
#| msgid "File name"
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "Názov súboru"
#: tfrmlinker.spbtndown.caption
#, fuzzy
#| msgid "Down"
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "Dolu"
#: tfrmlinker.spbtndown.hint
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
msgid "Down"
msgstr "Dolu"
#: tfrmlinker.spbtnrem.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "Odst&rániť"
#: tfrmlinker.spbtnrem.hint
#, fuzzy
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "Vymazať"
#: tfrmlinker.spbtnup.caption
#, fuzzy
#| msgid "Up"
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "Hore"
#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Hore"
#: tfrmmain.actabout.caption
#, fuzzy
#| msgid "About"
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
msgid "&About"
msgstr "O programe"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Pridať názov súboru do príkazového riadku"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Uložiť cestu a názov súboru do príkazového riadku"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Kopírovať cestu do príkazového riadku"
#: tfrmmain.actbriefview.caption
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr ""
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr ""
#: tfrmmain.actcalculatespace.caption
#, fuzzy
#| msgid "Calculate &Occupied Space..."
msgid "Calculate &Occupied Space"
msgstr "Vypočítať &obsadené miesto..."
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Zmeniť adresár"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr ""
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Ísť do nadradeného adresára"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Ísť do koreňového adresára"
#: tfrmmain.actchecksumcalc.caption
#, fuzzy
#| msgid "Calculate check sum..."
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "Vytvoriť kontrolný súčet..."
#: tfrmmain.actchecksumverify.caption
#, fuzzy
#| msgid "Verify check sum..."
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "Overiť kontrolný súčet..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Vymazať log súbor"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Vymazať okno logu"
#: tfrmmain.actclosealltabs.caption
#, fuzzy
#| msgid "Remove &All Tabs"
msgctxt "tfrmmain.actclosealltabs.caption"
msgid "Close &All Tabs"
msgstr "Vymazať záložky"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr ""
#: tfrmmain.actclosetab.caption
#, fuzzy
#| msgid "&Remove Tab"
msgctxt "tfrmmain.actclosetab.caption"
msgid "&Close Tab"
msgstr "Zavrieť záložku"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Nasledujúci príkazový riadok"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Nastav príkazový riadok na nasledujúci príkaz v histórii"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Predchádzajúci príkazový riadok"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Nastav príkazový riadok na predchádzajúci príkaz v histórii"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Plný"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Stĺpcový pohľad"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Porovnať po&dľa obsahu"
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr "Porovnať adresáre"
#: tfrmmain.actcomparedirectories.hint
msgctxt "tfrmmain.actcomparedirectories.hint"
msgid "Compare Directories"
msgstr "Porovnať adresáre"
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr ""
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr ""
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr ""
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr ""
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Zobraziť kontextové menu"
#: tfrmmain.actcopy.caption
#, fuzzy
#| msgid "Copy F5"
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr ""
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr ""
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Kopírovať mená, vrátane cesty, do schránky"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Kopírovať mená súborov do schránky"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Kopírovať súbory bez potvrdzovania"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr ""
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr ""
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Kopírovať do rovnakého panelu"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "Kopírovať"
#: tfrmmain.actcountdircontent.caption
#, fuzzy
#| msgid "Sho&w occupied space"
msgid "Sho&w Occupied Space"
msgstr "Zo&braziť obsadené miesto"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Vys&trihnúť"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr ""
#: tfrmmain.actdelete.caption
#, fuzzy
#| msgid "Delete F8"
msgctxt "tfrmmain.actdelete.caption"
msgid "Delete"
msgstr "Vymazať"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "História zložiek"
#: tfrmmain.actdirhotlist.caption
#, fuzzy
#| msgid "Directory &hotlist"
msgid "Directory &Hotlist"
msgstr "&Rýchle adresáre"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr ""
#: tfrmmain.actedit.caption
#, fuzzy
#| msgid "Edit F4"
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Editovať"
#: tfrmmain.acteditcomment.caption
#, fuzzy
#| msgid "Edit comment..."
msgid "Edit Co&mment..."
msgstr "Upraviť ko&mentár..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Editovať nový súbor"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Upraviť cestu nad zoznamom súborov"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Zameniť &panely"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
#, fuzzy
#| msgid "Exit"
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "Koniec"
#: tfrmmain.actextractfiles.caption
#, fuzzy
#| msgid "Extract files..."
msgid "&Extract Files..."
msgstr "Rozbaliť súbory..."
#: tfrmmain.actfileassoc.caption
#, fuzzy
#| msgid "File &Associations..."
msgid "Configuration of File &Associations"
msgstr "Asociácia súborov..."
#: tfrmmain.actfilelinker.caption
#, fuzzy
#| msgid "Link files"
msgid "Com&bine Files..."
msgstr "Spojiť súbory"
#: tfrmmain.actfileproperties.caption
#, fuzzy
#| msgid "Show file properties"
msgid "Show &File Properties"
msgstr "Zobraziť vlastnosti súboru"
#: tfrmmain.actfilespliter.caption
#, fuzzy
#| msgid "Split file"
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
msgid "Spl&it File..."
msgstr "Rozdeliť súbor..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr ""
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Aktivovať príkazový riadok"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Umiestniť kurzor na prvý súbor zoznamu"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Umiestniť kurzor na posledný súbor zoznamu"
#: tfrmmain.acthardlink.caption
#, fuzzy
#| msgid "Create hard link..."
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
msgid "Create &Hard Link..."
msgstr "Vytvoriť &HardLink..."
#: tfrmmain.acthelpindex.caption
#, fuzzy
#| msgid "Contents"
msgid "&Contents"
msgstr "Obsah"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "Režim s horizontálnymi panelmi"
#: tfrmmain.actkeyboard.caption
#, fuzzy
#| msgid "Keyboard"
msgid "&Keyboard"
msgstr "Klávesnica"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr ""
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr ""
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Ľavý &= Pravý"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr ""
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Otvoriť ľavý zoznam diskov"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr ""
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr ""
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr ""
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr ""
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr ""
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr ""
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr ""
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr ""
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Nahrať vý&ber zo schránky"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "Nahrať výber zo súboru..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr ""
#: tfrmmain.actmakedir.caption
#, fuzzy
#| msgid "MakeDir"
msgid "Create &Directory"
msgstr "Vytvor adresár"
#: tfrmmain.actmarkcurrentextension.caption
#, fuzzy
#| msgid "Select all with same extension"
msgid "Select All with the Same E&xtension"
msgstr "Vybrať všetko s rovnakou príponou"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
#, fuzzy
#| msgid "Invert Selections"
msgid "&Invert Selection"
msgstr "Invertovať výber"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "&Vybrať všetko"
#: tfrmmain.actmarkminus.caption
#, fuzzy
#| msgid "Unselect a group"
msgid "Unselect a Gro&up..."
msgstr "Zrušiť výber sk&upiny"
#: tfrmmain.actmarkplus.caption
#, fuzzy
#| msgid "Select a group"
msgid "Select a &Group..."
msgstr "Výber skupiny"
#: tfrmmain.actmarkunmarkall.caption
#, fuzzy
#| msgid "Unselect All"
msgid "&Unselect All"
msgstr "Zr&ušiť výber"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimalizovať okno"
#: tfrmmain.actmultirename.caption
#, fuzzy
#| msgid "Multi Rename Tool"
msgid "Multi &Rename Tool"
msgstr "Nástroj pre hromadné premenovanie"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Pripojiť sieťový adresár"
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "Odpojiť sieťový adresár"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Rýchle pripojiť zo siete"
#: tfrmmain.actnewtab.caption
#, fuzzy
#| msgid "&New tab"
msgid "&New Tab"
msgstr "Nová záložka"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actnexttab.caption
#, fuzzy
#| msgid "Switch to nex&t tab"
msgid "Switch to Nex&t Tab"
msgstr "Prepnúť do novej záložky"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Otvoriť"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Zkúsiť otvoriť archív"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Otvoriť súbor lišty"
#: tfrmmain.actopendirinnewtab.caption
#, fuzzy
#| msgid "Open &folder in new tab"
msgid "Open &Folder in a New Tab"
msgstr "Otvoriť adresár v novej záložke"
#: tfrmmain.actopenvirtualfilesystemlist.caption
#, fuzzy
#| msgid "Open VFS List"
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
msgid "Open &VFS List"
msgstr "Otvoriť VFS zoznam"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "Konzola operácií"
#: tfrmmain.actoptions.caption
#, fuzzy
#| msgid "Options..."
msgid "&Options..."
msgstr "Nastavenia..."
#: tfrmmain.actpackfiles.caption
#, fuzzy
#| msgid "Pack files..."
msgid "&Pack Files..."
msgstr "Zabaliť súbory..."
#: tfrmmain.actpanelssplitterperpos.caption
#, fuzzy
msgid "Set splitter position"
msgstr "Nastaviť pozíciu deliacej čiary"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "Vložiť"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actprevtab.caption
#, fuzzy
#| msgid "Switch to &previous tab"
msgid "Switch to &Previous Tab"
msgstr "Prepnúť do predchádzajúcej záložky"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Rýchly filter"
#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Rýchle hľadanie"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "Panel rýchleho náhľadu"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Obnoviť"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrename.caption
#, fuzzy
#| msgid "Move F6"
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Presun"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Presunúť/premenovať súbory bez potvrdzovania"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Premenovať"
#: tfrmmain.actrenametab.caption
#, fuzzy
#| msgid "Re&name Tab"
msgid "&Rename Tab"
msgstr "Preme&novať záložku"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "Obnoviť výbe&r"
#: tfrmmain.actreverseorder.caption
#, fuzzy
#| msgid "Reverse order"
msgid "Re&verse Order"
msgstr "Obrátené poradie"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr ""
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr ""
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Pravý &= Ľavý"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr ""
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Otvoriť pravý zoznam diskov"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr ""
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr ""
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr ""
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr ""
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr ""
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr ""
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr ""
#: tfrmmain.actrunterm.caption
#, fuzzy
#| msgid "Run Term"
msgid "Run &Terminal"
msgstr "Spustiť terminál"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr ""
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Uložiť výber"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Uložiť výber do &súboru..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr ""
#: tfrmmain.actsearch.caption
#, fuzzy
#| msgid "&Search"
msgid "&Search..."
msgstr "&Hľadať"
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr ""
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr ""
#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "Zmena atribútov"
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Uzamknuté; adresáre otvárať v nových záložkách"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normálne"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "Uzamknuté"
#: tfrmmain.actsettaboptionpathresets.caption
#, fuzzy
#| msgid "Locked, but &directory changes allowed"
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
msgid "Locked with &Directory Changes Allowed"
msgstr "Uzamknuté; zmena adresára povolená"
#: tfrmmain.actshellexecute.caption
msgctxt "tfrmmain.actshellexecute.caption"
msgid "Open"
msgstr "Otvoriť"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Otvor použité systémové asociácie"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Zobraziť menu tlačítok"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Zobraziť históriu príkazového riadku"
#: tfrmmain.actshowmainmenu.caption
#, fuzzy
#| msgid "Menu F9"
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Menu"
#: tfrmmain.actshowsysfiles.caption
#, fuzzy
#| msgid "Show hidden/system files"
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "Zobraziť skryté/systémové súbory"
#: tfrmmain.actsortbyattr.caption
#, fuzzy
#| msgid "Sort by attrib"
msgid "Sort by &Attributes"
msgstr "Triediť podľa &atribútov"
#: tfrmmain.actsortbydate.caption
#, fuzzy
#| msgid "Sort by date"
msgid "Sort by &Date"
msgstr "Triediť podľa &dátumu"
#: tfrmmain.actsortbyext.caption
#, fuzzy
#| msgid "Sort by extension"
msgid "Sort by &Extension"
msgstr "Tri&ediť podľa prípony"
#: tfrmmain.actsortbyname.caption
#, fuzzy
#| msgid "Sort by name"
msgid "Sort by &Name"
msgstr "Triediť podľa &názvu"
#: tfrmmain.actsortbysize.caption
#, fuzzy
#| msgid "Sort by size"
msgid "Sort by &Size"
msgstr "Triediť podľa veľko&sti"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr ""
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Povoliť/zakázať zoznam súborov, ktoré sa nemajú zobrazovať"
#: tfrmmain.actsymlink.caption
#, fuzzy
#| msgid "Create symbolic link..."
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "Vytvoriť Sym&Link..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr ""
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Cieľ &= Zdroj"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Testovať archív(y)"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Náhľady"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Pohľad s náhľadmi"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr ""
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Preniesť adresár pod kurzorom do ľavého okna"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Preniesť adresár pod kurzorom do pravého okna"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr ""
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr ""
#: tfrmmain.actunmarkcurrentextension.caption
#, fuzzy
#| msgid "Unselect all with same extension"
msgid "Unselect All with the Same Ex&tension"
msgstr "Zrušiť výber súborov s rovnakou príponou"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
#, fuzzy
#| msgid "View F3"
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Zobraziť"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Zobraziť históriu navštívených ciest"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Ísť na nasledujúcu položku v histórii"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Ísť na predchádzajúcu položku v histórii"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr ""
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
#, fuzzy
#| msgid "&Visit Double Commander Web Site"
msgid "&Visit Double Commander Website"
msgstr "Navštíviť domovskú stránku"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Bezpečne zmazať"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr ""
#: tfrmmain.btnf10.caption
#, fuzzy
#| msgid "Exit F10"
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Koniec"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Adresár"
#: tfrmmain.btnf8.caption
msgctxt "tfrmmain.btnf8.caption"
msgid "Delete"
msgstr "Vymazať"
#: tfrmmain.btnf9.caption
#, fuzzy
#| msgid "Terminal F9"
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminál"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
#, fuzzy
#| msgid "Directory hotlist"
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Hotlist zložiek"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Zobraziť aktuálny adresár pravého panelu v ľavom panely"
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Ísť do domovského adresára"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Ísť do koreňového adresára"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Ísť do nadradeného adresára"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
#, fuzzy
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Rýchle adresáre"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Zobraziť aktuálny adresár ľavého panelu v pravom panely"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "tfrmmain.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Cesta"
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Zrušiť"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Kopírovať..."
#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Vytvoriť odkaz..."
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline10.caption
#, fuzzy
msgctxt "tfrmmain.miline10.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline11.caption
#, fuzzy
msgctxt "tfrmmain.miline11.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline21.caption
#, fuzzy
msgctxt "tfrmmain.miline21.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline23.caption
#, fuzzy
msgctxt "tfrmmain.miline23.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline26.caption
#, fuzzy
msgctxt "tfrmmain.miline26.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline33.caption
msgctxt "tfrmmain.miline33.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline37.caption
msgctxt "tfrmmain.miline37.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline38.caption
msgctxt "tfrmmain.miline38.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline39.caption
#, fuzzy
msgctxt "tfrmmain.miline39.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline40.caption
#, fuzzy
msgctxt "tfrmmain.miline40.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline50.caption
msgctxt "tfrmmain.miline50.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline55.caption
#, fuzzy
msgctxt "tfrmmain.miline55.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Vyčistiť"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Skryť"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Vybrať všetko"
#: tfrmmain.mimove.caption
#, fuzzy
msgid "Move..."
msgstr "Presunúť..."
#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Vytvoriť symlink..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Možnosti záložiek"
#: tfrmmain.mitrayiconexit.caption
#, fuzzy
#| msgid "Exit"
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "Koniec"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Obnoviť"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "tfrmmain.mnualloperstart.caption"
msgid "Start"
msgstr "Štart"
#: tfrmmain.mnualloperstop.caption
msgctxt "tfrmmain.mnualloperstop.caption"
msgid "Cancel"
msgstr "Zrušiť"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Príkazy"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "&Konfigurácia"
#: tfrmmain.mnucontextline1.caption
msgctxt "tfrmmain.mnucontextline1.caption"
msgid "-"
msgstr "-"
#: tfrmmain.mnucontextline2.caption
msgctxt "tfrmmain.mnucontextline2.caption"
msgid "-"
msgstr "-"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr ""
#: tfrmmain.mnufiles.caption
#, fuzzy
#| msgid "Files"
msgid "&Files"
msgstr "&Súbory"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "&Pomoc"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Označiť"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Sieť"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Zobraziť"
#: tfrmmain.mnutaboptions.caption
#, fuzzy
#| msgid "&Options"
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "&Nastavenia"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Záložky"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Vystrihnúť"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Vymazať"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Upraviť"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Vložiť"
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmaincommandsdlg.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmmaincommandsdlg.btnok.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr ""
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr ""
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr ""
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr ""
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr ""
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr ""
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr ""
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Klávesa"
#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Prid&ať"
#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "&Pomoc"
#: tfrmmaskinputdlg.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmmaskinputdlg.btndefinetemplate.caption
#, fuzzy
#| msgid "Define..."
msgid "&Define..."
msgstr "&Definovať..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Rozlíšovať veľkosť písmen"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Vstupná maska:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
#, fuzzy
#| msgid "Or select predefined selection type:"
msgid "O&r select predefined selection type:"
msgstr "Alebo zvoľte preddefinovaný typ výbe&ru:"
#: tfrmmkdir.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Vytvoriť nový adresár"
#: tfrmmkdir.lblmakedir.caption
#, fuzzy
#| msgid "Input new directory name:"
msgid "&Input new directory name:"
msgstr "Zadajte nový názov adresára:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr "Nová veľkosť"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Výška"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Kvalita JPG kompresie"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Šírka"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Výška"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Šírka"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavrieť"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Vymazať"
#: tfrmmultirename.btnedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "&Upraviť"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "Nahrať (Ctrl+&L)"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "P&remenovať"
#: tfrmmultirename.btnrestore.caption
#, fuzzy
#| msgid "Reset all"
msgid "Reset &all"
msgstr "Obnoviť všetko"
#: tfrmmultirename.btnsavepreset.caption
#, fuzzy
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "Uložiť (Ctrl+&S)"
#: tfrmmultirename.caption
msgctxt "tfrmmultirename.caption"
msgid "MultiRename"
msgstr "Hromadné premenovanie"
#: tfrmmultirename.cblog.caption
#, fuzzy
#| msgid "Enable"
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "Log"
#: tfrmmultirename.cbregexp.caption
#, fuzzy
#| msgid "&Regular expressions"
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "&Regulárne výrazy"
#: tfrmmultirename.cbusesubs.caption
#, fuzzy
#| msgid "Use substitution"
msgid "&Use substitution"
msgstr "Po&užiť substitúciu"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
#, fuzzy
#| msgid "[E]xtension"
msgid "[E] Extension"
msgstr "[E] Prípona"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Počítadlo"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Vyhľadať && Nahradiť"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Log výsledku"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Maska"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Predvoľby"
#: tfrmmultirename.lbext.caption
#, fuzzy
#| msgid "Extension"
msgid "&Extension"
msgstr "Prípona"
#: tfrmmultirename.lbfind.caption
#, fuzzy
#| msgid "Find..."
msgid "&Find..."
msgstr "Hľadať..."
#: tfrmmultirename.lbinterval.caption
#, fuzzy
#| msgid "Interval"
msgid "&Interval"
msgstr "&Interval"
#: tfrmmultirename.lbname.caption
#, fuzzy
#| msgid "File Name"
msgid "File &Name"
msgstr "&Názov súboru"
#: tfrmmultirename.lbreplace.caption
#, fuzzy
#| msgid "Replace..."
msgid "Re&place..."
msgstr "Nahradiť..."
#: tfrmmultirename.lbstnb.caption
#, fuzzy
#| msgid "Start Number"
msgid "S&tart Number"
msgstr "Číslovať od"
#: tfrmmultirename.lbwidth.caption
#, fuzzy
#| msgid "Width"
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "Šírka"
#: tfrmmultirename.micounter.caption
#, fuzzy
#| msgid "[C]ounter"
msgid "[C] Counter"
msgstr "[C] Počítadlo"
#: tfrmmultirename.miday.caption
#, fuzzy
#| msgid "[D]ay"
msgid "[D] Day"
msgstr "[D] Deň"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Deň (2 číslice)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Deň týždňa (skrátene, t.j. \"pon\")"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDD] Deň týždňa (celý, t.j. \"pondelok\")"
#: tfrmmultirename.miextensionx.caption
#, fuzzy
#| msgid "[Ex]xtension"
msgid "[Ex] Character at position x"
msgstr "[Ex] Znak na pozícii x"
#: tfrmmultirename.miextensionxx.caption
#, fuzzy
#| msgid "[Ex:x]xtension"
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:x] Znaky od pozície x do y"
#: tfrmmultirename.mihour.caption
#, fuzzy
#| msgid "[h]our"
msgid "[h] Hour"
msgstr "[h] Hodina"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Hodina (2 číslice)"
#: tfrmmultirename.miminute.caption
#, fuzzy
#| msgid "Mi[n]ute"
msgid "[n] Minute"
msgstr "[n] Minúta"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minúta (2 číslice)"
#: tfrmmultirename.mimonth.caption
#, fuzzy
#| msgid "[M]onth"
msgid "[M] Month"
msgstr "[M] Mesiac"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Mesiac (2 číslice)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Meno mesiaca (krátko, t.j. \"jan\")"
#: tfrmmultirename.mimonth3.caption
#, fuzzy
#| msgid "[MMMM] Month name (long, e.g. \"january\")"
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Meno mesiaca (celé, t.j. \"január\")"
#: tfrmmultirename.miname.caption
#, fuzzy
#| msgid "[N]ame"
msgid "[N] Name"
msgstr "[N]Názov"
#: tfrmmultirename.minamex.caption
#, fuzzy
#| msgid "[Nx]ame"
msgid "[Nx] Character at position x"
msgstr "[Nx] Znak na pozícii x"
#: tfrmmultirename.minamexx.caption
#, fuzzy
#| msgid "[Nx:x]ame"
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Znaky od pozície x do y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Čas..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Prípona..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Názov..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Zásuvný modul"
#: tfrmmultirename.misecond.caption
#, fuzzy
#| msgid "[s]econd"
msgid "[s] Second"
msgstr "[s] Sekunda"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Sekundy (2 číslice)"
#: tfrmmultirename.miyear.caption
#, fuzzy
#| msgid "[Y] Year"
msgid "[Y] Year (2 digits)"
msgstr "[Y] Rok (2 číslice)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Rok (4 číslice)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr ""
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr ""
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
msgid "Old File Name"
msgstr "Staré meno súboru"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
msgid "New File Name"
msgstr "Nové meno súboru"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
msgid "File Path"
msgstr "Cesta k súboru"
#: tfrmmultirenamewait.caption
#, fuzzy
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Vyber aplikáciu"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Užívateľský príkaz"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Ulož asociácie"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Nastav vybranú aplikáciu ako štandartnú akciu"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Typ súboru na otvorenie: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Viacnásobné mená súboru"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr ""
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Jednoduché meno súboru"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr ""
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
#, fuzzy
#| msgid "Apply"
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
msgid "&Apply"
msgstr "&Použiť"
#: tfrmoptions.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Nastavenia"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Prosím, vyber jednu z podstránok, táto stránka neobsahuje nastavenia."
#: tfrmoptionsarchivers.btnautoconfig.caption
#, fuzzy
#| msgid "Auto Configure"
msgctxt "tfrmoptionsarchivers.btnautoconfig.caption"
msgid "A&uto Configure"
msgstr "A&utokonfigurovať"
#: tfrmoptionsarchivers.btnmultiarcadd.caption
#, fuzzy
#| msgid "Add"
msgctxt "tfrmoptionsarchivers.btnmultiarcadd.caption"
msgid "A&dd"
msgstr "Pridať"
#: tfrmoptionsarchivers.btnmultiarcapply.caption
#, fuzzy
#| msgid "Apply"
msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption"
msgid "A&pply"
msgstr "&Použiť"
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
#, fuzzy
#| msgid "Delete"
msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption"
msgid "D&elete"
msgstr "Vymazať"
#: tfrmoptionsarchivers.btnmultiarcrename.caption
#, fuzzy
#| msgid "Rename"
msgctxt "tfrmoptionsarchivers.btnmultiarcrename.caption"
msgid "&Rename"
msgstr "Premenovať"
#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
#, fuzzy
#| msgid "Debug mode"
msgctxt "tfrmoptionsarchivers.chkmultiarcdebug.caption"
msgid "De&bug mode"
msgstr "Režim ladenia"
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
#, fuzzy
#| msgid "Enabled"
msgctxt "tfrmoptionsarchivers.chkmultiarcenabled.caption"
msgid "E&nabled"
msgstr "Povolené"
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
#, fuzzy
#| msgid "Show console output"
msgctxt "tfrmoptionsarchivers.chkmultiarcoutput.caption"
msgid "S&how console output"
msgstr "Ukázať výstup konzoly"
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "tfrmoptionsarchivers.gbarchiveroptions.caption"
msgid "Options"
msgstr "Nastavenia"
#: tfrmoptionsarchivers.lblarchiveadd.caption
#, fuzzy
#| msgid "Add:"
msgctxt "tfrmoptionsarchivers.lblarchiveadd.caption"
msgid "Add&ing:"
msgstr "Pridať:"
#: tfrmoptionsarchivers.lblarchiveextension.caption
#, fuzzy
#| msgid "Extension:"
msgctxt "tfrmoptionsarchivers.lblarchiveextension.caption"
msgid "E&xtension:"
msgstr "Prípona:"
#: tfrmoptionsarchivers.lblarchiveextract.caption
#, fuzzy
#| msgid "Extract:"
msgctxt "tfrmoptionsarchivers.lblarchiveextract.caption"
msgid "Ex&tract:"
msgstr "Rozbaliť:"
#: tfrmoptionsarchivers.lblarchivelist.caption
#, fuzzy
#| msgid "List:"
msgctxt "tfrmoptionsarchivers.lblarchivelist.caption"
msgid "&List:"
msgstr "Zoznam:"
#: tfrmoptionsarchivers.lblarchivelistend.caption
#, fuzzy
#| msgid "Listing finish (optional):"
msgctxt "tfrmoptionsarchivers.lblarchivelistend.caption"
msgid "Listing &finish (optional):"
msgstr "Päta výpisu (nepovinné)"
#: tfrmoptionsarchivers.lblarchivelistformat.caption
#, fuzzy
#| msgid "Listing format:"
msgctxt "tfrmoptionsarchivers.lblarchivelistformat.caption"
msgid "Listing for&mat:"
msgstr "Formát výpisu"
#: tfrmoptionsarchivers.lblarchiveliststart.caption
#, fuzzy
#| msgid "Listing start (optional):"
msgctxt "tfrmoptionsarchivers.lblarchiveliststart.caption"
msgid "Listin&g start (optional):"
msgstr "Hlavička výpisu (nepovinné)"
#: tfrmoptionsarchivers.lblarchiver.caption
#, fuzzy
#| msgid "Archiver:"
msgctxt "tfrmoptionsarchivers.lblarchiver.caption"
msgid "Arc&hiver:"
msgstr "Archivátor:"
#: tfrmoptionsarchivers.lbldescription.caption
#, fuzzy
#| msgid "Description:"
msgctxt "tfrmoptionsarchivers.lbldescription.caption"
msgid "De&scription:"
msgstr "Popis:"
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "tfrmoptionsarchivers.tbarchiveradditional.caption"
msgid "Additional"
msgstr "Rozšírené"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr "Hlavné"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
#, fuzzy
#| msgid "Also when &size, date, or attributes change"
msgctxt "tfrmoptionsautorefresh.cbwatchattributeschange.caption"
msgid "When &size, date or attributes change"
msgstr "Tiež pri zmene &veľkosti, dátumu alebo atribútov"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "Pre nasledujúce cesty a podadresáre"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
#, fuzzy
#| msgid "When files are &created, deleted or renamed"
msgctxt "tfrmoptionsautorefresh.cbwatchfilenamechange.caption"
msgid "When &files are created, deleted or renamed"
msgstr "Aktualizovať zoznam pri vy&tvorení, zmazaní alebo premenovaní"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
#, fuzzy
#| msgid "Don't &react to updates while in the background"
msgctxt "tfrmoptionsautorefresh.cbwatchonlyforeground.caption"
msgid "When application is in the &background"
msgstr "Pokiaľ je aplikácia na pozadí"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgctxt "tfrmoptionsautorefresh.gbautorefreshdisable.caption"
msgid "Disable auto-refresh"
msgstr "Zakázať automatické obnovovanie"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgctxt "tfrmoptionsautorefresh.gbautorefreshenable.caption"
msgid "Refresh file list"
msgstr "Obnoviť zoznam súborov"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
#, fuzzy
#| msgid "Always show tray icon"
msgctxt "tfrmoptionsbehavior.cbalwaysshowtrayicon.caption"
msgid "Al&ways show tray icon"
msgstr "Vždy zobraziť ikonu v oznamovacej oblasti"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Automaticky skryť odpojené disky"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "tfrmoptionsbehavior.cbminimizetotray.caption"
msgid "Mo&ve icon to system tray when minimized"
msgstr "Minimalizovať do oznamovacej oblasti (System Tray)"
#: tfrmoptionsbehavior.cbonlyonce.caption
#, fuzzy
#| msgid "Allow only one copy of DC at a time"
msgctxt "tfrmoptionsbehavior.cbonlyonce.caption"
msgid "A&llow only one copy of DC at a time"
msgstr "Povoliť beh len jednej inštancie DC"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Tu môžeš zadať 1 alebo viac diskov alebo prípojných bodov oddelených \";\"."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Zoznam zakázaných diskov"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr ""
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr ""
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr ""
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr ""
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr ""
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
#, fuzzy
#| msgid "Cut text to column width"
msgctxt "tfrmoptionscolumnsview.cbcuttexttocolwidth.caption"
msgid "Cut &text to column width"
msgstr "Orezať text na šírku stĺpca"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
#, fuzzy
#| msgid "Horizontal lines"
msgctxt "tfrmoptionscolumnsview.cbgridhorzline.caption"
msgid "&Horizontal lines"
msgstr "Horizontálne čiary"
#: tfrmoptionscolumnsview.cbgridvertline.caption
#, fuzzy
#| msgid "Vertical lines"
msgctxt "tfrmoptionscolumnsview.cbgridvertline.caption"
msgid "&Vertical lines"
msgstr "&Vertikálne čiary"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
#, fuzzy
#| msgid "Auto fill columns"
msgctxt "tfrmoptionscolumnsview.chkautofillcolumns.caption"
msgid "A&uto fill columns"
msgstr "A&utomaticky vyplniť stĺpce"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Zobraz mriežku"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Automatická veľkosť stĺpcov"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
#, fuzzy
#| msgid "Auto size column:"
msgctxt "tfrmoptionscolumnsview.lblautosizecolumn.caption"
msgid "Auto si&ze column:"
msgstr "Automatická veľkosť stĺpca"
#: tfrmoptionsconfiguration.btnconfigapply.caption
#, fuzzy
#| msgid "Apply"
msgctxt "tfrmoptionsconfiguration.btnconfigapply.caption"
msgid "A&pply"
msgstr "&Použiť"
#: tfrmoptionsconfiguration.btnconfigedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "tfrmoptionsconfiguration.btnconfigedit.caption"
msgid "&Edit"
msgstr "Upraviť"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
#, fuzzy
#| msgid "Command line history"
msgctxt "tfrmoptionsconfiguration.cbcmdlinehistory.caption"
msgid "Co&mmand line history"
msgstr "Históriu príkazového riadku"
#: tfrmoptionsconfiguration.cbdirhistory.caption
#, fuzzy
#| msgid "Directory history"
msgctxt "tfrmoptionsconfiguration.cbdirhistory.caption"
msgid "&Directory history"
msgstr "Históriu adresárov"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
#, fuzzy
#| msgid "File mask history"
msgctxt "tfrmoptionsconfiguration.cbfilemaskhistory.caption"
msgid "&File mask history"
msgstr "Históriu použitých masiek"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
#, fuzzy
#| msgid "Save configuration"
msgctxt "tfrmoptionsconfiguration.chksaveconfiguration.caption"
msgid "Sa&ve configuration"
msgstr "Nastavenie"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
#, fuzzy
#| msgid "Search/Replace history"
msgctxt "tfrmoptionsconfiguration.chksearchreplacehistory.caption"
msgid "Searc&h/Replace history"
msgstr "Históriu hľadania/nahrádzania"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Adresáre"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgctxt "tfrmoptionsconfiguration.gblocconfigfiles.caption"
msgid "Location of configuration files"
msgstr "Umiestnenie konfiguračných súborov"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgctxt "tfrmoptionsconfiguration.gbsaveonexit.caption"
msgid "Save on exit"
msgstr "Uložiť pri ukončení"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgctxt "tfrmoptionsconfiguration.lblcmdlineconfigdir.caption"
msgid "Set on command line"
msgstr "Nastaviť v príkazovom riadku"
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
#, fuzzy
#| msgid "Program directory (portable version)"
msgctxt "tfrmoptionsconfiguration.rbprogramdir.caption"
msgid "P&rogram directory (portable version)"
msgstr "Adresár p&rogramu (\"portable\" verzia)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
#, fuzzy
#| msgid "User home directory"
msgctxt "tfrmoptionsconfiguration.rbuserhomedir.caption"
msgid "&User home directory"
msgstr "Domovský adresár užívateľa"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Všetko"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "&Vymazať"
#: tfrmoptionscustomcolumns.btnfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr ""
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Nový"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr ""
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr ""
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Premenovať"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Uložiť ako"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "Uložiť"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Povoliť Overcolor"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr ""
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "Hlavné"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Rámček kurzoru"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr ""
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr ""
#: tfrmoptionscustomcolumns.lblbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "Pozadie:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Pozadie 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
#, fuzzy
#| msgid "Con&figure columns for file system:"
msgctxt "tfrmoptionscustomcolumns.lblconfigcolumns.caption"
msgid "Con&figure columns view:"
msgstr "Kon&figurácia stĺpcov pre systém súborov:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr ""
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "Farba kurzoru:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Text kurzoru:"
#: tfrmoptionscustomcolumns.lblfontname.caption
#, fuzzy
#| msgid "Configure view nr:"
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Konfigurácia pohľadu č.:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Veľkosť:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "Farba písma:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "Farba označených:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr ""
#: tfrmoptionscustomcolumns.miaddcolumn.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Pridať stĺpec"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "&Pomoc"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgid "Some functions to select appropriate target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
msgid "Name, a-z"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr ""
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
msgid "Name:"
msgstr "Meno:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
msgid "Path:"
msgstr "Cesta:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgid "&Target:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to &configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr ""
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr ""
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Ukáž potvrdzovacie okno po drop-e"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr ""
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr ""
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Ukáž súborový systém"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Ukáž voľný pri&estor"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Ukáž značku"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Zoznam diskov"
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Pozadie"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
msgid "Bac&kground"
msgstr "Pozadie"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr ""
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
msgid "Save"
msgstr "Uložiť"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Atribúty prvku"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Pop&redie"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
msgid "Fo&reground"
msgstr "Pop&redie"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "&Textová značka"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Použi (a uprav) &globálnu schému nastavení"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Použi miestnu schému nastavení"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "Tučné"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
msgid "In&vert"
msgstr "In&vert"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
msgid "O&ff"
msgstr "Vypni"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
msgid "O&n"
msgstr "Zapni"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "Kurzíva"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
msgid "In&vert"
msgstr "In&vert"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
msgid "O&ff"
msgstr "Vypni"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
msgid "O&n"
msgstr "Zapni"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "&Strike Out"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
msgid "In&vert"
msgstr "Pre&vrátiť"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
msgid "O&ff"
msgstr "Vyp"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
msgid "O&n"
msgstr "Zap"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "Podčiarknuť"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "Pre&vrátiť"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "Vyp"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "Zap"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr ""
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr ""
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr ""
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr ""
#: tfrmoptionsfavoritetabs.btnrename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Premenovať"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr ""
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr ""
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Nie"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr ""
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr ""
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem1.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsfavoritetabs.micutselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Vystrihnúť"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr ""
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsfavoritetabs.mipasteselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Vložiť"
#: tfrmoptionsfavoritetabs.mirename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Premenovať"
#: tfrmoptionsfavoritetabs.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr ""
#: tfrmoptionsfileassoc.btnaddact.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Pridať"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "&Add"
msgstr "Prid&ať"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
#, fuzzy
#| msgid "Add"
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "Pridať"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr ""
#: tfrmoptionsfileassoc.btndownact.caption
#, fuzzy
#| msgid "Down"
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "&Down"
msgstr "Dole"
#: tfrmoptionsfileassoc.btneditext.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edit"
msgstr "Upraviť"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btnremoveact.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
msgid "Remo&ve"
msgstr "Odstrániť"
#: tfrmoptionsfileassoc.btnremoveext.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
msgid "Re&move"
msgstr "Odstrániť"
#: tfrmoptionsfileassoc.btnremovetype.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "Odst&rániť"
#: tfrmoptionsfileassoc.btnrenametype.caption
#, fuzzy
#| msgid "Rename"
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "Pr&emenovať"
#: tfrmoptionsfileassoc.btnupact.caption
#, fuzzy
#| msgid "Up"
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "Hore"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr ""
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr ""
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Akcie"
#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
msgid "Extensions"
msgstr "Prípony"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Typy súborov"
#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
msgid "Icon"
msgstr "Ikona"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lblaction.caption
#, fuzzy
#| msgid "Action:"
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
msgid "Action name:"
msgstr "Akcia:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "&Command:"
msgstr "&Príkaz:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parametre:"
#: tfrmoptionsfileassoc.lblstartpath.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Začiatok cesty:"
#: tfrmoptionsfileassoc.menuitem1.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr ""
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr ""
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Upraviť"
#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
msgid "Open in Editor"
msgstr "Otvoriť v editore"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr ""
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
msgid "Get output from command"
msgstr "Získať výstup príkazu"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr ""
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr ""
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Otvoriť"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr ""
#: tfrmoptionsfileassoc.miseparator.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgctxt "tfrmoptionsfileassoc.mishell.caption"
msgid "Run in terminal"
msgstr "Spustiť v terminále"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Zobraziť"
#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
msgid "Open in Viewer"
msgstr "Otvoriť v prezerači"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr ""
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr ""
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr ""
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr ""
#: tfrmoptionsfileoperations.bvlconfirmations.caption
#, fuzzy
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr "Ukázať okno potvrdenia pre:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Operácie kopírovania"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Operácie zmazania"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
#, fuzzy
#| msgid "Delete to recycle bin (Shift key reverses this setting)"
msgctxt "tfrmoptionsfileoperations.cbdeletetotrash.caption"
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "&F8/Del presúva do koša (Shift=zmazať ihneď)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Operácie vyhodenia do koša"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
#, fuzzy
#| msgid "Drop readonly flag"
msgctxt "tfrmoptionsfileoperations.cbdropreadonlyflag.caption"
msgid "D&rop readonly flag"
msgstr "Zahodiť znak len na čítanie"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "Operácie presunu"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
#, fuzzy
#| msgid "Process comments with files/folders"
msgctxt "tfrmoptionsfileoperations.cbprocesscomments.caption"
msgid "&Process comments with files/folders"
msgstr "Spracovať komentáre s adresármi/súbormi"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Vybrať meno súboru bez prípony, pri premenovaní"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
#, fuzzy
#| msgid "Show tab select panel in copy/move dialog"
msgctxt "tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption"
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Zobraziť výber záložky v dialógu \"kopírovať/presunúť\""
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
#, fuzzy
#| msgid "Skip file operations errors and write them to log window"
msgctxt "tfrmoptionsfileoperations.cbskipfileoperror.caption"
msgid "S&kip file operations errors and write them to log window"
msgstr "Preskočiť chyby súborových operácií a len ich zapísať do okna logov"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Vykonávanie operácií"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Užívateľský interfejs"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "Veľkosť zásobníka pre súborové operácie (v KB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Ukázať postup operácií &inicializovaný v"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr ""
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "Počet prechodov bezpečného vymazania:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "tfrmoptionsfilepanelscolors.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnindbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnindcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr ""
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Povoliť Overcolor"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
#, fuzzy
#| msgid "Use Frame Cursor"
msgctxt "tfrmoptionsfilepanelscolors.cbbuseframecursor.caption"
msgid "Use &Frame Cursor"
msgstr "Použiť rámčekový kurzor"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Použiť Indikátor &Gradientu"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
#, fuzzy
#| msgid "Use Inverted Selection"
msgctxt "tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption"
msgid "U&se Inverted Selection"
msgstr "Použiť inverzný výber"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Rámček kurzoru"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr "Indikátor Voľného Miesta na Disku"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "Pozadie"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
#, fuzzy
#| msgid "Background 2:"
msgctxt "tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption"
msgid "Backg&round 2:"
msgstr "Pozadie 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
#, fuzzy
#| msgid "Cursor Color:"
msgctxt "tfrmoptionsfilepanelscolors.lblcursorcolor.caption"
msgid "C&ursor Color:"
msgstr "Farba kurzoru:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
#, fuzzy
#| msgid "Cursor Text:"
msgctxt "tfrmoptionsfilepanelscolors.lblcursortext.caption"
msgid "Cursor Te&xt:"
msgstr "Text kurzoru:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
#, fuzzy
#| msgid "Brightness level of inactive panel"
msgctxt "tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption"
msgid "&Brightness level of inactive panel"
msgstr "Úroveň jasu neaktívneho panela"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "&Indikátor Zadnej Farby:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "&Indikátor Prednej Farby:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
#, fuzzy
#| msgid "Mark Color:"
msgctxt "tfrmoptionsfilepanelscolors.lblmarkcolor.caption"
msgid "&Mark Color:"
msgstr "Farba označenia:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
#, fuzzy
#| msgid "Text Color:"
msgctxt "tfrmoptionsfilepanelscolors.lbltextcolor.caption"
msgid "T&ext Color:"
msgstr "Farba písma:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "Hľadať časť mena súboru"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr ""
#: tfrmoptionsfilesearch.gbfilesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Hľadanie súborov"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr ""
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Použíť mapovanie pamäte pre hľadanie textu v súboroch"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "Po&užiť stream pre hľadanie textu v súboroch"
#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "Prid&ať"
#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "&Pomoc"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "Nenačítať zoznam súborov pokiaľ záložka je aktivovaná"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
#, fuzzy
#| msgid "Show square brackets around directories"
msgctxt "tfrmoptionsfilesviews.cbdirbrackets.caption"
msgid "S&how square brackets around directories"
msgstr "Názvy zložiek v hranatých zátvorkách"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Zvýraznenie nových a aktualizovaných súborov"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr ""
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
#, fuzzy
#| msgid "Load file list in separate thread"
msgctxt "tfrmoptionsfilesviews.cblistfilesinthread.caption"
msgid "Load &file list in separate thread"
msgstr "Nahrať zoznam súborov v samostatnom vlákne"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
#, fuzzy
#| msgid "Load icons after file list"
msgctxt "tfrmoptionsfilesviews.cbloadiconsseparately.caption"
msgid "Load icons af&ter file list"
msgstr "Nahrať ikony po zozname súborov"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
#, fuzzy
#| msgid "Show system and hidden files"
msgctxt "tfrmoptionsfilesviews.cbshowsystemfiles.caption"
msgid "Show s&ystem and hidden files"
msgstr "Zobraziť skryté/systémové súbory"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
#, fuzzy
#| msgid "When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgctxt "tfrmoptionsfilesviews.cbspacemovesdown.caption"
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Pri výbere medzerníkom posunúť kurzor dolu, ako pri výbere klávesou Insert"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independant attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formátovanie"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgctxt "tfrmoptionsfilesviews.gbsorting.caption"
msgid "Sorting"
msgstr "Triedenie"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Rozlíšovanie veľkosti písmen:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Nesprávny formát"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
#, fuzzy
#| msgid "Date and time format:"
msgctxt "tfrmoptionsfilesviews.lbldatetimeformat.caption"
msgid "&Date and time format:"
msgstr "Formát dátumu a času:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Formát veľkosti súboru:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "Vlož&iť nové súbory:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Triedenie adresárov:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
#, fuzzy
#| msgid "Sort &method:"
msgctxt "tfrmoptionsfilesviews.lblsortmethod.caption"
msgid "&Sort method:"
msgstr "Metóda triedenia:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "Presunúť aktualizované súbory:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
#, fuzzy
#| msgid "Add"
msgctxt "tfrmoptionsfiletypescolors.btnaddcategory.caption"
msgid "A&dd"
msgstr "Pridať"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
#, fuzzy
#| msgid "Apply"
msgctxt "tfrmoptionsfiletypescolors.btnapplycategory.caption"
msgid "A&pply"
msgstr "&Použiť"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "tfrmoptionsfiletypescolors.btncategorycolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
#, fuzzy
#| msgid "Delete"
msgctxt "tfrmoptionsfiletypescolors.btndeletecategory.caption"
msgid "D&elete"
msgstr "Vymazať"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
msgid "Template..."
msgstr "Šablóny..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Farby typu súborov (trieď podľa drag&&drop)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
#, fuzzy
#| msgid "Category attributes:"
msgctxt "tfrmoptionsfiletypescolors.lblcategoryattr.caption"
msgid "Category a&ttributes:"
msgstr "Atribúty kategórií:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
#, fuzzy
#| msgid "Category color:"
msgctxt "tfrmoptionsfiletypescolors.lblcategorycolor.caption"
msgid "Category co&lor:"
msgstr "Farba kategórie:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
#, fuzzy
#| msgid "Category mask:"
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
msgid "Category &mask:"
msgstr "Maska kategórie:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
#, fuzzy
#| msgid "Category name:"
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr "Názov kategórie:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "tfrmoptionsfonts.btnseleditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "tfrmoptionsfonts.btnsellogfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "tfrmoptionsfonts.btnselmainfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "tfrmoptionsfonts.btnselviewerbookfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "tfrmoptionsfonts.btnselviewfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr ""
#: tfrmoptionsfonts.lbleditorfont.caption
#, fuzzy
#| msgid "Editor font"
msgctxt "tfrmoptionsfonts.lbleditorfont.caption"
msgid "&Editor font"
msgstr "Písmo editora"
#: tfrmoptionsfonts.lbllogfont.caption
#, fuzzy
#| msgid "Log font"
msgctxt "tfrmoptionsfonts.lbllogfont.caption"
msgid "&Log font"
msgstr "Písmo logu"
#: tfrmoptionsfonts.lblmainfont.caption
#, fuzzy
#| msgid "Main font"
msgctxt "tfrmoptionsfonts.lblmainfont.caption"
msgid "Main &font"
msgstr "Hlavné písmo"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr ""
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr ""
#: tfrmoptionsfonts.lblviewerbookfont.caption
#, fuzzy
#| msgid "Viewer Book Font"
msgctxt "tfrmoptionsfonts.lblviewerbookfont.caption"
msgid "Viewer&Book Font"
msgstr "Písmo prezerača kníh"
#: tfrmoptionsfonts.lblviewerfont.caption
#, fuzzy
#| msgid "Viewer font"
msgctxt "tfrmoptionsfonts.lblviewerfont.caption"
msgid "&Viewer font"
msgstr "Písmo prezerača"
#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Pridaj horúcu klávesu"
#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Vymazať"
#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "Vymaž horúcu klávesu"
#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "Zm&eň horúcu klávesu"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Premenovať"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
#, fuzzy
#| msgid "Filter"
msgctxt "tfrmoptionshotkeys.lbfilter.caption"
msgid "&Filter"
msgstr "&Filter"
#: tfrmoptionshotkeys.lblcategories.caption
#, fuzzy
#| msgid "Categories:"
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
msgid "C&ategories:"
msgstr "K&ategórie:"
#: tfrmoptionshotkeys.lblcommands.caption
#, fuzzy
#| msgid "Commands:"
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
msgid "Co&mmands:"
msgstr "Príkazy:"
#: tfrmoptionshotkeys.lblscfiles.caption
#, fuzzy
#| msgid "Shortcut files:"
msgctxt "tfrmoptionshotkeys.lblscfiles.caption"
msgid "&Shortcut files:"
msgstr "&Súbory zástupcov:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Príkaz"
#: tfrmoptionshotkeys.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "&Pre nasledujúce cesty a podadresáre"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Ukáž ikony akcií v &menu"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
#, fuzzy
#| msgid "Show overlay i&cons, e.g. for links"
msgctxt "tfrmoptionsicons.cbiconsshowoverlay.caption"
msgid "Show o&verlay icons, e.g. for links"
msgstr "Zobraziť prekladané i&kony (pre zástupcov)"
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Zakáž špeciálne ikony"
#: tfrmoptionsicons.gbiconssize.caption
#, fuzzy
#| msgid " Icon &size "
msgctxt "tfrmoptionsicons.gbiconssize.caption"
msgid " Icon size "
msgstr "Veľkosť i&kon"
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "tfrmoptionsicons.gbshowiconsmode.caption"
msgid " Show icons to the left of the filename "
msgstr "Zobraziť ikony vľavo od názvu súboru"
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
#, fuzzy
#| msgid "&All"
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
msgid "A&ll"
msgstr "&Všetko"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "tfrmoptionsicons.rbiconsshowallandexe.caption"
msgid "All associated + &EXE/LNK (slow)"
msgstr "Všetky asociácie + &EXE/LNK (pomaly)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "tfrmoptionsicons.rbiconsshownone.caption"
msgid "&No icons"
msgstr "Bez &ikon"
#: tfrmoptionsicons.rbiconsshowstandard.caption
#, fuzzy
#| msgid "&Only standard icons"
msgctxt "tfrmoptionsicons.rbiconsshowstandard.caption"
msgid "Only &standard icons"
msgstr "L&en štandartné ikony"
#: tfrmoptionsignorelist.btnaddsel.caption
#, fuzzy
#| msgid "&Add selected names"
msgctxt "tfrmoptionsignorelist.btnaddsel.caption"
msgid "A&dd selected names"
msgstr "Prid&ať vybrané mená"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "tfrmoptionsignorelist.btnaddselwithpath.caption"
msgid "Add selected names with &full path"
msgstr "Pridať vybrané mená s celou cestou"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "tfrmoptionsignorelist.chkignoreenable.caption"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignorovať (nezobrazovať) nasledujúce súbory a adresáre:"
#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "tfrmoptionsignorelist.lblsavein.caption"
msgid "&Save in:"
msgstr "Uložiť do:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Ľavá, pravá šípka zmení adresár (pohyby ako v Lynx-e)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Písanie"
#: tfrmoptionskeyboard.lblalt.caption
#, fuzzy
#| msgid "Alt+L&etters"
msgctxt "tfrmoptionskeyboard.lblalt.caption"
msgid "Alt+L&etters:"
msgstr "Al&t+Písmená:"
#: tfrmoptionskeyboard.lblctrlalt.caption
#, fuzzy
#| msgid "Ctrl+Alt+Le&tters"
msgctxt "tfrmoptionskeyboard.lblctrlalt.caption"
msgid "Ctrl+Alt+Le&tters:"
msgstr "&Ctrl+Alt+Písmená:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "Písmená:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
#, fuzzy
#| msgid "Flat buttons"
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr "Ploché tlačítka"
#: tfrmoptionslayout.cbflatinterface.caption
#, fuzzy
#| msgid "Flat interface"
msgctxt "tfrmoptionslayout.cbflatinterface.caption"
msgid "Flat i&nterface"
msgstr "Ploché rozhranie"
#: tfrmoptionslayout.cbflattoolbar.caption
#, fuzzy
#| msgid "Flat buttons"
msgctxt "tfrmoptionslayout.cbflattoolbar.caption"
msgid "Flat b&uttons"
msgstr "Ploché tlačítka"
#: tfrmoptionslayout.cbfreespaceind.caption
#, fuzzy
#| msgid "Show free space indicator on drive label"
msgctxt "tfrmoptionslayout.cbfreespaceind.caption"
msgid "Show fr&ee space indicator on drive label"
msgstr "Zobraziť indikátor voľného miesta na disku"
#: tfrmoptionslayout.cblogwindow.caption
#, fuzzy
#| msgid "Show log window"
msgctxt "tfrmoptionslayout.cblogwindow.caption"
msgid "Show lo&g window"
msgstr "Zobraz okno logu"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "tfrmoptionslayout.cbpanelofoperations.caption"
msgid "Show panel of operation in background"
msgstr "Zobraziť panel operácií na pozadí"
#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "tfrmoptionslayout.cbproginmenubar.caption"
msgid "Show common progress in menu bar"
msgstr "Zobraziť celkový postup v lište menu"
#: tfrmoptionslayout.cbshowcmdline.caption
#, fuzzy
#| msgid "Show command &line"
msgctxt "tfrmoptionslayout.cbshowcmdline.caption"
msgid "Show command l&ine"
msgstr "Zobraziť príkazový ria&dok"
#: tfrmoptionslayout.cbshowcurdir.caption
#, fuzzy
#| msgid "Show &current directory"
msgctxt "tfrmoptionslayout.cbshowcurdir.caption"
msgid "Show current director&y"
msgstr "Zobraziť aktuáln&y adresár"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "tfrmoptionslayout.cbshowdiskpanel.caption"
msgid "Show &drive buttons"
msgstr "Zobraziť &tlačítka diskov"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
#, fuzzy
#| msgid "Show free space label"
msgctxt "tfrmoptionslayout.cbshowdrivefreespace.caption"
msgid "Show free s&pace label"
msgstr "V hlavičke panela zobraziť údaj o voľnom mieste"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Ukáž &tlačidlo zoznamu diskov"
#: tfrmoptionslayout.cbshowkeyspanel.caption
#, fuzzy
#| msgid "Show &function key buttons"
msgctxt "tfrmoptionslayout.cbshowkeyspanel.caption"
msgid "Show function &key buttons"
msgstr "Zobraziť &funkčné tlačidlá"
#: tfrmoptionslayout.cbshowmainmenu.caption
#, fuzzy
#| msgid "Show main menu"
msgctxt "tfrmoptionslayout.cbshowmainmenu.caption"
msgid "Show &main menu"
msgstr "Zobraziť hlavné menu"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
#, fuzzy
#| msgid "Show &button bar"
msgctxt "tfrmoptionslayout.cbshowmaintoolbar.caption"
msgid "Show tool&bar"
msgstr "Zobraziť &tlačídlovú lištu"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Ukáž skrátený štítok voľného priestoru"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "tfrmoptionslayout.cbshowstatusbar.caption"
msgid "Show &status bar"
msgstr "Zobraziť &stavový riadok"
#: tfrmoptionslayout.cbshowtabheader.caption
#, fuzzy
#| msgid "Show &tabstop header"
msgctxt "tfrmoptionslayout.cbshowtabheader.caption"
msgid "S&how tabstop header"
msgstr "Zobraziť &tabstop hlavičku"
#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "tfrmoptionslayout.cbshowtabs.caption"
msgid "Sho&w folder tabs"
msgstr "Zobraziť &záložky"
#: tfrmoptionslayout.cbtermwindow.caption
#, fuzzy
#| msgid "Show terminal window"
msgctxt "tfrmoptionslayout.cbtermwindow.caption"
msgid "Show te&rminal window"
msgstr "Zobraziť okno terminálu"
#: tfrmoptionslayout.cbtwodiskpanels.caption
#, fuzzy
#| msgid "Show two drive button bars (fixed width, above file windows)"
msgctxt "tfrmoptionslayout.cbtwodiskpanels.caption"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Zobraziť 2 zoznamy diskov (pevná šírka, nad oknami so súbormi)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgctxt "tfrmoptionslayout.gbscreenlayout.caption"
msgid " Screen layout "
msgstr "Vzhľad obrazovky"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr ""
#: tfrmoptionslog.cblogarcop.caption
#, fuzzy
#| msgid "Pack/Unpack"
msgctxt "tfrmoptionslog.cblogarcop.caption"
msgid "&Pack/Unpack"
msgstr "Zbaliť/Rozbaliť"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr ""
#: tfrmoptionslog.cblogcpmvln.caption
#, fuzzy
#| msgid "Copy/Move/Create link/symlink"
msgctxt "tfrmoptionslog.cblogcpmvln.caption"
msgid "Cop&y/Move/Create link/symlink"
msgstr "Kopírovanie/Presun/Vytvorenie linku/symlinku"
#: tfrmoptionslog.cblogdelete.caption
#, fuzzy
#| msgid "Delete"
msgctxt "tfrmoptionslog.cblogdelete.caption"
msgid "&Delete"
msgstr "Vymazať"
#: tfrmoptionslog.cblogdirop.caption
#, fuzzy
#| msgid "Create/Delete directories"
msgctxt "tfrmoptionslog.cblogdirop.caption"
msgid "Crea&te/Delete directories"
msgstr "Tvorba/Mazanie zložiek"
#: tfrmoptionslog.cblogerrors.caption
msgctxt "tfrmoptionslog.cblogerrors.caption"
msgid "Log &errors"
msgstr "Spis &chýb"
#: tfrmoptionslog.cblogfile.caption
#, fuzzy
#| msgid "&Create a log file:"
msgctxt "tfrmoptionslog.cblogfile.caption"
msgid "C&reate a log file:"
msgstr "&Vytvoriť súbor spisu:"
#: tfrmoptionslog.cbloginfo.caption
#, fuzzy
#| msgid "Log information messages"
msgctxt "tfrmoptionslog.cbloginfo.caption"
msgid "Log &information messages"
msgstr "Spis informačných správ"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr ""
#: tfrmoptionslog.cblogsuccess.caption
msgctxt "tfrmoptionslog.cblogsuccess.caption"
msgid "Log &successful operations"
msgstr "Spis &dokončených operácií"
#: tfrmoptionslog.cblogvfs.caption
#, fuzzy
#| msgid "File system plugins"
msgctxt "tfrmoptionslog.cblogvfs.caption"
msgid "&File system plugins"
msgstr "Zásuvné moduly súborového systému"
#: tfrmoptionslog.gblogfile.caption
msgctxt "tfrmoptionslog.gblogfile.caption"
msgid "File operation log file"
msgstr "Spis súborových operácií"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Spis operácií"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Stav operácie"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "Odober náhľady pre už neexistujúce súbory"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
msgid "Create new with the encoding:"
msgstr ""
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Vždy choď na root disku, keď je zmena diskov"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
#, fuzzy
#| msgid "Show warning messages (\"OK\" button only)"
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Zobraziť varovné správy (len tlačítko \"OK\")"
#: tfrmoptionsmisc.chkthumbsave.caption
#, fuzzy
#| msgid "Save thumbnails in cache"
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
msgid "&Save thumbnails in cache"
msgstr "Uložiť náhľady do cache"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
msgid "Thumbnails"
msgstr "Náhľady"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr ""
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr ""
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
msgid "Default encoding:"
msgstr ""
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr ""
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr ""
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr ""
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "pixely"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "Veľkosť náhľadu:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
#, fuzzy
#| msgid "Selection by mouse"
msgctxt "tfrmoptionsmouse.cbselectionbymouse.caption"
msgid "&Selection by mouse"
msgstr "Výber myšou"
#: tfrmoptionsmouse.gbscrolling.caption
msgctxt "tfrmoptionsmouse.gbscrolling.caption"
msgid "Scrolling"
msgstr "Skrolovanie"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Výber"
#: tfrmoptionsmouse.lblmousemode.caption
#, fuzzy
#| msgid "Mode:"
msgctxt "tfrmoptionsmouse.lblmousemode.caption"
msgid "&Mode:"
msgstr "Mód:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
#, fuzzy
#| msgid "Line by line"
msgctxt "tfrmoptionsmouse.rbscrolllinebyline.caption"
msgid "&Line by line"
msgstr "Riadok po riadku"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
#, fuzzy
#| msgid "Line by line with cursor movement"
msgctxt "tfrmoptionsmouse.rbscrolllinebylinecursor.caption"
msgid "Line by line &with cursor movement"
msgstr "Riadok po riadku s posunom kurzoru"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
#, fuzzy
#| msgid "Page by page"
msgctxt "tfrmoptionsmouse.rbscrollpagebypage.caption"
msgid "&Page by page"
msgstr "Stránka po stránke"
#: tfrmoptionsplugins.btnaddplugin.caption
#, fuzzy
#| msgid "Add"
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "Pridať"
#: tfrmoptionsplugins.btnconfigplugin.caption
#, fuzzy
#| msgid "Configure"
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "Konfigurovať"
#: tfrmoptionsplugins.btnenableplugin.caption
#, fuzzy
#| msgid "Enable"
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
msgid "E&nable"
msgstr "Povoliť"
#: tfrmoptionsplugins.btnremoveplugin.caption
#, fuzzy
#| msgid "Remove"
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "Odstrániť"
#: tfrmoptionsplugins.btntweakplugin.caption
#, fuzzy
#| msgid "Tweak"
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
msgid "&Tweak"
msgstr "Ladenie"
#: tfrmoptionsplugins.lbldsxdescription.caption
#, fuzzy
#| msgid "Search plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Vyhľadávacie zásuvné moduly umožňujú použitie pri hľadaní alternatívnych vyhľadávacích algoritmov alebo externých nástrojov (napr. \"nájsť \", atď.)."
#: tfrmoptionsplugins.lblwcxdescription.caption
#, fuzzy
#| msgid "Packer plugins are used to work with archives."
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
msgid "Pack&er plugins are used to work with archives"
msgstr "Komprimačné zásuvné moduly pre prácu s archívmi."
#: tfrmoptionsplugins.lblwdxdescription.caption
#, fuzzy
#| msgid "Content plugins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Obsahové zásuvné moduly umožňujú zobraziť rozšírené informácie ako sú MP3 tagy alebo atribúty obrázkov v zozname súborov, alebo ich používať na vyhľadávanie a \"multi-premenovanie\"."
#: tfrmoptionsplugins.lblwfxdescription.caption
#, fuzzy
#| msgid "File system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Zásuvné moduly súborových systémov umožnia prístup k bežne nedostupným médiám ako sú napr. externé zariadenia (Palm/PocketPC)."
#: tfrmoptionsplugins.lblwlxdescription.caption
#, fuzzy
#| msgid "Viewer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Zobrazovacie zásuvné moduly umožňujú prezeranie súborov ako sú napr. obrázky, databázy a pod. v prezerači (F3, alebo Ctrl+Q)."
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Aktívne"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Zásuvný modul"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Registrované pre"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Názov súboru"
#: tfrmoptionsplugins.tsdsx.caption
#, fuzzy
#| msgid "Search plugins (.DSX)"
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
msgid "&Search plugins (.DSX)"
msgstr "Vyhľadávacie zásuvné moduly (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
#, fuzzy
#| msgid "Packer plugins (.WCX)"
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
msgid "Pac&ker plugins (.WCX)"
msgstr "Komprimačné zásuvné moduly (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
#, fuzzy
#| msgid "Content plugins (.WDX)"
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
msgid "Content pl&ugins (.WDX)"
msgstr "Zásuvné moduly obsahu (.WDX)"
#: tfrmoptionsplugins.tswfx.caption
#, fuzzy
#| msgid "File system plugins (.WFX)"
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
msgid "F&ile system plugins (.WFX)"
msgstr "Zásuvné moduly súborových systémov (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
#, fuzzy
#| msgid "Viewer plugins (.WLX)"
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
msgid "&Viewer plugins (.WLX)"
msgstr "Zobrazovacie zásuvné moduly (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "tfrmoptionsquicksearchfilter.cbexactbeginning.caption"
msgid "&Beginning (name must start with first typed character)"
msgstr "&Začiatok (meno musí začínať zadaným znakom)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "tfrmoptionsquicksearchfilter.cbexactending.caption"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "&Koniec (posledný znak pred . musí zodpovedať zadanému)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "tfrmoptionsquicksearchfilter.cgpoptions.caption"
msgid "Options"
msgstr "Nastavenia"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Presné meno súhlasí"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Hľadaj písmeno"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Vyhľadať tieto položky"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr ""
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "tfrmoptionstabs.cbtabsactivateonclick.caption"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Aktivovať cieľový &panel pri kliknutí na jeho ľubovolnú záložku"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "tfrmoptionstabs.cbtabsalwaysvisible.caption"
msgid "&Show tab header also when there is only one tab"
msgstr "&Zobraziť záložku, aj keď existuje len jedna"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr ""
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
#, fuzzy
#| msgid "&Confirm close all tabs"
msgctxt "tfrmoptionstabs.cbtabsconfirmcloseall.caption"
msgid "Con&firm close all tabs"
msgstr "&Potvrdiť uzatvorenie všetkých záložiek"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr ""
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr "Obmedzená dĺžka názvu záložky na"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "tfrmoptionstabs.cbtabslockedasterisk.caption"
msgid "Show locked tabs &with an asterisk *"
msgstr "Zobraziť uzamknuté záložky so znakom *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "tfrmoptionstabs.cbtabsmultilines.caption"
msgid "&Tabs on multiple lines"
msgstr "&Záložky na viac riadkov"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "tfrmoptionstabs.cbtabsopenforeground.caption"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&Hore otvorí novú záložku na pozadí"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "tfrmoptionstabs.cbtabsopennearcurrent.caption"
msgid "Open &new tabs near current tab"
msgstr "Otvárať &nové záložky vedľa aktuálnej záložky"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr ""
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
#, fuzzy
#| msgid "Show tab close button"
msgctxt "tfrmoptionstabs.cbtabsshowclosebutton.caption"
msgid "Show ta&b close button"
msgstr "Na záložkách aj tlačítko zavrieť"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr ""
#: tfrmoptionstabs.gbtabs.caption
msgctxt "tfrmoptionstabs.gbtabs.caption"
msgid "Folder tabs headers"
msgstr "Hlavičky záložiek"
#: tfrmoptionstabs.lblchar.caption
msgctxt "tfrmoptionstabs.lblchar.caption"
msgid "characters"
msgstr "znakov"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr ""
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr "Umiestnenie záložky"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
#, fuzzy
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Nie"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr ""
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr ""
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr ""
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr ""
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr ""
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Príkaz:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Parametre:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Príkaz:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Parametre:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Príkaz:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Parametre:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "Klonovať tlačidlo"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
msgid "&Delete"
msgstr "&Vymazať"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgctxt "tfrmoptionstoolbar.btnedithotkey.caption"
msgid "Edit hot&key"
msgstr "Zmeň horúcu klávesu"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgctxt "tfrmoptionstoolbar.btninsertbutton.caption"
msgid "&Insert new button"
msgstr "Vložte nové tlačítko"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr ""
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Iné ..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr "V&ymaž horúcu klávesu"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr ""
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
#: tfrmoptionstoolbar.cbflatbuttons.caption
#, fuzzy
#| msgid "Flat b&uttons"
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "Ploché tlačítka"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr ""
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Zadaj parametre príkazu, každý v samostatnom riadku. Stlač F1 na pozretie pomoci k parametrom"
#: tfrmoptionstoolbar.gbgroupbox.caption
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
msgid "Appearance"
msgstr "Vzhľad"
#: tfrmoptionstoolbar.lblbarsize.caption
#, fuzzy
#| msgid "Ba&r size:"
msgctxt "tfrmoptionstoolbar.lblbarsize.caption"
msgid "&Bar size:"
msgstr "Veľkosť lišty:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblexternalcommand.caption"
msgid "Comman&d:"
msgstr "Príkaz:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parametre:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr ""
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Horúca klávesa:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Ikona:"
#: tfrmoptionstoolbar.lbliconsize.caption
#, fuzzy
#| msgid "Ic&on size:"
msgctxt "tfrmoptionstoolbar.lbliconsize.caption"
msgid "Icon si&ze:"
msgstr "Veľkosť ikony:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "Príkaz:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "&Parametre:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Začiatok cesty:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "Pomôcka:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr ""
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr ""
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr ""
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr ""
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr ""
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr ""
#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr ""
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr ""
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr ""
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr ""
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr ""
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Typ tlačidla"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
#, fuzzy
#| msgid "Keep terminal window open after executing program"
msgctxt "tfrmoptionstoolbase.cbtoolskeepterminalopen.caption"
msgid "&Keep terminal window open after executing program"
msgstr "Ponechať o&kno terminálu otvorené aj po skončení programu"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
#, fuzzy
#| msgid "Execute in terminal"
msgctxt "tfrmoptionstoolbase.cbtoolsruninterminal.caption"
msgid "&Execute in terminal"
msgstr "Spustiť v t&erminály"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
#, fuzzy
#| msgid "Use external program"
msgctxt "tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption"
msgid "&Use external program"
msgstr "Po&užiť externý program"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
#, fuzzy
#| msgid "Additional parameters"
msgctxt "tfrmoptionstoolbase.lbltoolsparameters.caption"
msgid "A&dditional parameters"
msgstr "Ďalšie parametre"
#: tfrmoptionstoolbase.lbltoolspath.caption
#, fuzzy
#| msgid "Path to program to execute"
msgctxt "tfrmoptionstoolbase.lbltoolspath.caption"
msgid "&Path to program to execute"
msgstr "Cesta k externému &programu"
#: tfrmoptionstooltips.btnaddfields.caption
#, fuzzy
#| msgid "Add"
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "Pri&dať"
#: tfrmoptionstooltips.btnapplyfields.caption
#, fuzzy
#| msgid "Apply"
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "&Použiť"
#: tfrmoptionstooltips.btndeletefields.caption
#, fuzzy
#| msgid "Delete"
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "Vymazať"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Šablóny..."
#: tfrmoptionstooltips.chkshowtooltip.caption
#, fuzzy
#| msgid "Show tool tip"
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
msgid "&Show tooltip for files in the file panel"
msgstr "Zobraziť bublinovú pomoc"
#: tfrmoptionstooltips.gbcustomfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
msgid "Custom fields by file type"
msgstr "Užívateľské polia podľa typu súboru"
#: tfrmoptionstooltips.lblfieldslist.caption
#, fuzzy
#| msgid "Category hint:"
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Pomoc pre kategóriu:"
#: tfrmoptionstooltips.lblfieldsmask.caption
#, fuzzy
#| msgid "Category mask:"
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Maska kategórie:"
#: tfrmoptionstooltips.lblfieldsname.caption
#, fuzzy
#| msgid "Category name:"
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "Názov kategórie:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Farba kurzoru:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "tfrmoptionsviewer.btnbackviewercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "tfrmoptionsviewer.btnfontviewercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgctxt "tfrmoptionsviewer.gbviewerbookmode.caption"
msgid "Viewer Book Mode"
msgstr "Mód prezerania knihy"
#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "tfrmoptionsviewer.gbviewerexample.caption"
msgid "Example"
msgstr "Vzorka"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
#, fuzzy
#| msgid "Background color in book viewer"
msgctxt "tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption"
msgid "&Background color in book viewer"
msgstr "Far&ba pozadia v prezerači kníh"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
#, fuzzy
#| msgid "Font color in book viewer"
msgctxt "tfrmoptionsviewer.lblfontcolorviewerbook.caption"
msgid "&Font color in book viewer"
msgstr "&Farba písma v prezerači kníh"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
#, fuzzy
#| msgid "Number of columns in book viewer"
msgctxt "tfrmoptionsviewer.lblnumbercolumnsviewer.caption"
msgid "&Number of columns in book viewer"
msgstr "Počet stĺpcov v prezerači k&níh"
#: tfrmpackdlg.btnconfig.caption
#, fuzzy
#| msgid "&Configure"
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "&Konfigurovať"
#: tfrmpackdlg.caption
msgctxt "tfrmpackdlg.caption"
msgid "Pack files"
msgstr "Komprimovať súbory"
#: tfrmpackdlg.cbcreateseparatearchives.caption
#, fuzzy
#| msgid "Create separate archives, o&ne per selected file/dir"
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Vytvoriť samostat&né archívne súbory pre každý vybratý súbor/adresár"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Sa&morozbaľovací archív"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "&Zakódovať"
#: tfrmpackdlg.cbmovetoarchive.caption
#, fuzzy
#| msgid "M&ove to archive"
msgid "Mo&ve to archive"
msgstr "Pre&sunúť do archívu"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Viaczväzkový archív"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
#, fuzzy
#| msgid "Put in the TAR archive first"
msgid "P&ut in the TAR archive first"
msgstr "Najskôr vytvoriť archív TAR"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Kom&primovať s cestou (only recursed)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Komprimovať súbor(y) do súboru:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Komprimátor"
#: tfrmpackinfodlg.btnclose.caption
#, fuzzy
#| msgid "Close"
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Zavrieť"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Rozbaliť &Všetko a spustiť"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "&Rozbaliť a spustiť"
#: tfrmpackinfodlg.caption
msgctxt "tfrmpackinfodlg.caption"
msgid "Properties of packed file"
msgstr "Vlastnosti komprimovaného súboru"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Atribúty:"
#: tfrmpackinfodlg.lblcompressionratio.caption
#, fuzzy
msgid "Compression ratio:"
msgstr "Kompresný pomer:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Dátum:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Metóda:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Pôvodná veľkosť:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Súbor:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Skomprimovaná veľkosť:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Komprimátor:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Čas:"
#: tfrmquicksearch.btncancel.caption
msgctxt "tfrmquicksearch.btncancel.caption"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Zavrieť panel filtra"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Zadaj text na vyhľadanie alebo filtrovanie"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr ""
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Rozlíšovať veľkosť písmen"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr ""
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Adresáre"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr ""
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Súbory"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr ""
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Zhoda Začiatok"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr ""
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Zhoda Koniec"
#: tfrmquicksearch.tglfilter.caption
msgctxt "tfrmquicksearch.tglfilter.caption"
msgid "Filter"
msgstr "Filter"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Prepnúť medzi vyhľadávaním a filtrom"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr ""
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr ""
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Zásuvný modul"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Hodnota"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr ""
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr ""
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "tfrmselecttextrange.btppanel.cancelbutton.caption"
msgid "Cancel"
msgstr "Zrušiť"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "tfrmselecttextrange.btppanel.closebutton.caption"
msgid "&Close"
msgstr "&Zavrieť"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "tfrmselecttextrange.btppanel.helpbutton.caption"
msgid "&Help"
msgstr "&Pomoc"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "Vyber znaky na vloženie:"
#: tfrmsetfileproperties.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsetfileproperties.caption
msgctxt "tfrmsetfileproperties.caption"
msgid "Change attributes"
msgstr "Nastaviť atribúty"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Sticky"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "Archív"
#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Vytvorený:"
#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "Skrytý"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Naposledy otvorený"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Zmenený"
#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "Len na čítanie"
#: tfrmsetfileproperties.chkrecursive.caption
#, fuzzy
#| msgid "Recursive"
msgid "Including subfolders"
msgstr "Rekurzívne"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "Systémový"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Časová značka"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atribúty"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atribúty"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitov:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Skupina"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(šedé pole znamená nezmenenú hodnotu)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ostatní"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlastník"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Textovo:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Spustiť"
#: tfrmsetfileproperties.lblmodeinfo.caption
#, fuzzy
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(šedé pole znamená nezmenenú hodnotu)"
#: tfrmsetfileproperties.lbloctal.caption
#, fuzzy
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Číselne:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čítanie"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zápis"
#: tfrmsplitter.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
#, fuzzy
#| msgid "OK"
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "OK"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmsplitter.caption
msgctxt "tfrmsplitter.caption"
msgid "Splitter"
msgstr "Delenie súborov"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr ""
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Názov súboru"
#: tfrmsplitter.grbxsize.caption
#, fuzzy
#| msgid "File size"
msgid "Size and number of parts"
msgstr "Veľkosť a počet častí"
#: tfrmsplitter.lbdirtarget.caption
#, fuzzy
#| msgid "Directory target"
msgid "Directory &target"
msgstr "Cieľový adresár"
#: tfrmsplitter.lbfilesource.caption
#, fuzzy
#| msgid "File source"
msgid "File &source"
msgstr "Zdroj &súboru"
#: tfrmsplitter.lblnumberparts.caption
#, fuzzy
#| msgid "Number of parts"
msgid "&Number of parts"
msgstr "Počet častí"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr ""
#: tfrmsplitter.rbtngigab.caption
#, fuzzy
#| msgid "Gigabytes"
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr "GB"
#: tfrmsplitter.rbtnkilob.caption
#, fuzzy
#| msgid "Kilobytes"
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr "KB"
#: tfrmsplitter.rbtnmegab.caption
#, fuzzy
#| msgid "Megabytes"
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr "MB"
#: tfrmstartingsplash.caption
msgctxt "tfrmstartingsplash.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "tfrmstartingsplash.lblbuild.caption"
msgid "Build"
msgstr "Build"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr ""
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr ""
#: tfrmstartingsplash.lblrevision.caption
msgctxt "tfrmstartingsplash.lblrevision.caption"
msgid "Revision"
msgstr "Revízia"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "tfrmstartingsplash.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "tfrmstartingsplash.lblversion.caption"
msgid "Version"
msgstr "Verzia"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""
#: tfrmsymlink.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsymlink.caption
#, fuzzy
#| msgid "Create symlink"
msgid "Create symbolic link"
msgstr "Vytvoriť symbolický odkaz"
#: tfrmsymlink.lblexistingfile.caption
#, fuzzy
#| msgid "Destination that the link will point to"
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Existujúci cieľ (kde link bude ukazovať)"
#: tfrmsymlink.lbllinktocreate.caption
#, fuzzy
#| msgid "Link name"
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Názov odkazu"
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
msgid "Close"
msgstr "Zavrieť"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
msgid "Compare"
msgstr "Porovnať"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr ""
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr ""
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr ""
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr ""
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr ""
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr ""
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Meno"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Veľkosť"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Dátum"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Dátum"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Veľkosť"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Meno"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr ""
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Porovnať"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr ""
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr ""
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr ""
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr ""
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr ""
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr ""
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr ""
#: tfrmsyncdirsperformdlg.caption
msgctxt "tfrmsyncdirsperformdlg.caption"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr ""
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr ""
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr ""
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmtweakplugin.btnadd.caption
#, fuzzy
#| msgid "Add new"
msgid "A&dd new"
msgstr "Pri&dať nový"
#: tfrmtweakplugin.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušiť"
#: tfrmtweakplugin.btnchange.caption
#, fuzzy
#| msgid "Change"
msgid "C&hange"
msgstr "Zmeniť"
#: tfrmtweakplugin.btndefault.caption
#, fuzzy
#| msgid "Default"
msgid "De&fault"
msgstr "Východzí"
#: tfrmtweakplugin.btnok.caption
#, fuzzy
#| msgid "OK"
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmtweakplugin.btnremove.caption
#, fuzzy
#| msgid "Remove"
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "Odst&rániť"
#: tfrmtweakplugin.caption
msgctxt "tfrmtweakplugin.caption"
msgid "Tweak plugin"
msgstr "Vylepšovací zásuvný modul"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
#, fuzzy
#| msgid "Detect archive type by content"
msgid "De&tect archive type by content"
msgstr "De&tekovať typ archívu podľa obsahu"
#: tfrmtweakplugin.cbpk_caps_delete.caption
#, fuzzy
#| msgid "Can delete files"
msgid "Can de&lete files"
msgstr "Môžete mazať súbory"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
#, fuzzy
#| msgid "Supports encryption"
msgid "Supports e&ncryption"
msgstr "Podporuje šifrovanie"
#: tfrmtweakplugin.cbpk_caps_hide.caption
#, fuzzy
#| msgid "Show as normal files (hide packer icon)"
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Zobraziť ako normálne súbory (skryť ikonu komprimátora)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
#, fuzzy
#| msgid "Supports packing in memory"
msgid "Supports pac&king in memory"
msgstr "Podporuje komprimáciu v pamäti"
#: tfrmtweakplugin.cbpk_caps_modify.caption
#, fuzzy
#| msgid "Can modify existing archives"
msgid "Can &modify existing archives"
msgstr "Môžte meniť existujúce archívy"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
#, fuzzy
#| msgid "Archive can contain multiple files"
msgid "&Archive can contain multiple files"
msgstr "&Archív môže obsahovať viac súborov"
#: tfrmtweakplugin.cbpk_caps_new.caption
#, fuzzy
#| msgid "Can create new archives"
msgid "Can create new archi&ves"
msgstr "Môžte vytvárať nové archí&vy"
#: tfrmtweakplugin.cbpk_caps_options.caption
#, fuzzy
#| msgid "Supports the options dialogbox"
msgid "S&upports the options dialogbox"
msgstr "Podpor&uje dialóg s nastavením"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
#, fuzzy
#| msgid "Allow searching for text in archives"
msgid "Allow searchin&g for text in archives"
msgstr "Podporuje vyhľadávanie textu v archívoch"
#: tfrmtweakplugin.lbldescription.caption
#, fuzzy
#| msgid "Description:"
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "Popis:"
#: tfrmtweakplugin.lbldetectstr.caption
#, fuzzy
#| msgid "Detect string:"
msgid "D&etect string:"
msgstr "D&etekovaný text:"
#: tfrmtweakplugin.lblextension.caption
#, fuzzy
#| msgid "Extension:"
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "Prípona:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Vlajky:"
#: tfrmtweakplugin.lblname.caption
#, fuzzy
#| msgid "Name:"
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "Me&no:"
#: tfrmtweakplugin.lblplugin.caption
#, fuzzy
#| msgid "Plugin:"
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "Zásuvný modul:"
#: tfrmtweakplugin.lblplugin1.caption
#, fuzzy
#| msgid "Plugin:"
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "Zásuvný modul:"
#: tfrmviewer.actabout.caption
msgctxt "tfrmviewer.actabout.caption"
msgid "About Viewer..."
msgstr "O prezerači..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Zobraziť About správu"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "tfrmviewer.actcopyfile.caption"
msgid "Copy File"
msgstr "Skopírovať Súbor"
#: tfrmviewer.actcopyfile.hint
msgctxt "tfrmviewer.actcopyfile.hint"
msgid "Copy File"
msgstr "Skopírovať Súbor"
#: tfrmviewer.actcopytoclipboard.caption
#, fuzzy
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Kopírovať do schránky"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr ""
#: tfrmviewer.actdeletefile.caption
msgctxt "tfrmviewer.actdeletefile.caption"
msgid "Delete File"
msgstr "Vymazať Súbor"
#: tfrmviewer.actdeletefile.hint
msgctxt "tfrmviewer.actdeletefile.hint"
msgid "Delete File"
msgstr "Vymazať Súbor"
#: tfrmviewer.actexitviewer.caption
#, fuzzy
#| msgid "Exit"
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "Koniec"
#: tfrmviewer.actfind.caption
#, fuzzy
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Hľadať"
#: tfrmviewer.actfindnext.caption
#, fuzzy
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Hľadať ďalší"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr ""
#: tfrmviewer.actfullscreen.caption
#, fuzzy
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Celá obrazovka"
#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr ""
#: tfrmviewer.actloadnextfile.caption
msgctxt "tfrmviewer.actloadnextfile.caption"
msgid "&Next"
msgstr "&Další"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Načítať Nasledujúci Súbor"
#: tfrmviewer.actloadprevfile.caption
msgctxt "tfrmviewer.actloadprevfile.caption"
msgid "&Previous"
msgstr "&Predchádzajúci"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Načítať Predchádzajúci Súbor"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr ""
#: tfrmviewer.actmirrorhorz.hint
#, fuzzy
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr "Zrkadliť"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr ""
#: tfrmviewer.actmovefile.caption
msgctxt "tfrmviewer.actmovefile.caption"
msgid "Move File"
msgstr "Presunúť Súbor"
#: tfrmviewer.actmovefile.hint
msgctxt "tfrmviewer.actmovefile.hint"
msgid "Move File"
msgstr "Presunúť Súbor"
#: tfrmviewer.actpreview.caption
#, fuzzy
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Náhľad"
#: tfrmviewer.actreload.caption
msgctxt "tfrmviewer.actreload.caption"
msgid "Reload"
msgstr "Obnoviť"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Znova načítať aktuálny súbor"
#: tfrmviewer.actrotate180.caption
#, fuzzy
#| msgid "Rotate 180"
msgctxt "tfrmviewer.actrotate180.caption"
msgid "+ 180"
msgstr "Otoč o 180"
#: tfrmviewer.actrotate180.hint
#, fuzzy
#| msgid "Rotate 180"
msgctxt "tfrmviewer.actrotate180.hint"
msgid "Rotate 180 degrees"
msgstr "Otoč o 180"
#: tfrmviewer.actrotate270.caption
#, fuzzy
#| msgid "Rotate 270"
msgctxt "tfrmviewer.actrotate270.caption"
msgid "- 90"
msgstr "Otoč o 270"
#: tfrmviewer.actrotate270.hint
#, fuzzy
#| msgid "Rotate 270"
msgctxt "tfrmviewer.actrotate270.hint"
msgid "Rotate -90 degrees"
msgstr "Otoč o 270"
#: tfrmviewer.actrotate90.caption
#, fuzzy
#| msgid "Rotate 90"
msgctxt "tfrmviewer.actrotate90.caption"
msgid "+ 90"
msgstr "Otoč o 90"
#: tfrmviewer.actrotate90.hint
#, fuzzy
#| msgid "Rotate 90"
msgctxt "tfrmviewer.actrotate90.hint"
msgid "Rotate +90 degrees"
msgstr "Otoč o 90"
#: tfrmviewer.actsave.caption
#, fuzzy
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Uložiť"
#: tfrmviewer.actsaveas.caption
msgctxt "tfrmviewer.actsaveas.caption"
msgid "Save As..."
msgstr "Uložiť ako..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Ulož Súbor Ako ..."
#: tfrmviewer.actscreenshot.caption
#, fuzzy
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Okopírovať obrazovku"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr ""
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr ""
#: tfrmviewer.actselectall.caption
#, fuzzy
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Vybrat Všetko"
#: tfrmviewer.actshowasbin.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "Zobraziť &binárne"
#: tfrmviewer.actshowasbook.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "Zobraziť ako knihu"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr ""
#: tfrmviewer.actshowashex.caption
#, fuzzy
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "Zobraziť &hexadecimálne"
#: tfrmviewer.actshowastext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "Zobraziť ako &Text"
#: tfrmviewer.actshowaswraptext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "Zobraziť &ako zalamovaný text"
#: tfrmviewer.actshowgraphics.caption
#, fuzzy
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Grafika"
#: tfrmviewer.actshowplugins.caption
#, fuzzy
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Zásuvné moduly"
#: tfrmviewer.actstretchimage.caption
msgctxt "tfrmviewer.actstretchimage.caption"
msgid "Stretch"
msgstr "Roztiahnuť"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Natiahni obrázok"
#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr ""
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr ""
#: tfrmviewer.actzoomin.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Priblížiť"
#: tfrmviewer.actzoomout.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Oddialiť"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Kopírovať"
#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Vystrihnúť"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Vymazať"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Vymazať"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Celá obrazovka"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Zvýrazniť"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Presunúť"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Presunúť"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Farba"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Červené oči"
#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Zmeniť veľkosť/rozlíšenie"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Zpäť"
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Prezerač"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Prezentácia"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Pero"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Zvýrazniť"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Farba"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Prezentácia"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Zobraziť"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "O programe"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Edit"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Kó&dovanie"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Súbor"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Obrázok"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Tlač..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Otočiť"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Okopírovať obrazovku"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Zobraziť"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Vybrať všetko"
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Ak súbor existuje"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Ak súbor existuje"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
#, fuzzy
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopírov&ať dátum/čas"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Pracuj na pozadí (oddelené spojenie)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Ak súbor existuje"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Výška"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Šírka"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Zruš Rýchly Filter"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Prerušiť Prebiehajúcu Operáciu"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr ""
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr ""
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr ""
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr ""
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr ""
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr ""
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr ""
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr ""
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr ""
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr ""
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Schránka neobsahuje žiadne platné údaje panelu nástrojov"
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr ""
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr ""
#: ulng.rscolattr
msgid "Attr"
msgstr "Atr."
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Dátum"
#: ulng.rscolext
msgid "Ext"
msgstr "Prípona"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Meno"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Veľkosť"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Zarovnať"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Nadpis"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Vymazať"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Detaily položky"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Presunúť"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Šírka"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Nastavenie stĺpcov:"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr ""
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr ""
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Kopírovanie (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr ""
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr ""
#: ulng.rsdiffadds
msgid " Adds: "
msgstr ""
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr ""
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr ""
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr ""
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr ""
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Pr&erušiť"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "Všetko"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Pripojiť"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr ""
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Zrušiť"
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "Pokračovať"
#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "Kopírovať do"
#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "Kopírovať do &Všetko"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "Ukončiť program"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr ""
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Všetko ignorovať"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Nie"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "&Nie je"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&OK"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr ""
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Prepísať"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Prepísať &Všetko"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr ""
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Prepísať Všetko Staršie"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr ""
#: ulng.rsdlgbuttonrename
#, fuzzy
#| msgid "Rename"
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Pr&emenovať"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr ""
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Znovu"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "Pre&skočiť"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Pres&kočiť Všetko"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Ano"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Kopírovať súbor(y)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Presunúť súbor(y)"
#: ulng.rsdlgoppause
#, fuzzy
#| msgid "Pause"
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "Pauza"
#: ulng.rsdlgopstart
#, fuzzy
#| msgid "Start"
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "Štart"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Rad"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Rýchlosť %s/s"
#: ulng.rsdlgspeedtime
#, fuzzy
#| msgid "Speed %s/s, remaining time %s"
msgid "Speed %s/s, time remaining %s"
msgstr "Rýchlosť %s/s, ostávajúci čas %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr ""
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr ""
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Interný editor Double Commanderu."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr ""
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr ""
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "nový.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Meno súboru:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Otvoriť súbor"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Vzad"
#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Hľadanie"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "V&pred"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Nahradiť"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr ""
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr ""
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr ""
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr ""
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr ""
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr ""
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr ""
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
#, fuzzy
#| msgid "Ask;Overwrite;Copy into;Skip"
msgid "Ask;Merge;Skip"
msgstr "Opýtaj sa;Prepíš;Skopíruj do;Preskoč"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Opýtaj sa;Prepíš;Prepíš staršie;Preskoč"
#: ulng.rsfileopsetpropertyerroroptions
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Opýtaj sa;Nenastavuj už nikdy;Ignoruj chyby"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "Filter"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Definovať vzor"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s úrovní"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "všetko (nelimitovaná hĺbka)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "len aktuálny adresár"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Adresár %s neexistuje!"
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Nájdené: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Uložiť vyhľadávaciu šablónu"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Názov šablóny:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Prehľadané: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Prehľadávam"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Hľadať súbory"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr ""
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Začať v"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Voľných %s z %s bytov"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "Voľné miesto %s bytov"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Dátum/čas posledného prístupu"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Atribúty"
#: ulng.rsfunccomment
msgid "Comment"
msgstr "Komentár"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Skomprimovaná veľkosť"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Dátum/čas vytvoeenia"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Prípona"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Skupina"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr ""
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Odkaz na"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Dátum/čas zmeny"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Meno"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Meno bez prípony"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Vlastník"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Cesta"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Veľkosť"
#: ulng.rsfunctype
msgid "Type"
msgstr "Typ"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Chyba pri vytváraní hardlinku."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr ""
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Dialód kopírovania/presunu"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Porovnávač"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr ""
#: ulng.rshotkeycategoryeditor
#, fuzzy
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rshotkeycategoryfindfiles
#, fuzzy
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Hľadať súbory"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Hlavný"
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Prezerač"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr ""
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Maska zrušenia výberu"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Maska výberu"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Vstupná maska:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr ""
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr ""
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Konfigurovať užívateľské stĺpce"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr ""
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Akcie"
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr ""
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Upraviť"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Vysunúť"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr ""
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr ""
#: ulng.rsmnumount
msgid "Mount"
msgstr "Pripojiť"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Nový"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Nie je dostupné žiadne médium"
#: ulng.rsmnuopen
#, fuzzy
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Otvoriť"
#: ulng.rsmnuopenwith
#, fuzzy
#| msgid "Open with ..."
msgid "Open with"
msgstr "Otvoriť s ..."
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Iné ..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr ""
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Triediť podľa"
#: ulng.rsmnuumount
#, fuzzy
#| msgid "Umount"
msgid "Unmount"
msgstr "Odpojiť"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Zobraziť"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Účet:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Ďalšie parametre pre príkazový riadok archivátora:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Nedá sa kopírovať/presunúť súbor \"%s\" sám na seba!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Nemôžem vymazať adresár %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Zmena adresára na [%s] zlyhala!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Odstrániť všetky neaktívne záložky?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Záložka (%s) je uzamknutá! Aj tak zavrieť?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Skutočne chcete skončiť?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr ""
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr ""
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Kopírovať %d vybraných súborov/zložek?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Kopírovať vybrané \"%s\"?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr ""
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr ""
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr ""
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Vymazať čiastočne skopírovaný súbor?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Vymazať %d vybrané súbory / adresáre?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Vymazať %d vybraných súborov/zložiek do koša?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Vymazať vybrané \"%s\"?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Presunúť vybrané \"%s\" do koša?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "\"%s\" nedá sa zmazať do koše! Vymazať priamo?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Disk nie je dostupný"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr ""
#: ulng.rsmsgenterfileext
#, fuzzy
msgid "Enter file extension:"
msgstr "Zadajte príponu súboru:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Zadajte názov:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr ""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "CRC chyba (kontrolný súčet nesúhlasí)"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Dáta sú zlé"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Nedá sa spojiť so serverom: \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Nedá sa kopírovať súbor %s do %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Už existuje adresár s menom \"%s\"."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Dátum %s nie je podporovaný!"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Adresár %s existuje!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Operácia prerušená užívateľom"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Chyba pri uzatváraní súboru"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Nedá sa vytvoriť súbor"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "V archíve nie sú žiadne ďalšie súbory"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Nedá sa otvoriť existujúci súbor"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Chyba pri čítaní súboru"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Chyba pri zápise do súboru"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Nedá sa vytvoriť adresár %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Neplatný odkaz"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Súbory neexistujú"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Nedostatok pamäti"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Funkcia nie je podporovaná!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Chyba v príkaze kontextového menu "
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Chyba pri načítavaní konfigurácie"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Syntaktická chyba v regulárnom výraze!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Nedá sa premenovať súbor %s na %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Nemôžem uložiť asociáciu súboru!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Súbor sa nedá uložiť"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Nedajú sa nastaviť atribúty pre \"%s\""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Nedá sa nastaviť dátum/čas pre \"%s\""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Nemôžem nastaviť majiteľa/skupinu pre \"%s\""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr ""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Buffer je príliš malý"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Príliš mnoho súborov pre kompresiu"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Neznámy formát archívu"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr ""
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr ""
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr ""
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr ""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Súbor %s bol zmenený, uložiť?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr ""
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr ""
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Súbor %s existuje, prepísať?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr ""
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr ""
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Sú aktívne súborové operácie"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Niektoré súborové operácie ešte neboli dokončené. Ukončenie Double Commanderu môže spôsobiť stratu dát."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
#, fuzzy
#| msgid "File %s is marked as read-only. Delete it?"
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Súbor %s je len na čítanie! Aj tak Vymazať?"
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "Veľkosť \"%s\" je príliš veľká pro cieľový súborový systém!"
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "Adresár %s existuje, prepísať?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Následuj symbolický odkaz \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr ""
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr ""
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr ""
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr ""
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr ""
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr ""
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr ""
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr ""
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr ""
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr ""
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr ""
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr ""
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr ""
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr ""
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr ""
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr ""
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr ""
#: ulng.rsmsghotdirjustpath
#, fuzzy
#| msgid "Path"
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Cesta"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr ""
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr ""
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr ""
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr ""
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr ""
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr ""
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr ""
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr ""
#: ulng.rsmsghotdirsimplecommand
#, fuzzy
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Príkaz:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr ""
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr ""
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Meno:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr ""
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr ""
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr ""
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr ""
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr ""
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr ""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Chyba v príkazovom riadku"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Neplatné meno súboru"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Nesprávny formát konfiguračného súboru"
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Nesprávna cesta"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Cesta %s obsahuje zakázané znaky."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Toto nie je platný zásuvný modul!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Tento zásuvný modul je vytvorený pre Double Commander pre %s.%s Nemôže fungovať s Double Commander pre %s!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Nesprávne úvodzovky"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Neplatný výber."
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Nahrávam zoznam súborov..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr ""
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr ""
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Kopírovať súbor %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Zmazať súbor %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Chyba:"
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr ""
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Rozbaliť súbor %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Info: "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Vytvoriť odkaz %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Vytvoriť adresár %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Presunúť súbor %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Komprimovať do súboru %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Odstrániť adresár %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Hotovo:"
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Vytvoriť symlink %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Testovať integritu súboru %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr ""
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr ""
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Hlavné heslo"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Prosím, zadejte hlavné heslo:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Nový súbor"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Ďalšia časť bude rozbalená"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Žiadne súbory"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Nie sú vybrané žiadne súbory."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Nie je dostatok voľného miesta na cieľovom disku! Pokračovať?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Nie je dostatok voľného miesta na cieľovom disku! Opakovať?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Nedá sa vymazať súbor %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Nie je zavedené."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Heslo:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Heslá sú rozdielne!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Prosím, zadejte heslo:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Heslo (Firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Prosím, znova zadaj heslo na kontrolu:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Vymazať %s"
#: ulng.rsmsgpresetalreadyexists
#, fuzzy
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Predvoľba \"%s\" už existuje. Nahradiť?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr ""
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr ""
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr ""
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr ""
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Premenovať/presunúť %d vybraných súborov/zložek?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Premenovať/presunúť vybrané \"%s\"?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Prosím, na uplatnenie zmien reštartujte program"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr ""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Vybrané: %s z %s, súbory: %d z %d, adresáre: %d of %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr ""
#: ulng.rsmsgselectonlychecksumfiles
#, fuzzy
#| msgid "Please select only check sum files!"
msgid "Please select only checksum files!"
msgstr "Prosím, vyberte len súbory s kontrolným súčtom!"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Prosím, vyberte umiestnenie ďalšej časti"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Nastaviť názov disku"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr ""
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr ""
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr ""
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr ""
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr ""
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr ""
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr ""
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr ""
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Premenovať záložku"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Nové meno záložky:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Cieľová cesta:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr ""
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr ""
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr ""
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Bolo vybraných príliš veľa súborov."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr ""
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr ""
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr ""
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Užívateľské meno:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Užívateľské meno (Firewall):"
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Názov disku:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Prosím, zadajte veľkosť zväzku:"
#: ulng.rsmsgwipefldr
#, fuzzy
msgid "Wipe %d selected files/directories?"
msgstr "Bezpečne zmazať %d vybraných súborov/zložek?"
#: ulng.rsmsgwipesel
#, fuzzy
msgid "Wipe selected \"%s\"?"
msgstr "Bezpečne zmazať vybrané \"%s\"?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
#, fuzzy
#| msgid "No change;UPPERCASE;lowercase;First Char Big;"
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Nemeniť;VEĽKÝM;malým;Prvý znak veľkým;Prvý Znak Každého Slova Veľkým;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Prerušené"
#: ulng.rsopercalculatingchecksum
#, fuzzy
#| msgid "Calculating check sum"
msgid "Calculating checksum"
msgstr "Počítam kontrolný súčet"
#: ulng.rsopercalculatingchecksumin
#, fuzzy
#| msgid "Calculating check sum in \"%s\""
msgid "Calculating checksum in \"%s\""
msgstr "Počítam kontrolný súčet v \"%s\""
#: ulng.rsopercalculatingchecksumof
#, fuzzy
#| msgid "Calculating check sum of \"%s\""
msgid "Calculating checksum of \"%s\""
msgstr "Počítam kontrolný súčet \"%s\""
#: ulng.rsopercalculatingstatictics
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "Počíta sa"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Počíta sa \"%s\""
#: ulng.rsopercombining
msgid "Joining"
msgstr "Pripájam sa"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Pripájam súbory v \"%s\" do \"%s\""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Kopírujem"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Kopírujem z \"%s\" do \"%s\""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Kopírujem \"%s\" do \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Vytváram adresár"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Vytváram adresár \"%s\""
#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "Mazanie"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Mazanie v \"%s\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Mazanie \"%s\""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Vykonávam"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Vykonávam \"%s\""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Rozbaľujem"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Rozbaľujem z \"%s\" do \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Ukončené"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Výpis"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Výpis \"%s\""
#: ulng.rsopermoving
msgid "Moving"
msgstr "Presúvam"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Presúvam z \"%s\" do \"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Presúvam \"%s\" na \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Nespustené"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Balím"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Balím z \"%s\" do \"%s\""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Balím \"%s\" do \"%s\""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Pozastavené"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Pozastavujem"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Beží"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Nastavujem vlastníctvo"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Nastavujem vlastníctvo v \"%s\""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Nastavujem vlastníctvo \"%s\""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Delím"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Delím \"%s\" na \"%s\""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Spúšťam"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Zastavené"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Zastavujem"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Skúšam"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Skúšam v \"%s\""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Skúšam \"%s\""
#: ulng.rsoperverifyingchecksum
#, fuzzy
#| msgid "Verifying check sum"
msgid "Verifying checksum"
msgstr "Overujem kontrolný súčet"
#: ulng.rsoperverifyingchecksumin
#, fuzzy
#| msgid "Verifying check sum in \"%s\""
msgid "Verifying checksum in \"%s\""
msgstr "Overujem kontrolný súčet v \"%s\""
#: ulng.rsoperverifyingchecksumof
#, fuzzy
#| msgid "Verifying check sum of \"%s\""
msgid "Verifying checksum of \"%s\""
msgstr "Overujem kontrolný súčet \"%s\""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Čakám na prístup k zdroju súborov"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Čakám na reakciu užívateľa"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Bezpečné mazanie"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Bezpečné mazanie v \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Bezpečné mazanie \"%s\""
#: ulng.rsoperworking
msgid "Working"
msgstr "Pracujem"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr ""
#: ulng.rsoptarchivedelete
msgctxt "ulng.rsoptarchivedelete"
msgid "Delete:"
msgstr "Zmazať:"
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Rozbaliť bez cesty:"
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr "Mód kontroly formátu:"
#: ulng.rsoptarchiveid
msgctxt "ulng.rsoptarchiveid"
msgid "ID:"
msgstr "ID:"
#: ulng.rsoptarchiveidpos
msgctxt "ulng.rsoptarchiveidpos"
msgid "ID Position:"
msgstr "Pozícia ID:"
#: ulng.rsoptarchiveidseekrange
msgctxt "ulng.rsoptarchiveidseekrange"
msgid "ID Seek Range:"
msgstr "Rozsah hľadania ID:"
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr "Parameter"
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr "Výzva pre zadanie hesla:"
#: ulng.rsoptarchiveselfextract
msgctxt "ulng.rsoptarchiveselfextract"
msgid "Create self extracting archive:"
msgstr "Vytvoriť samorozbalovací archív:"
#: ulng.rsoptarchivetest
msgctxt "ulng.rsoptarchivetest"
msgid "Test:"
msgstr "Skúška:"
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Meno typu archívu:"
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Hodnota"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Asociovať zásuvný modul \"%s\" s:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Prvý;Posledný"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr ""
#: ulng.rsoptdisable
#, fuzzy
msgid "Disable"
msgstr "Zakázať"
#: ulng.rsoptenable
msgctxt "ulng.rsoptenable"
msgid "Enable"
msgstr "Povoliť"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Zadajte príponu"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr ""
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "oddelenom okne;minimalizovanom oddelenom okne;panely operácií"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr ""
#: ulng.rsopthotkeysadddeleteshortcutlong
#, fuzzy,badformat
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Skratka pre cm_Delete bude zaregistrovaná, takže môže byť použitá na obrátenie tohto nastavenia."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Pridať skratku pre %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Pridať skratku"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Nemôžem zmeniť skratku"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Zmeniť skratku"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Príkaz"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Skratka %s pre cm_Delete má parameter, ktorý prepíše toto nastavenie. Chceš tento parameter na použitie s globálnym nastavením?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Skratka %s pre cm_Delete musí mať parameter zmenený, aby súhlasil so skratkou %s. Chceš ho zmeniť?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Popis"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Zmeniť skratku pre %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Opraviť parameter"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Klávesa"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Horúce klávesy"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr ""
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parametre"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Nastaviť skratku pre vymazanie súboru"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
#, fuzzy,badformat
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Pre toto nastavenie"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Skratka %s pre cm_Delete je postupnosť skratiek, pre ktorú klávesa so spätným Shiftom nemôže byť priradená. Toto nastavenie nemusí fungovať."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Klávesa sa už používa"
#: ulng.rsopthotkeysshortcutusedtext1
#, fuzzy
#| msgid "Shortcut %s is already used for %s."
msgid "Shortcut %s is already used."
msgstr "Klávesa %s sa už používa pre"
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Zmeniť na %s?"
#: ulng.rsopthotkeysusedby
#, fuzzy
#| msgid "used by"
msgid "used for %s in %s"
msgstr "použité pre %s %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "použité pre tento príkaz, ale s inými parametrami"
#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Archivátory"
#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Automatická obnova"
#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Funkcie"
#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr ""
#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Farby"
#: ulng.rsoptionseditorcolumnsview
msgctxt "ulng.rsoptionseditorcolumnsview"
msgid "Columns"
msgstr "Stĺpce"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Umiestnenie konfigurácie"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Užívateľské stĺpce"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Rýchle adresáre"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr ""
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Tlačidlo zoznamu diskov"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr ""
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr ""
#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Asociácie súborov"
#: ulng.rsoptionseditorfilenewfiletypes
#, fuzzy
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Nový"
#: ulng.rsoptionseditorfileoperations
#, fuzzy
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Súborové operácie"
#: ulng.rsoptionseditorfilepanels
#, fuzzy
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Panely súborov"
#: ulng.rsoptionseditorfilesearch
#, fuzzy
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Hľadanie súborov"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Náhľad súborov"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Typy súborov"
#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Záložky zložiek"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr ""
#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Písma"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Zvýrazňovače"
#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Horúce klávesy"
#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Ikony"
#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Zoznam ignorovaných"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Klávesy"
#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Jazyk"
#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr "Rozvrhnutie"
#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Log"
#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Rôzne"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Myš"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Zásuvné moduly"
#: ulng.rsoptionseditorquicksearch
#, fuzzy
#| msgid "Quick search"
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Rýchle hľadanie/filter"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminál"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Panel nástrojov"
#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Nástroje"
#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Bublinová pomoc"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr ""
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr ""
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Žiadny;Príkaz;Rýchle hľadanie;Rýchly filter"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Ľavé tlačítko;Pravé tlačítko;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "Na vrch zoznamu súborov;Pod adresáre (ak sú adresáre zoradené pred súbormi);Na vytriedenej pozícii;Na spodok zoznamu súborov"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Zásuvný modul %s je už priradený nasledujúcim príponám:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Aktívne"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Názov súboru"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Meno"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Registrované pre"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr ""
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "Súbory;Ad&resáre;Súbory a Adresáre"
#: ulng.rsoptsearchopt
#, fuzzy
#| msgid "&Hide filter panel when not focused"
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "Sc&hovaj filter panelu, keď s ním nepracuješ"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "Nerozlišovať veľkosť písmen;Podľa miestneho nastavenia (aAbBcC);Najprv veľké, potom malé písmená (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "Triediť podľa mena a zobraz ich na začiatku;Triediť ako súbory a zobraz ich na začiatku;Triediť ako súbory"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Abecedne, s ohľadom na prízvuk;Prirodzené triedenie: abecedne a číselne"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Hore;Dole"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "Odd&eľovač;Vnúto&rný príkaz;E&xterný príkaz;Men&u"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr ""
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "Nemeň pozíciu;Použi také isté nastavenia ako pre nové súbory;Na triedenú pozíciu"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Súbory: %d, adresáre: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Nedajú sa zmeniť prístupové práva pre \"%s\""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Nedá sa zmeniť vlastník pre \"%s\""
#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "Súbor"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Adresár"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Pomenovaná rúra"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Socket"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Špeciálne blokové zariadenie"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Špeciálne znakové zariadenie"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Zástupca"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Neznámy typ"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Výsledok hľadania:"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "Hľadanie"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr ""
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Vybrať adresár"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "Ukáže &sa pomoc pre %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Všetko"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr ""
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr ""
#: ulng.rssimplewordcommand
#, fuzzy
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Príkaz"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr ""
#: ulng.rssimplewordfiles
msgid "files"
msgstr "Súbory"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr ""
#: ulng.rssimplewordresult
msgid "Result"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr ""
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bajtov"
#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr "Gigabajtov"
#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr "Kilobajtov"
#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr "Megabajtov"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabajtov"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Súborov: %d, Zložiek: %d, Veľkosť: %s (%s bajtov)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Nedá sa vytvoriť cieľový adresár!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Nesprávný formát veľkosti súboru!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Nedá sa rozdeliť súbor!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Počet častí je väčší ako 100! Pokračovať?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Zvoľte adresár:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr ""
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr ""
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Chyba pri vytváraní zástupcu."
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr "Predvolený text"
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr "Prostý text"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr ""
#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Dňov"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Hodina(hodiny,hodín)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minúta(ty,t)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Mesiac(e,ov)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Sekunda(sekundy,sekúnd)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Týždeň(ne,ňov)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Rok(y,ov)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr ""
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr ""
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Porovnávač"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Chyba otvorenia iných"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Chyba otvorenia editora"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Chyba otvorenia terminálu"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Chyba otvorenia prezerača"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminál"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Prezerač"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Prosím, založte do bug trackeru správu o tejto chybe s popisom, čo ste robili a s nasledujúcim súborom:%sStlačte %s pre pokračovanie alebo %s pre ukončenie programu."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr ""
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr ""
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr ""
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr ""
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr ""
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr ""
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr ""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr ""
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr ""
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr ""
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr ""
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr ""
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr ""
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr ""
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr ""
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr ""
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr ""
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr ""
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr ""
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr ""
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr ""
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr ""
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr ""
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr ""
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr ""
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr ""
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr ""
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr ""
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr ""
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr ""
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr ""
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr ""
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr ""
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Sieť"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Interný prezerač Double Commandera."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr ""
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Kódovanie"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr ""
#: ulng.rsviewnewsize
#, fuzzy
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Nová veľkosť"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s nebol nájdený!"
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr ""
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr ""
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr ""
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr ""