doublecmd/language/doublecmd.ca.po
2017-10-26 19:56:34 +00:00

13157 lines
330 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2012-08-14\n"
"Last-Translator: Jordi Casas <jordi@refugi.com>\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Català\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr ""
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr ""
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr ""
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr ""
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Escull plantilla"
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
#, fuzzy
#| msgid "Check free space"
msgid "C&heck free space"
msgstr "Examina espai lliure"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Copia atributs"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Copia propietat"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Copia Data/Hora"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
#, fuzzy
#| msgid "Correct links"
msgid "Correct lin&ks"
msgstr "Corregeix enllaços"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
#, fuzzy
#| msgid "Drop readonly flag"
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
msgid "Drop readonly fla&g"
msgstr "Treu marca de només-lectura"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Exclou carpetes buides"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
#, fuzzy
#| msgid "Follow links"
msgid "Fo&llow links"
msgstr "Segueix enllaços"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "Reserva espai"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Usa fitxer de plantilla"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
#, fuzzy
#| msgid "When directory exists"
msgid "When dir&ectory exists"
msgstr "Quan la carpeta existeixi"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
#, fuzzy
#| msgid "When file exists"
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When &file exists"
msgstr "Quan el fitxer existeixi"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<sense plantilla>"
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr "&Tanca"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Copia al portapapers"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "Quant a"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Fet"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr ""
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Pàgina Web:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revisió"
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Versió"
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Reinicia"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Escull atributs"
#: tfrmattributesedit.cbarchive.caption
#, fuzzy
#| msgid "Archive"
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
msgid "&Archive"
msgstr "Fitxer"
#: tfrmattributesedit.cbcompressed.caption
#, fuzzy
#| msgid "Compressed"
msgid "Co&mpressed"
msgstr "Comprimit"
#: tfrmattributesedit.cbdirectory.caption
#, fuzzy
#| msgid "Directory"
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
msgid "&Directory"
msgstr "Carpeta"
#: tfrmattributesedit.cbencrypted.caption
#, fuzzy
#| msgid "Encrypted"
msgid "&Encrypted"
msgstr "Encriptat"
#: tfrmattributesedit.cbhidden.caption
#, fuzzy
#| msgid "Hidden"
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
msgid "&Hidden"
msgstr "Ocult"
#: tfrmattributesedit.cbreadonly.caption
#, fuzzy
#| msgid "Read only"
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
msgid "Read o&nly"
msgstr "Només lectura"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
#, fuzzy
#| msgid "Sparse"
msgid "S&parse"
msgstr "Escàs"
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Adhesiu"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
#, fuzzy
#| msgid "Symlink"
msgid "&Symlink"
msgstr "Enllaç Simbòlic"
#: tfrmattributesedit.cbsystem.caption
#, fuzzy
#| msgid "System"
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "Sistema"
#: tfrmattributesedit.cbtemporary.caption
#, fuzzy
#| msgid "Temporary"
msgid "&Temporary"
msgstr "Temporal"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Atributs NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Atributs generals"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grup"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Altres"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Propietari"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Ejecució"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lectura"
#: tfrmattributesedit.lbltextattrs.caption
#, fuzzy
#| msgid "As text:"
msgid "As te&xt:"
msgstr "Como a text:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Escriptura"
#: tfrmchecksumcalc.caption
#, fuzzy
#| msgid "Calculate check sum..."
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Calcula suma de comprovació"
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr ""
#: tfrmchecksumcalc.cbseparatefile.caption
#, fuzzy
#| msgid "Create separate checksum file for each file"
msgid "C&reate separate checksum file for each file"
msgstr "Crea un fitxer por cada comprobació"
#: tfrmchecksumcalc.lblsaveto.caption
#, fuzzy
#| msgid "&Save check sum file(s) to:"
msgid "&Save checksum file(s) to:"
msgstr "Desa fitxer de comprobació en:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Tanca"
#: tfrmchecksumverify.caption
#, fuzzy
#| msgid "Verify check sum..."
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Verifica comprobació..."
#: tfrmconnectionmanager.btnadd.caption
#, fuzzy
#| msgid "Add"
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "Afegeix"
#: tfrmconnectionmanager.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmconnectionmanager.btnconnect.caption
#, fuzzy
#| msgid "Connect"
msgid "C&onnect"
msgstr "C&onnecta"
#: tfrmconnectionmanager.btndelete.caption
#, fuzzy
#| msgid "Delete"
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "Esborra"
#: tfrmconnectionmanager.btnedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Edita"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Connexió"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Connecta a:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "Afegeix a la cua"
#: tfrmcopydlg.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "O&pcions"
#: tfrmcopydlg.btnsaveoptions.caption
#, fuzzy
#| msgid "Save these options as default"
msgid "Sa&ve these options as default"
msgstr "Desa opcions per defecte"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Copia fitxer(s)"
#: tfrmcopydlg.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Nova cua"
#: tfrmcopydlg.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Cua 1"
#: tfrmcopydlg.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Cua 2"
#: tfrmcopydlg.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Cua 3"
#: tfrmcopydlg.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Cua 4"
#: tfrmcopydlg.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Cua 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr ""
#: tfrmdescredit.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Comentari Fitxer/Carpeta"
#: tfrmdescredit.lbleditcommentfor.caption
#, fuzzy
#| msgid "Edit comment for:"
msgid "E&dit comment for:"
msgstr "Edita comentari per:"
#: tfrmdescredit.lblencoding.caption
#, fuzzy
#| msgid "Encoding:"
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "Codificant:"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "Quant a"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Autocomparació."
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Mode Binari"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Cancel·la"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Cancel·la"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Copia bloc dret"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Copia bloc dret"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Copia bloc esquerra"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Copia bloc esquerra"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Copia"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Retalla"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Esborra"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Enganxa"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Refà"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Selecciona &tot"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Desfà"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "&Surt"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Primera diferència"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "tfrmdiffer.actfirstdifference.hint"
msgid "First Difference"
msgstr "Primera diferència"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Ignora maj./min."
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Ignora espais blancs"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Manté desplaçament"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Última diferència"
#: tfrmdiffer.actlastdifference.hint
msgctxt "tfrmdiffer.actlastdifference.hint"
msgid "Last Difference"
msgstr "Última diferència"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Diferències de línia"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Següent diferència"
#: tfrmdiffer.actnextdifference.hint
msgctxt "tfrmdiffer.actnextdifference.hint"
msgid "Next Difference"
msgstr "Següent diferència"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Obre esquerra..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Obre dreta..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Dibuixa Fons"
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Diferència prèvia"
#: tfrmdiffer.actprevdifference.hint
msgctxt "tfrmdiffer.actprevdifference.hint"
msgid "Previous Difference"
msgstr "Diferència prèvia"
#: tfrmdiffer.actreload.caption
#, fuzzy
#| msgid "Reload"
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
msgid "&Reload"
msgstr "Recarrega"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Recarrega"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Desa"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Desa"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Amnomena i desa..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Anomena i desa..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Desa esquerra"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Desa esquerra"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Desa esquerra com..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Desa esquerra com..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Desa dreta"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Desa dreta"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Desa dreta com..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Desa dreta com..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Compara"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Compara"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Codificació"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Codificant"
#: tfrmdiffer.caption
msgctxt "tfrmdiffer.caption"
msgid "Compare files"
msgstr "Compara fitxers"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
#, fuzzy
#| msgid "Left"
msgid "&Left"
msgstr "esquerra"
#: tfrmdiffer.miencodingright.caption
#, fuzzy
#| msgid "Right"
msgid "&Right"
msgstr "dreta"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Accions"
#: tfrmdiffer.mnuedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "Edita"
#: tfrmdiffer.mnuencoding.caption
#, fuzzy
#| msgid "Encoding"
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "Codificació"
#: tfrmdiffer.mnufile.caption
#, fuzzy
#| msgid "File"
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "Fitxer"
#: tfrmdiffer.mnuoptions.caption
#, fuzzy
#| msgid "Options"
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
msgid "&Options"
msgstr "&Opcions"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr ""
#: tfrmedithotkey.btncancel.caption
msgctxt "tfrmedithotkey.btncancel.caption"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmedithotkey.btnok.caption
msgctxt "tfrmedithotkey.btnok.caption"
msgid "&OK"
msgstr "&Accepta"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr ""
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr "Només per a aquests controls"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "Paràmetres (Cadascun a una línia diferent)"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Dreceres"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "Quant a"
#: tfrmeditor.actabout.hint
msgctxt "tfrmeditor.actabout.hint"
msgid "About"
msgstr "Quant a"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Configuració"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Configuració"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Copia"
#: tfrmeditor.acteditcopy.hint
msgctxt "tfrmeditor.acteditcopy.hint"
msgid "Copy"
msgstr "Copia"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Retalla"
#: tfrmeditor.acteditcut.hint
msgctxt "tfrmeditor.acteditcut.hint"
msgid "Cut"
msgstr "Retalla"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Esborra"
#: tfrmeditor.acteditdelete.hint
msgctxt "tfrmeditor.acteditdelete.hint"
msgid "Delete"
msgstr "Esborra"
#: tfrmeditor.acteditfind.caption
#, fuzzy
#| msgid "&Find "
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Cerca"
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Cerca"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Cerca següent"
#: tfrmeditor.acteditfindnext.hint
msgctxt "tfrmeditor.acteditfindnext.hint"
msgid "Find next"
msgstr "Cerca següent"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr ""
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr ""
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr ""
#: tfrmeditor.acteditlineendcr.hint
msgctxt "tfrmeditor.acteditlineendcr.hint"
msgid "Mac (CR)"
msgstr ""
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr ""
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
msgid "Windows (CRLF)"
msgstr ""
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr ""
#: tfrmeditor.acteditlineendlf.hint
msgctxt "tfrmeditor.acteditlineendlf.hint"
msgid "Unix (LF)"
msgstr ""
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Enganxa"
#: tfrmeditor.acteditpaste.hint
msgctxt "tfrmeditor.acteditpaste.hint"
msgid "Paste"
msgstr "Enganxa"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Refà"
#: tfrmeditor.acteditredo.hint
msgctxt "tfrmeditor.acteditredo.hint"
msgid "Redo"
msgstr "Refà"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Reemplaça"
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Reemplaça"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Selecciona &tot"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Selecciona tot"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Desfà"
#: tfrmeditor.acteditundo.hint
msgctxt "tfrmeditor.acteditundo.hint"
msgid "Undo"
msgstr "Desfà"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "Tanca"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Tanca"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Surt"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Surt"
#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "&Nou"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Nou"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Obre"
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Obre"
#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Desa"
#: tfrmeditor.actfilesave.hint
msgctxt "tfrmeditor.actfilesave.hint"
msgid "Save"
msgstr "Desa"
#: tfrmeditor.actfilesaveas.caption
#, fuzzy
#| msgid "Save &As.."
msgid "Save &As..."
msgstr "Anomena i desa..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Anomena i desa"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "De&sa-ho Tot"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Desa-ho tot"
#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr "Editor"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "A&juda"
#: tfrmeditor.menuitem1.caption
msgctxt "tfrmeditor.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Edita"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codificant"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Obre com"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Anomena i desa"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Fitxer"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "LLenguatge de codificació"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Fi de línia"
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n5.caption
msgctxt "tfrmeditor.n5.caption"
msgid "-"
msgstr "-"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&Accepta"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
msgid "C&ase sensitivity"
msgstr "Sensible a may./min."
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
#, fuzzy
#| msgid "Search from &caret"
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
msgid "S&earch from caret"
msgstr "Cerca desde la posició actual"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "Expresions &regulars"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
msgid "Selected &text only"
msgstr "Només Selecciona &text"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
msgid "&Whole words only"
msgstr "Només paraules completes"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
msgid "Option"
msgstr "Opció"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
msgid "&Replace with:"
msgstr "&Reemplaça amb:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
msgid "&Search for:"
msgstr "&Cerca:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
msgid "Direction"
msgstr "Direcció"
#: tfrmextractdlg.caption
msgctxt "tfrmextractdlg.caption"
msgid "Unpack files"
msgstr "Descomprimeix Fitxers"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Descomprimeix carpetes si es guardaren"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Descomprimeix cada fitxer en una carpeta &separada"
#: tfrmextractdlg.cboverwrite.caption
#, fuzzy
#| msgid "&Overwrite existing files"
msgid "O&verwrite existing files"
msgstr "&Sobreescriu Fitxers existents"
#: tfrmextractdlg.lblextractto.caption
#, fuzzy
#| msgid "To the directory:"
msgid "To the &directory:"
msgstr "A la carpeta:"
#: tfrmextractdlg.lblfilemask.caption
#, fuzzy
#| msgid "Extract files matching file mask:"
msgid "&Extract files matching file mask:"
msgstr "Extreu Fitxers:"
#: tfrmextractdlg.lblpassword.caption
#, fuzzy
#| msgid "Password for encrypted files:"
msgid "&Password for encrypted files:"
msgstr "Contrasenya:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Tanca"
#: tfrmfileexecuteyourself.caption
msgctxt "tfrmfileexecuteyourself.caption"
msgid "Wait..."
msgstr "Espereu..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Nom del fitxer:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "De:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "¡Clique a Tanca quan el fitxer temporal es pugui esborrar!"
#: tfrmfileop.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&Al panell"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Visualitza tot"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Operació actual"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "De:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Per:"
#: tfrmfileproperties.btnclose.caption
#, fuzzy
#| msgid "Close"
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Tanca"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "&Configura propietats"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Ajusta a tots els fitxers seleccionats"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Salta aquest fitxer"
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr "Propietats"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Enganxós"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Propietari"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grup"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Altres"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Propietari"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
#, fuzzy
#| msgid "Representation in text:"
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Text:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "tfrmfileproperties.lblcontains.caption"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Conté:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Executa"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Nom"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Nom"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Ruta:"
#: tfrmfileproperties.lblgroupstr.caption
#, fuzzy
#| msgid "Group"
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
msgid "&Group"
msgstr "Grup"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Últim accès:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Última modificació"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Últim canvi d'estat:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Octal"
#: tfrmfileproperties.lblownerstr.caption
#, fuzzy
#| msgid "Owner"
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
msgid "O&wner"
msgstr "Propietari"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lectura"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Mida:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
#, fuzzy
#| msgid "Symlink:"
msgid "Symlink to:"
msgstr "Enllaç simbòlic:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
#, fuzzy
msgid "Type:"
msgstr "Tipus:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Escriu"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Nom"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Valor"
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributs"
#: tfrmfileproperties.tsplugins.caption
#, fuzzy
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Complements"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Propietats"
#: tfrmfinddlg.actcancel.caption
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "Cancel·la"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "&Tanca"
#: tfrmfinddlg.actclose.caption
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "Tanca"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "Edita"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "Inclou a la llista"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Va al fitxer"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Cerca dades"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Última cerca"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Nova cerca"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr ""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr ""
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr ""
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr ""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr ""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "Inicia"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Visualització"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Afegeix"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "A&juda"
#: tfrmfinddlg.btnsavetemplate.caption
#, fuzzy
#| msgid "Save"
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "Desa"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Esborra"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "Carrega"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "Desa"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Desa amb \"Start in directory\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Si es desa amb \"Start in directory\" es restaurarà quan es carrega la plantilla. Feu-lo servir si voleu corregir la cerca a un determinat directori\""
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Usa plantilla"
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Cerca fitxers"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Sensible a majúscules"
#: tfrmfinddlg.cbdatefrom.caption
#, fuzzy
#| msgid "Date From:"
msgid "&Date from:"
msgstr "Data inicial:"
#: tfrmfinddlg.cbdateto.caption
#, fuzzy
#| msgid "Date To:"
msgid "Dat&e to:"
msgstr "Data final:"
#: tfrmfinddlg.cbfilesizefrom.caption
#, fuzzy
#| msgid "Size from:"
msgid "S&ize from:"
msgstr "Mida desde:"
#: tfrmfinddlg.cbfilesizeto.caption
#, fuzzy
#| msgid "Size to:"
msgid "Si&ze to:"
msgstr "Mida fins:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr ""
#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "Cerca &text en Fitxer"
#: tfrmfinddlg.cbfollowsymlinks.caption
#, fuzzy
#| msgid "Follow symlinks"
msgctxt "tfrmfinddlg.cbfollowsymlinks.caption"
msgid "Follow s&ymlinks"
msgstr "Seguir l'enllaç simbòlic"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "Cerca fitxers que NO continguin el text"
#: tfrmfinddlg.cbnotolderthan.caption
#, fuzzy
#| msgid "Not older than:"
msgid "N&ot older than:"
msgstr "No més de:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr ""
#: tfrmfinddlg.cbpartialnamesearch.caption
#, fuzzy
#| msgid "Search for part of file name "
msgid "Searc&h for part of file name"
msgstr "Cerca parts del nom del fitxer"
#: tfrmfinddlg.cbregexp.caption
#, fuzzy
#| msgid "&Regular expressions"
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "Expressions regulars"
#: tfrmfinddlg.cbreplacetext.caption
#, fuzzy
#| msgid "Re&place text"
msgid "Re&place by"
msgstr "Reemplaça text"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Carpetes i &fitxers seleccionats"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr ""
#: tfrmfinddlg.cbtimefrom.caption
#, fuzzy
#| msgid "Time from:"
msgid "&Time from:"
msgstr "&Hora inicial:"
#: tfrmfinddlg.cbtimeto.caption
#, fuzzy
#| msgid "Time to:"
msgid "Ti&me to:"
msgstr "Hora final:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "Usa complement de cerca:"
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Entreu el nom de les carpetes a excloure de la cerca separats per \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Entreu el nom dels fitxers a excloure de la cerca separats per \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Entreu el nom dels fitxers separats per \";\""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Carpetes"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Fitxers"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Cerca dades"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Atributs"
#: tfrmfinddlg.lblencoding.caption
#, fuzzy
#| msgid "Encoding:"
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
msgid "Encodin&g:"
msgstr "Codificació:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "Exclou carpetes"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Exclou fitxers"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "Màscara de fitxer"
#: tfrmfinddlg.lblfindpathstart.caption
#, fuzzy
#| msgid "&Start in directory"
msgid "Start in &directory"
msgstr "Comença a la &Carpeta"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Cerca subcarpetes:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "Cerques prèvies:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr ""
#: tfrmfinddlg.mioptions.caption
#, fuzzy
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Opcions"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Elimina de la lista"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.miseparator1.caption
msgctxt "tfrmfinddlg.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.miseparator2.caption
msgctxt "tfrmfinddlg.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Mostra Tots els ítems trobats"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr ""
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Mostra en el Visualitzador"
#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Visualització"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Avançat"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Carrega/Desa"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Complements"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Resultats"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Estàndar"
#: tfrmfindview.btnclose.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmfindview.btnfind.caption
#, fuzzy
#| msgid "Find"
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Cerca"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Cerca"
#: tfrmfindview.cbcasesens.caption
#, fuzzy
#| msgid "Case sensitive"
msgid "C&ase sensitive"
msgstr "Sensible majúscules/minúscules"
#: tfrmhardlink.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmhardlink.caption
#, fuzzy
#| msgid "Create hardlink"
msgid "Create hard link"
msgstr "Crea enllaç fort"
#: tfrmhardlink.lblexistingfile.caption
#, fuzzy
#| msgid "Destination that the link will point to"
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Ruta on s'enllaçarà"
#: tfrmhardlink.lbllinktocreate.caption
#, fuzzy
#| msgid "Link name"
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Nom de l'enllaç"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr ""
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr ""
#: tfrmhotdirexportimport.caption
msgctxt "tfrmhotdirexportimport.caption"
msgid "Select the entries your want to import"
msgstr ""
#: tfrmhotdirexportimport.lbhint.caption
msgctxt "tfrmhotdirexportimport.lbhint.caption"
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr ""
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr ""
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgctxt "tfrmlinker.caption"
msgid "Linker"
msgstr "Enllaçador"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Desa a..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Element"
#: tfrmlinker.lblfilename.caption
#, fuzzy
#| msgid "File name"
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "Nom &fitxer"
#: tfrmlinker.spbtndown.caption
#, fuzzy
#| msgid "Down"
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "Avall"
#: tfrmlinker.spbtndown.hint
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
msgid "Down"
msgstr "Avall"
#: tfrmlinker.spbtnrem.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "Elimina"
#: tfrmlinker.spbtnrem.hint
#, fuzzy
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "Esborra"
#: tfrmlinker.spbtnup.caption
#, fuzzy
#| msgid "Up"
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "Amunt"
#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Amunt"
#: tfrmmain.actabout.caption
#, fuzzy
#| msgid "About"
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
msgid "&About"
msgstr "Quant a"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Afegeix nom de fitxer a la linia d'ordres"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Afegeix ruta i nom de fitxer a la linia d'ordres"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Copia ruta a linia d'ordres"
#: tfrmmain.actbriefview.caption
#, fuzzy
#| msgid "Brief"
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr "Reduïda"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Visualització reduïda"
#: tfrmmain.actcalculatespace.caption
#, fuzzy
#| msgid "Calculate &Occupied Space..."
msgid "Calculate &Occupied Space"
msgstr "Calcula espai &ocupat"
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Canviar de Carpeta"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr ""
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Canvia a la carpeta superior"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Canvia a la carpeta arrel"
#: tfrmmain.actchecksumcalc.caption
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "Calcula suma de comprovació"
#: tfrmmain.actchecksumverify.caption
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "Verifica suma de comprovació"
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Esborra fitxer log"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Esborra finestra log"
#: tfrmmain.actclosealltabs.caption
#, fuzzy
#| msgid "Remove &All Tabs"
msgctxt "tfrmmain.actclosealltabs.caption"
msgid "Close &All Tabs"
msgstr "Tanca tot&es les pestanyes"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr ""
#: tfrmmain.actclosetab.caption
#, fuzzy
#| msgid "&Remove Tab"
msgctxt "tfrmmain.actclosetab.caption"
msgid "&Close Tab"
msgstr "Tanca &pestanya"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Següent línia d'ordres"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Estableix línia d'ordres per al proper comandament a historial"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Línia de comandament prèvia"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Establir línia d'ordres per al mandat previ a la història"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Completa"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr ""
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Compara per &continguts"
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr "Compara carpetes"
#: tfrmmain.actcomparedirectories.hint
msgctxt "tfrmmain.actcomparedirectories.hint"
msgid "Compare Directories"
msgstr "Compara carpetes"
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr ""
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr ""
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr ""
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr ""
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Mostra menú contextual"
#: tfrmmain.actcopy.caption
#, fuzzy
#| msgid "Copy"
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Copia"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr ""
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr ""
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Copia nom(s) de fitxer(s) amb ruta completa"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Copia nom(s) de fitxer(s) al portapapers"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Copia fitxers sense demanar confirmació"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr ""
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr ""
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Copia al mateix panel"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "Copia"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Mostra espai ocupat"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Retalla"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr ""
#: tfrmmain.actdelete.caption
#, fuzzy
#| msgid "Delete"
msgctxt "tfrmmain.actdelete.caption"
msgid "Delete"
msgstr "Esborra"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "Història de carpetes"
#: tfrmmain.actdirhotlist.caption
#, fuzzy
#| msgid "Directory &hotlist"
msgid "Directory &Hotlist"
msgstr "Marcadors"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr ""
#: tfrmmain.actedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Edita"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Edita comentari..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Edita nou Fitxer"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Edita camp de ruta sobre la llista de fitxers"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Intercanvia panells"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Surt"
#: tfrmmain.actextractfiles.caption
#, fuzzy
#| msgid "Extract files..."
msgid "&Extract Files..."
msgstr "&Extreu fitxers..."
#: tfrmmain.actfileassoc.caption
#, fuzzy
#| msgid "File &Associations..."
msgid "Configuration of File &Associations"
msgstr "Associacions de fitxers..."
#: tfrmmain.actfilelinker.caption
#, fuzzy
#| msgid "Link files"
msgid "Com&bine Files..."
msgstr "Com&bina fitxers..."
#: tfrmmain.actfileproperties.caption
#, fuzzy
#| msgid "Show file properties"
msgid "Show &File Properties"
msgstr "Mostra propietats"
#: tfrmmain.actfilespliter.caption
#, fuzzy
#| msgid "Split file"
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
msgid "Spl&it File..."
msgstr "Divideix fitxer..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr ""
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Enfocament de linia d'ordres"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Col·locar el cursor sobre el primer fitxer"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Col·locar el cursor sobre l'últim fitxer"
#: tfrmmain.acthardlink.caption
#, fuzzy
#| msgid "Create hard link..."
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
msgid "Create &Hard Link..."
msgstr "Crea enllaç &fort..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "Continguts"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "Panells en horitzontal"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "Teclat"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr ""
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr ""
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "esquerra &= dreta"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr ""
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Obre llista d'unitats a l'esquerra"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr ""
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr ""
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr ""
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr ""
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr ""
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr ""
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr ""
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr ""
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Carrega selecció del portapapers"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "Carrega se&lecció des de fitxer..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr ""
#: tfrmmain.actmakedir.caption
#, fuzzy
#| msgid "MakeDir"
msgid "Create &Directory"
msgstr "Crea Dir"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Selecciona amb la mateixa extensió"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
#, fuzzy
#| msgid "Invert Selections"
msgid "&Invert Selection"
msgstr "&Inverteix selecció"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "&Selecciona tot"
#: tfrmmain.actmarkminus.caption
#, fuzzy
#| msgid "Unselect a group"
msgid "Unselect a Gro&up..."
msgstr "Deselecciona gr&up..."
#: tfrmmain.actmarkplus.caption
#, fuzzy
#| msgid "Select a group"
msgid "Select a &Group..."
msgstr "Selecciona &grup..."
#: tfrmmain.actmarkunmarkall.caption
#, fuzzy
#| msgid "Unselect All"
msgid "&Unselect All"
msgstr "&Deselecciona tot"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimitzar finestra"
#: tfrmmain.actmultirename.caption
#, fuzzy
#| msgid "Multi Rename Tool"
msgid "Multi &Rename Tool"
msgstr "&Reanomenat múltiple"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "&Connectant xarxa..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "&Desconnectant xarxa..."
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Connexió &ràpida de xarxa..."
#: tfrmmain.actnewtab.caption
#, fuzzy
#| msgid "&New tab"
msgid "&New Tab"
msgstr "&Nova pestanya"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Canvia a la pestanya següen&t"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Obre"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Intenta obrir fitxer"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Obre fitxer de barra"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Obre carpeta a nova pestanya"
#: tfrmmain.actopenvirtualfilesystemlist.caption
#, fuzzy
#| msgid "Open VFS List"
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
msgid "Open &VFS List"
msgstr "Visualitza unitats de xarxa"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "&Visualitzador d'operacions"
#: tfrmmain.actoptions.caption
#, fuzzy
#| msgid "Options..."
msgid "&Options..."
msgstr "&Opcions..."
#: tfrmmain.actpackfiles.caption
#, fuzzy
#| msgid "Pack files..."
msgid "&Pack Files..."
msgstr "Comprimeix fitxers..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Fixar posició de separació"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "&Enganxa"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Canvia a la pestanya &prèvia"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Filtre ràpid"
#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Cerca ràpida"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "Panell de vista ràpida"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Actualitza"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrename.caption
#, fuzzy
#| msgid "Move"
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Mou"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Mou/Elimina sense confirmació"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Reanomena"
#: tfrmmain.actrenametab.caption
#, fuzzy
#| msgid "Re&name Tab"
msgid "&Rename Tab"
msgstr "Re&anomena pestanya"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Restaura selecció"
#: tfrmmain.actreverseorder.caption
#, fuzzy
#| msgid "Reverse order"
msgid "Re&verse Order"
msgstr "Ordre in&vers"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr ""
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr ""
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Dret &= Esquerra"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr ""
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Obre llista d'unitats a la dreta"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr ""
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr ""
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr ""
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr ""
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr ""
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr ""
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr ""
#: tfrmmain.actrunterm.caption
#, fuzzy
#| msgid "Run Term"
msgid "Run &Terminal"
msgstr "Terminal"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr ""
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Desa selecció"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Desa sel&ecció a fitxer..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr ""
#: tfrmmain.actsearch.caption
#, fuzzy
#| msgid "&Search"
msgid "&Search..."
msgstr "&Cerca"
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr ""
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr ""
#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "Canvia atributs..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Bloqueja carpetes obertes a pestanyes noves"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr ""
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "B&loqueja"
#: tfrmmain.actsettaboptionpathresets.caption
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
msgid "Locked with &Directory Changes Allowed"
msgstr "Bloqueja amb canvis de carpeta permesos"
#: tfrmmain.actshellexecute.caption
msgctxt "tfrmmain.actshellexecute.caption"
msgid "Open"
msgstr "Obre"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Obre usant les associacions del sistema"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Mostra menú de botons"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Mostra històrial de linia d'ordres"
#: tfrmmain.actshowmainmenu.caption
#, fuzzy
#| msgid "Menu"
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Menú"
#: tfrmmain.actshowsysfiles.caption
#, fuzzy
#| msgid "Show hidden/system files"
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "Mostra Ocults/sistema"
#: tfrmmain.actsortbyattr.caption
#, fuzzy
#| msgid "Sort by attrib"
msgid "Sort by &Attributes"
msgstr "Ordena per atributs"
#: tfrmmain.actsortbydate.caption
#, fuzzy
#| msgid "Sort by date"
msgid "Sort by &Date"
msgstr "Or&dena per data"
#: tfrmmain.actsortbyext.caption
#, fuzzy
#| msgid "Sort by extension"
msgid "Sort by &Extension"
msgstr "Ordena per extensió"
#: tfrmmain.actsortbyname.caption
#, fuzzy
#| msgid "Sort by name"
msgid "Sort by &Name"
msgstr "Ordena per nom"
#: tfrmmain.actsortbysize.caption
#, fuzzy
#| msgid "Sort by size"
msgid "Sort by &Size"
msgstr "Ordena per mida"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr ""
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Habilita/deshabilita ignorar llista per no mostrar noms de Fitxer"
#: tfrmmain.actsymlink.caption
#, fuzzy
#| msgid "Create symbolic link..."
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "Crea e&nlaç simbòlic..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr ""
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Destinació = Origen"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Comprova fitxer(s)"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Miniatures"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Visualització en miniatures"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr ""
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Carpeta sota el cursor a l'esquerra"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Carpeta sota el cursor a la dreta"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr ""
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr ""
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Deselecciona tot amb la mateixa extensió"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
#, fuzzy
#| msgid "View"
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Visualització"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Mostra hstòria de las direccions visitades per vista activa"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Va a l'entrada següent"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Va a la entrada prèvia"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr ""
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "Visita el lloc web de Double Commander"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Destrueix"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr ""
#: tfrmmain.btnf10.caption
#, fuzzy
#| msgid "Exit"
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Surt"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Carpeta"
#: tfrmmain.btnf8.caption
#, fuzzy
#| msgid "Delete"
msgctxt "tfrmmain.btnf8.caption"
msgid "Delete"
msgstr "Esborra"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr ""
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Carpetes freqüents"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr ""
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Mostra carpeta actual del panell dret al esquerra"
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Va a la carpeta d'usuari"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Va a la carpeta arrel"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Va a la carpeta superior"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
#, fuzzy
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Carpetes freqüents"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ""
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Mostra la carpeta actual del panell esquerra al dret"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "tfrmmain.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Ruta"
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr ""
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr ""
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr ""
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr ""
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr ""
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr ""
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr ""
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Cancel·la"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Copia..."
#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Crea enllaç"
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline10.caption
msgctxt "tfrmmain.miline10.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline11.caption
msgctxt "tfrmmain.miline11.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline21.caption
msgctxt "tfrmmain.miline21.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline23.caption
msgctxt "tfrmmain.miline23.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline26.caption
msgctxt "tfrmmain.miline26.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline33.caption
msgctxt "tfrmmain.miline33.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline37.caption
msgctxt "tfrmmain.miline37.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline38.caption
msgctxt "tfrmmain.miline38.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline39.caption
msgctxt "tfrmmain.miline39.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline40.caption
msgctxt "tfrmmain.miline40.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline50.caption
msgctxt "tfrmmain.miline50.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline55.caption
msgctxt "tfrmmain.miline55.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Neteja"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Copia"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "oculta"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Selecciona tot"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Mou..."
#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Crea enllaç Simbòlic"
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Opcions de pestanya"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Surt"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Restaura"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr ""
#: tfrmmain.mnualloperstart.caption
msgctxt "tfrmmain.mnualloperstart.caption"
msgid "Start"
msgstr "Inicia"
#: tfrmmain.mnualloperstop.caption
msgctxt "tfrmmain.mnualloperstop.caption"
msgid "Cancel"
msgstr "Cancel·la"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Ordres"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "C&onfiguració"
#: tfrmmain.mnucontextline1.caption
msgctxt "tfrmmain.mnucontextline1.caption"
msgid "-"
msgstr "-"
#: tfrmmain.mnucontextline2.caption
msgctxt "tfrmmain.mnucontextline2.caption"
msgid "-"
msgstr "-"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr ""
#: tfrmmain.mnufiles.caption
#, fuzzy
#| msgid "Files"
msgid "&Files"
msgstr "&Fitxers"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "A&juda"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Selecció"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Xarxa"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Visualització"
#: tfrmmain.mnutaboptions.caption
#, fuzzy
#| msgid "&Options"
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "Opcions"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Pestanyes"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr ""
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Copia"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Retalla"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Esborra"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Edita"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Enganxa"
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmaincommandsdlg.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmmaincommandsdlg.btnok.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&Accepta"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr ""
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr ""
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr ""
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr ""
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr ""
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr ""
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr ""
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Tecles ràpides"
#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Afegeix"
#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "A&juda"
#: tfrmmaskinputdlg.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmmaskinputdlg.btndefinetemplate.caption
#, fuzzy
#| msgid "Define..."
msgid "&Define..."
msgstr "Defineix..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Sensibilitat a Majúscules"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Màscara d'entrada:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
#, fuzzy
#| msgid "Or select predefined selection type:"
msgid "O&r select predefined selection type:"
msgstr "O escull tipus de selecció predefinida:"
#: tfrmmkdir.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Crea nova carpeta"
#: tfrmmkdir.lblmakedir.caption
#, fuzzy
#| msgid "Input new directory name:"
msgid "&Input new directory name:"
msgstr "Nom de la nova carpeta:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr "Nova Mida"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Alt :"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr ""
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr ""
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr ""
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr ""
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Qualitat de compresió jpg"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Ample:"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr ""
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr ""
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr ""
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr ""
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr ""
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Alt"
#: tfrmmodview.tequality.text
msgid "80"
msgstr ""
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Ample"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Tanca"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Esborra"
#: tfrmmultirename.btnedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "Edita"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "Carrega"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Reanomena"
#: tfrmmultirename.btnrestore.caption
#, fuzzy
#| msgid "Reset all"
msgid "Reset &all"
msgstr "Restaura"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Desa"
#: tfrmmultirename.caption
msgctxt "tfrmmultirename.caption"
msgid "MultiRename"
msgstr "Reanomenat múltiple"
#: tfrmmultirename.cblog.caption
#, fuzzy
#| msgid "Enable"
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "Permet"
#: tfrmmultirename.cbregexp.caption
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "Expressions regulars"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "Usa substitució"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
#, fuzzy
#| msgid "[E]xtension"
msgid "[E] Extension"
msgstr "[E]xtensió"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Comptador"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Cerca i Reemplaçar"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Registre de resultat"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Màscara"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Configuració"
#: tfrmmultirename.lbext.caption
#, fuzzy
#| msgid "Extension"
msgid "&Extension"
msgstr "Extensió"
#: tfrmmultirename.lbfind.caption
#, fuzzy
#| msgid "Find..."
msgid "&Find..."
msgstr "Cerca..."
#: tfrmmultirename.lbinterval.caption
#, fuzzy
#| msgid "Interval"
msgid "&Interval"
msgstr "Interval"
#: tfrmmultirename.lbname.caption
#, fuzzy
#| msgid "File Name"
msgid "File &Name"
msgstr "Nom"
#: tfrmmultirename.lbreplace.caption
#, fuzzy
#| msgid "Replace..."
msgid "Re&place..."
msgstr "Reemplaça..."
#: tfrmmultirename.lbstnb.caption
#, fuzzy
#| msgid "Start Number"
msgid "S&tart Number"
msgstr "Número inicial"
#: tfrmmultirename.lbwidth.caption
#, fuzzy
#| msgid "Width"
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "Amplada"
#: tfrmmultirename.micounter.caption
#, fuzzy
#| msgid "[C]ounter"
msgid "[C] Counter"
msgstr "[C]omptador"
#: tfrmmultirename.miday.caption
#, fuzzy
#| msgid "[D]ay"
msgid "[D] Day"
msgstr "[D] Dia"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr ""
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr ""
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr ""
#: tfrmmultirename.miextensionx.caption
#, fuzzy
#| msgid "[Ex]xtension"
msgid "[Ex] Character at position x"
msgstr "[Ex]xtensió"
#: tfrmmultirename.miextensionxx.caption
#, fuzzy
#| msgid "[Ex:x]xtension"
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:x]xtensió"
#: tfrmmultirename.mihour.caption
#, fuzzy
#| msgid "[h]our"
msgid "[h] Hour"
msgstr "[H] Hora"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr ""
#: tfrmmultirename.miminute.caption
#, fuzzy
#| msgid "Mi[n]ute"
msgid "[n] Minute"
msgstr "[Mi]nut"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr ""
#: tfrmmultirename.mimonth.caption
#, fuzzy
#| msgid "[M]onth"
msgid "[M] Month"
msgstr "[Mo]->Mes"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Mes (2 digits)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Nom del mes (abreujat, e.g., \"jan\")"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Nom del mes (llarg, e.g., \"january\")"
#: tfrmmultirename.miname.caption
#, fuzzy
#| msgid "[N]ame"
msgid "[N] Name"
msgstr "[N]om"
#: tfrmmultirename.minamex.caption
#, fuzzy
#| msgid "[Nx]ame"
msgid "[Nx] Character at position x"
msgstr "[Nx]om"
#: tfrmmultirename.minamexx.caption
#, fuzzy
#| msgid "[Nx:x]ame"
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:x]om"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Hora..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Extensió..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Nom..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Complement"
#: tfrmmultirename.misecond.caption
#, fuzzy
#| msgid "[s]econd"
msgid "[s] Second"
msgstr "[S]egon"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr ""
#: tfrmmultirename.miyear.caption
#, fuzzy
#| msgid "[Y] Year"
msgid "[Y] Year (2 digits)"
msgstr "[Y]->Any"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Any (4 dígits)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr ""
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr ""
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
msgid "Old File Name"
msgstr "Nom antic"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
msgid "New File Name"
msgstr "Nou nom de fitxer"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
msgid "File Path"
msgstr "Ruta"
#: tfrmmultirenamewait.caption
#, fuzzy
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Escull aplicació"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Personalitza comandament"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Desa associació"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Estableix aplicació seleccionada com a acció per defecte"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Tipus de fitxer a obrir: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Noms de fitxers múltiples"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr ""
#: tfrmopenwith.milistofurls.caption
#, fuzzy
#| msgid "Múltiple URIs"
msgid "Multiple URIs"
msgstr "Múltiples URIs"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr ""
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Nom de fitxer simple"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr ""
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "Simple URI"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr ""
#: tfrmoptions.btnapply.caption
#, fuzzy
#| msgid "Apply"
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
msgid "&Apply"
msgstr "Aplica"
#: tfrmoptions.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Opcions"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Seleccioneu si us plau una de les subpàgines. Aquesta no conté paràmetres configurables"
#: tfrmoptionsarchivers.btnautoconfig.caption
#, fuzzy
#| msgid "Auto Configure"
msgctxt "tfrmoptionsarchivers.btnautoconfig.caption"
msgid "A&uto Configure"
msgstr "Configuració automàtica"
#: tfrmoptionsarchivers.btnmultiarcadd.caption
#, fuzzy
#| msgid "Add"
msgctxt "tfrmoptionsarchivers.btnmultiarcadd.caption"
msgid "A&dd"
msgstr "Afegeix"
#: tfrmoptionsarchivers.btnmultiarcapply.caption
#, fuzzy
#| msgid "Apply"
msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption"
msgid "A&pply"
msgstr "Aplica"
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
#, fuzzy
#| msgid "Delete"
msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption"
msgid "D&elete"
msgstr "Esborra"
#: tfrmoptionsarchivers.btnmultiarcrename.caption
#, fuzzy
#| msgid "Rename"
msgctxt "tfrmoptionsarchivers.btnmultiarcrename.caption"
msgid "&Rename"
msgstr "Reanomena"
#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
#, fuzzy
#| msgid "Debug mode"
msgctxt "tfrmoptionsarchivers.chkmultiarcdebug.caption"
msgid "De&bug mode"
msgstr "Mode de depuració"
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
#, fuzzy
#| msgid "Enabled"
msgctxt "tfrmoptionsarchivers.chkmultiarcenabled.caption"
msgid "E&nabled"
msgstr "Habilita"
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
#, fuzzy
#| msgid "Show console output"
msgctxt "tfrmoptionsarchivers.chkmultiarcoutput.caption"
msgid "S&how console output"
msgstr "Mostra sortida de consola"
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "tfrmoptionsarchivers.gbarchiveroptions.caption"
msgid "Options"
msgstr "Opcions"
#: tfrmoptionsarchivers.lblarchiveadd.caption
#, fuzzy
#| msgid "Add:"
msgctxt "tfrmoptionsarchivers.lblarchiveadd.caption"
msgid "Add&ing:"
msgstr "Afegeix:"
#: tfrmoptionsarchivers.lblarchiveextension.caption
#, fuzzy
#| msgid "Extension:"
msgctxt "tfrmoptionsarchivers.lblarchiveextension.caption"
msgid "E&xtension:"
msgstr "Extensió:"
#: tfrmoptionsarchivers.lblarchiveextract.caption
#, fuzzy
#| msgid "Extract:"
msgctxt "tfrmoptionsarchivers.lblarchiveextract.caption"
msgid "Ex&tract:"
msgstr "Extreu:"
#: tfrmoptionsarchivers.lblarchivelist.caption
#, fuzzy
#| msgid "List:"
msgctxt "tfrmoptionsarchivers.lblarchivelist.caption"
msgid "&List:"
msgstr "Llista:"
#: tfrmoptionsarchivers.lblarchivelistend.caption
#, fuzzy
#| msgid "Listing finish (optional):"
msgctxt "tfrmoptionsarchivers.lblarchivelistend.caption"
msgid "Listing &finish (optional):"
msgstr "Acaba llistat (opcional):"
#: tfrmoptionsarchivers.lblarchivelistformat.caption
#, fuzzy
#| msgid "Listing format:"
msgctxt "tfrmoptionsarchivers.lblarchivelistformat.caption"
msgid "Listing for&mat:"
msgstr "Format de llistat:"
#: tfrmoptionsarchivers.lblarchiveliststart.caption
#, fuzzy
#| msgid "Listing start (optional):"
msgctxt "tfrmoptionsarchivers.lblarchiveliststart.caption"
msgid "Listin&g start (optional):"
msgstr "Inicia llistat (opcional):"
#: tfrmoptionsarchivers.lblarchiver.caption
#, fuzzy
#| msgid "Archiver:"
msgctxt "tfrmoptionsarchivers.lblarchiver.caption"
msgid "Arc&hiver:"
msgstr "Arxivador:"
#: tfrmoptionsarchivers.lbldescription.caption
#, fuzzy
#| msgid "Description:"
msgctxt "tfrmoptionsarchivers.lbldescription.caption"
msgid "De&scription:"
msgstr "Descripció:"
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "tfrmoptionsarchivers.tbarchiveradditional.caption"
msgid "Additional"
msgstr "Addicional"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr "General"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgctxt "tfrmoptionsautorefresh.cbwatchattributeschange.caption"
msgid "When &size, date or attributes change"
msgstr "Quan canvia la mida, la data o els atributs"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "Per les rutes següents i les seves subcarpetes:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
#, fuzzy
#| msgid "When files are &created, deleted or renamed"
msgctxt "tfrmoptionsautorefresh.cbwatchfilenamechange.caption"
msgid "When &files are created, deleted or renamed"
msgstr "Quan es creen fitxers, s'esborren o es reanomenen"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgctxt "tfrmoptionsautorefresh.cbwatchonlyforeground.caption"
msgid "When application is in the &background"
msgstr "Quan l'aplicació està en segon pla"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgctxt "tfrmoptionsautorefresh.gbautorefreshdisable.caption"
msgid "Disable auto-refresh"
msgstr "Deshabilita actualizació automàtica"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgctxt "tfrmoptionsautorefresh.gbautorefreshenable.caption"
msgid "Refresh file list"
msgstr "Actualitza la lista de fitxers"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
#, fuzzy
#| msgid "Always show tray icon"
msgctxt "tfrmoptionsbehavior.cbalwaysshowtrayicon.caption"
msgid "Al&ways show tray icon"
msgstr "Mostra sempre icona de la safata"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "&Oculta automàticament unitats no carregades"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "tfrmoptionsbehavior.cbminimizetotray.caption"
msgid "Mo&ve icon to system tray when minimized"
msgstr "Mou la icona a la safata del sistema quan es minimitza"
#: tfrmoptionsbehavior.cbonlyonce.caption
#, fuzzy
#| msgid "Allow only one copy of DC at a time"
msgctxt "tfrmoptionsbehavior.cbonlyonce.caption"
msgid "A&llow only one copy of DC at a time"
msgstr "Només una còpia de Double Commander oberta"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Aquí podeu introduir una o més unitats o punts de muntatge, separats per \";\"."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Llista &negra d'unitats"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr ""
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr ""
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr ""
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr ""
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr ""
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
#, fuzzy
#| msgid "Cut text to column width"
msgctxt "tfrmoptionscolumnsview.cbcuttexttocolwidth.caption"
msgid "Cut &text to column width"
msgstr "Ajusta text a l'amplada de columna"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
#, fuzzy
#| msgid "Horizontal lines"
msgctxt "tfrmoptionscolumnsview.cbgridhorzline.caption"
msgid "&Horizontal lines"
msgstr "Línies horitzontals"
#: tfrmoptionscolumnsview.cbgridvertline.caption
#, fuzzy
#| msgid "Vertical lines"
msgctxt "tfrmoptionscolumnsview.cbgridvertline.caption"
msgid "&Vertical lines"
msgstr "Línies verticals"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
#, fuzzy
#| msgid "Auto fill columns"
msgctxt "tfrmoptionscolumnsview.chkautofillcolumns.caption"
msgid "A&uto fill columns"
msgstr "Omple automàticament les columnes"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Mostra la graella"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Mida automàtica de les columnes"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
#, fuzzy
#| msgid "Auto size column:"
msgctxt "tfrmoptionscolumnsview.lblautosizecolumn.caption"
msgid "Auto si&ze column:"
msgstr "Mida automàtica de columna:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
#, fuzzy
#| msgid "Apply"
msgctxt "tfrmoptionsconfiguration.btnconfigapply.caption"
msgid "A&pply"
msgstr "Aplica"
#: tfrmoptionsconfiguration.btnconfigedit.caption
#, fuzzy
#| msgid "Edit"
msgctxt "tfrmoptionsconfiguration.btnconfigedit.caption"
msgid "&Edit"
msgstr "Edita"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
#, fuzzy
#| msgid "Command line history"
msgctxt "tfrmoptionsconfiguration.cbcmdlinehistory.caption"
msgid "Co&mmand line history"
msgstr "Historial d'ordres"
#: tfrmoptionsconfiguration.cbdirhistory.caption
#, fuzzy
#| msgid "Directory history"
msgctxt "tfrmoptionsconfiguration.cbdirhistory.caption"
msgid "&Directory history"
msgstr "Historial de carpetes"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
#, fuzzy
#| msgid "File mask history"
msgctxt "tfrmoptionsconfiguration.cbfilemaskhistory.caption"
msgid "&File mask history"
msgstr "Historial de màscares"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
#, fuzzy
#| msgid "Save configuration"
msgctxt "tfrmoptionsconfiguration.chksaveconfiguration.caption"
msgid "Sa&ve configuration"
msgstr "Desa configuració"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
#, fuzzy
#| msgid "Search/Replace history"
msgctxt "tfrmoptionsconfiguration.chksearchreplacehistory.caption"
msgid "Searc&h/Replace history"
msgstr "Història de Cerca/Reemplaçar"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Carpetes"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgctxt "tfrmoptionsconfiguration.gblocconfigfiles.caption"
msgid "Location of configuration files"
msgstr "Situació dels fitxers de configuració"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgctxt "tfrmoptionsconfiguration.gbsaveonexit.caption"
msgid "Save on exit"
msgstr "Desa en Sortir"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgctxt "tfrmoptionsconfiguration.lblcmdlineconfigdir.caption"
msgid "Set on command line"
msgstr "Defineix linia d'ordres"
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
#, fuzzy
#| msgid "Program directory (portable version)"
msgctxt "tfrmoptionsconfiguration.rbprogramdir.caption"
msgid "P&rogram directory (portable version)"
msgstr "Carpeta del programa (versió portable)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
#, fuzzy
#| msgid "User home directory"
msgctxt "tfrmoptionsconfiguration.rbuserhomedir.caption"
msgid "&User home directory"
msgstr "Carpeta d'usuari"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Tot"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "&Esborra"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr ""
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Nou"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr ""
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr ""
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Reanomena"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Anomena i desa"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "Desa"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Permet sobreexposició"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr ""
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "General"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
#, fuzzy
#| msgid "Cursor Límitr"
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Límit del cursor"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr ""
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr ""
#: tfrmoptionscustomcolumns.lblbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "Fons:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Fons 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
#, fuzzy
#| msgid "Con&figure columns for file system:"
msgctxt "tfrmoptionscustomcolumns.lblconfigcolumns.caption"
msgid "Con&figure columns view:"
msgstr "Configura columnes per a sistema de fitxers:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr ""
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "Color de cursor:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Text de cursor:"
#: tfrmoptionscustomcolumns.lblfontname.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Font:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Mida:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "Color de text:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "Color de la selecció:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr ""
#: tfrmoptionscustomcolumns.miaddcolumn.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Afegeix columna"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "A&juda"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
msgid "Some functions to select appropriate target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
msgid "Name, a-z"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr ""
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
msgid "Name:"
msgstr "Nom:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
msgid "Path:"
msgstr "Ruta:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
msgid "&Target:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to &configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr ""
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr ""
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Demana confirmació després de deixar anar"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr ""
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr ""
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Mostra fitxers del sistema"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Mostra espai lliure"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Mostra etiqueta"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Llista d'unitats"
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Segon pla"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
msgid "Bac&kground"
msgstr "Segon pla"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr ""
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
msgid "Save"
msgstr "Desa"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Atributs d'element"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Primer pla"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
msgid "Fo&reground"
msgstr "Primer pla"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "Marca de text"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr ""
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Usa configuració d'esquema local"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "Negreta"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
msgid "In&vert"
msgstr "Inverteix"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "Cursiva"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
msgid "In&vert"
msgstr "Inverteix"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "Treu barrat"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
msgid "In&vert"
msgstr "Inverteix"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "Subratllat"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "Inverteix"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr ""
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr ""
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr ""
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr ""
#: tfrmoptionsfavoritetabs.btnrename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Reanomena"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr ""
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr ""
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "No"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr ""
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr ""
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsfavoritetabs.micutselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Retalla"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr ""
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsfavoritetabs.mipasteselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Enganxa"
#: tfrmoptionsfavoritetabs.mirename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Reanomena"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr ""
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Afegeix"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "&Add"
msgstr "Afegeix"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
#, fuzzy
#| msgid "Add"
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "Afegeix"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr ""
#: tfrmoptionsfileassoc.btndownact.caption
#, fuzzy
#| msgid "Down"
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "&Down"
msgstr "Avall"
#: tfrmoptionsfileassoc.btneditext.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edit"
msgstr "Edita"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btnremoveact.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
msgid "Remo&ve"
msgstr "Elimina"
#: tfrmoptionsfileassoc.btnremoveext.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
msgid "Re&move"
msgstr "Elimina"
#: tfrmoptionsfileassoc.btnremovetype.caption
#, fuzzy
#| msgid "Remove"
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "Elimina"
#: tfrmoptionsfileassoc.btnrenametype.caption
#, fuzzy
#| msgid "Rename"
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "Reanomena"
#: tfrmoptionsfileassoc.btnupact.caption
#, fuzzy
#| msgid "Up"
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "Amunt"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr ""
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr ""
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Accions"
#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
msgid "Extensions"
msgstr "Extensions"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Tipus de Fitxer"
#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
msgid "Icon"
msgstr "Icona"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lblaction.caption
#, fuzzy
#| msgid "Action:"
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
msgid "Action name:"
msgstr "Acció:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "&Command:"
msgstr "&Comandament:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Paràmetres"
#: tfrmoptionsfileassoc.lblstartpath.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Ruta d'inici"
#: tfrmoptionsfileassoc.menuitem1.caption
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr ""
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr ""
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Edita"
#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
msgid "Open in Editor"
msgstr "Obre amb l'Editor"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr ""
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
msgid "Get output from command"
msgstr "Obtenir sortida de comandament"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr ""
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr ""
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Obre"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr ""
#: tfrmoptionsfileassoc.miseparator.caption
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgctxt "tfrmoptionsfileassoc.mishell.caption"
msgid "Run in terminal"
msgstr "Executa en el terminal"
#: tfrmoptionsfileassoc.miview.caption
#, fuzzy
#| msgid "View"
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Visualització"
#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
msgid "Open in Viewer"
msgstr "Obre en el Visualitzador"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr ""
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr ""
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr ""
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr ""
#: tfrmoptionsfileoperations.bvlconfirmations.caption
#, fuzzy
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr "Mostra finestra de confirmació per a..."
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Operació de còpia"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Operació d'esborrament"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
#, fuzzy
#| msgid "Delete to recycle bin (Shift key reverses this setting)"
msgctxt "tfrmoptionsfileoperations.cbdeletetotrash.caption"
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "S'envia a la paperera (la tecla majúscula inverteix aquesta selecció)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Esborra l'operació a la paperera"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
#, fuzzy
#| msgid "Drop readonly flag"
msgctxt "tfrmoptionsfileoperations.cbdropreadonlyflag.caption"
msgid "D&rop readonly flag"
msgstr "Treure marca de només lectura"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "&Operació de moviment"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
#, fuzzy
#| msgid "Process comments with files/folders"
msgctxt "tfrmoptionsfileoperations.cbprocesscomments.caption"
msgid "&Process comments with files/folders"
msgstr "Processar comentaris amb Fitxers/carpetes"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr ""
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
#, fuzzy
#| msgid "Show tab select panel in copy/move dialog"
msgctxt "tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption"
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Mostra la pestanya del panell seleccionat en el diàleg de Copia/Mou"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
#, fuzzy
#| msgid "Skip file operations errors and write them to log window"
msgctxt "tfrmoptionsfileoperations.cbskipfileoperror.caption"
msgid "S&kip file operations errors and write them to log window"
msgstr "Omet errors d'operació amb Fitxers i els escriu en una finestra de registre"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Executant operacions"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Interfície d'usuari"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "Tamany de &buffer per a fitxer d'operacions (en KB)"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Mostra progrés d'operacions inicialment en"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr ""
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "&Número de passos de neteja"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnindbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnindcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr ""
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Permet sobreexposició"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
#, fuzzy
#| msgid "Use Frame Cursor"
msgctxt "tfrmoptionsfilepanelscolors.cbbuseframecursor.caption"
msgid "Use &Frame Cursor"
msgstr "Usa cursor emmarcat"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Usa indicador de gradació"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
#, fuzzy
#| msgid "Use Inverted Selection"
msgctxt "tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption"
msgid "U&se Inverted Selection"
msgstr "Usar selecció invertida"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
#, fuzzy
#| msgid "Cursor Límitr"
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Límit del cursor"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr "Indicador de l'espai lliure de la unitat"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "Fons"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
#, fuzzy
#| msgid "Background 2:"
msgctxt "tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption"
msgid "Backg&round 2:"
msgstr "Fons 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
#, fuzzy
#| msgid "Cursor Color:"
msgctxt "tfrmoptionsfilepanelscolors.lblcursorcolor.caption"
msgid "C&ursor Color:"
msgstr "Color de cursor:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
#, fuzzy
#| msgid "Cursor Text:"
msgctxt "tfrmoptionsfilepanelscolors.lblcursortext.caption"
msgid "Cursor Te&xt:"
msgstr "Text de cursor:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
#, fuzzy
#| msgid "Brightness level of inactive panel"
msgctxt "tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption"
msgid "&Brightness level of inactive panel"
msgstr "Nivell de brillantor del panell inactiu"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Indicador de color de fons"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Indica color de primer pla"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
#, fuzzy
#| msgid "Mark Color:"
msgctxt "tfrmoptionsfilepanelscolors.lblmarkcolor.caption"
msgid "&Mark Color:"
msgstr "Color de la selecció:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
#, fuzzy
#| msgid "Text Color:"
msgctxt "tfrmoptionsfilepanelscolors.lbltextcolor.caption"
msgid "T&ext Color:"
msgstr "Color de text:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "Cerca part del nom del fitxer"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr ""
#: tfrmoptionsfilesearch.gbfilesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Cerca de fitxers"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr ""
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Usa mapatge en memòria per a cerca de text en fitxers"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "Usa disc per a cerca de text en fitxers"
#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "Afegeix"
#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "A&juda"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "No carrega la llista de fitxers fins que s'activi la pestanya"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
#, fuzzy
#| msgid "Show square brackets around directories"
msgctxt "tfrmoptionsfilesviews.cbdirbrackets.caption"
msgid "S&how square brackets around directories"
msgstr "Mostra claudàtors quadrats per a les carpetes"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Realça fitxers nous i actualitzats"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr ""
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
#, fuzzy
#| msgid "Load file list in separate thread"
msgctxt "tfrmoptionsfilesviews.cblistfilesinthread.caption"
msgid "Load &file list in separate thread"
msgstr "Carrega llista de fitxers en procesos separats"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
#, fuzzy
#| msgid "Load icons after file list"
msgctxt "tfrmoptionsfilesviews.cbloadiconsseparately.caption"
msgid "Load icons af&ter file list"
msgstr "Carrega les icones després de la llista de fitxers"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
#, fuzzy
#| msgid "Show system and hidden files"
msgctxt "tfrmoptionsfilesviews.cbshowsystemfiles.caption"
msgid "Show s&ystem and hidden files"
msgstr "Mostra fitxers Ocults/sistema"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
#, fuzzy
#| msgid "When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgctxt "tfrmoptionsfilesviews.cbspacemovesdown.caption"
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Quan es seleccioni Fitxers amb la barra d'espai, pasar al següent Fitxer (com amb <INSERT>)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formatant"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgctxt "tfrmoptionsfilesviews.gbsorting.caption"
msgid "Sorting"
msgstr "Ordenant"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Sensibilitat a les Majúscules:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Format incorrecte"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
#, fuzzy
#| msgid "Date and time format:"
msgctxt "tfrmoptionsfilesviews.lbldatetimeformat.caption"
msgid "&Date and time format:"
msgstr "Format de data i hora:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Format de mida de fitxer:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "Insereix nou fitxer:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Ordena carpetes:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
#, fuzzy
#| msgid "Sort &method:"
msgctxt "tfrmoptionsfilesviews.lblsortmethod.caption"
msgid "&Sort method:"
msgstr "Mètode d'ordenament:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "Mou fitxers actualitzats:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
#, fuzzy
#| msgid "Add"
msgctxt "tfrmoptionsfiletypescolors.btnaddcategory.caption"
msgid "A&dd"
msgstr "Afegeix"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
#, fuzzy
#| msgid "Apply"
msgctxt "tfrmoptionsfiletypescolors.btnapplycategory.caption"
msgid "A&pply"
msgstr "Aplica"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "tfrmoptionsfiletypescolors.btncategorycolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
#, fuzzy
#| msgid "Delete"
msgctxt "tfrmoptionsfiletypescolors.btndeletecategory.caption"
msgid "D&elete"
msgstr "Esborra"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
msgid "Template..."
msgstr "Plantilla..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Tipus de colors de fitxers (Ordena amb drag&&drop)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
#, fuzzy
#| msgid "Category attributes:"
msgctxt "tfrmoptionsfiletypescolors.lblcategoryattr.caption"
msgid "Category a&ttributes:"
msgstr "Atributs de la categoria:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
#, fuzzy
#| msgid "Category color:"
msgctxt "tfrmoptionsfiletypescolors.lblcategorycolor.caption"
msgid "Category co&lor:"
msgstr "Color de la categoria:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
#, fuzzy
#| msgid "Category mask:"
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
msgid "Category &mask:"
msgstr "Màscara de la categoria:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
#, fuzzy
#| msgid "Category name:"
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr "Nom de la categoria:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "tfrmoptionsfonts.btnseleditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "tfrmoptionsfonts.btnsellogfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "tfrmoptionsfonts.btnselmainfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "tfrmoptionsfonts.btnselviewerbookfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "tfrmoptionsfonts.btnselviewfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr ""
#: tfrmoptionsfonts.lbleditorfont.caption
#, fuzzy
#| msgid "Editor font"
msgctxt "tfrmoptionsfonts.lbleditorfont.caption"
msgid "&Editor font"
msgstr "Font de l'Editor"
#: tfrmoptionsfonts.lbllogfont.caption
#, fuzzy
#| msgid "Log font"
msgctxt "tfrmoptionsfonts.lbllogfont.caption"
msgid "&Log font"
msgstr "Font de Registre"
#: tfrmoptionsfonts.lblmainfont.caption
#, fuzzy
#| msgid "Main font"
msgctxt "tfrmoptionsfonts.lblmainfont.caption"
msgid "Main &font"
msgstr "Font Principal"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr ""
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr ""
#: tfrmoptionsfonts.lblviewerbookfont.caption
#, fuzzy
#| msgid "Viewer Book Font"
msgctxt "tfrmoptionsfonts.lblviewerbookfont.caption"
msgid "Viewer&Book Font"
msgstr "Font de Vista de Llibre"
#: tfrmoptionsfonts.lblviewerfont.caption
#, fuzzy
#| msgid "Viewer font"
msgctxt "tfrmoptionsfonts.lblviewerfont.caption"
msgid "&Viewer font"
msgstr "Font de Visualització"
#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Afegeis drecera"
#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Copia"
#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Esborra"
#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "Esborra drecera"
#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "Edita drecera"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Reanomena"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
#, fuzzy
#| msgid "Filter"
msgctxt "tfrmoptionshotkeys.lbfilter.caption"
msgid "&Filter"
msgstr "Filtre"
#: tfrmoptionshotkeys.lblcategories.caption
#, fuzzy
#| msgid "Categories:"
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
msgid "C&ategories:"
msgstr "Categories:"
#: tfrmoptionshotkeys.lblcommands.caption
#, fuzzy
#| msgid "Commands:"
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
msgid "Co&mmands:"
msgstr "Ordres:"
#: tfrmoptionshotkeys.lblscfiles.caption
#, fuzzy
#| msgid "Shortcut files:"
msgctxt "tfrmoptionshotkeys.lblscfiles.caption"
msgid "&Shortcut files:"
msgstr "Fitxers d'acció ràpida:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Comandament"
#: tfrmoptionshotkeys.miseparator1.caption
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Per les rutes següents i les seves subcarpetes:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Mostra icones per a accions als menús"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
#, fuzzy
#| msgid "Show overlay i&cons, e.g. for links"
msgctxt "tfrmoptionsicons.cbiconsshowoverlay.caption"
msgid "Show o&verlay icons, e.g. for links"
msgstr "Mostra icones superposades. Exemple: per enllaços"
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Desactiva icones especials"
#: tfrmoptionsicons.gbiconssize.caption
#, fuzzy
#| msgid " Icon &size "
msgctxt "tfrmoptionsicons.gbiconssize.caption"
msgid " Icon size "
msgstr "Mida d'Icona"
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "tfrmoptionsicons.gbshowiconsmode.caption"
msgid " Show icons to the left of the filename "
msgstr " Mostra icones a l'esquerra del nom"
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
#, fuzzy
#| msgid "&All"
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
msgid "A&ll"
msgstr "&Tot"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "tfrmoptionsicons.rbiconsshowallandexe.caption"
msgid "All associated + &EXE/LNK (slow)"
msgstr "Totes les associacions + &EXE/LNK (lent)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "tfrmoptionsicons.rbiconsshownone.caption"
msgid "&No icons"
msgstr "Sense icones"
#: tfrmoptionsicons.rbiconsshowstandard.caption
#, fuzzy
#| msgid "&Only standard icons"
msgctxt "tfrmoptionsicons.rbiconsshowstandard.caption"
msgid "Only &standard icons"
msgstr "Només icones estàndar"
#: tfrmoptionsignorelist.btnaddsel.caption
#, fuzzy
#| msgid "&Add selected names"
msgctxt "tfrmoptionsignorelist.btnaddsel.caption"
msgid "A&dd selected names"
msgstr "Afegeix noms seleccionats"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "tfrmoptionsignorelist.btnaddselwithpath.caption"
msgid "Add selected names with &full path"
msgstr "Afegeix noms seleccionats amb la ruta completa"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "tfrmoptionsignorelist.chkignoreenable.caption"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignora (no mostra) els següents fitxers i carpetes:"
#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "tfrmoptionsignorelist.lblsavein.caption"
msgid "&Save in:"
msgstr "Desa a:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Les fletxes esquerra/dreta canvien el directori (Com en Lynux)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Escrivint"
#: tfrmoptionskeyboard.lblalt.caption
#, fuzzy
#| msgid "Alt+L&etters"
msgctxt "tfrmoptionskeyboard.lblalt.caption"
msgid "Alt+L&etters:"
msgstr "Al&t+Lletres:"
#: tfrmoptionskeyboard.lblctrlalt.caption
#, fuzzy
#| msgid "Ctrl+Alt+Le&tters"
msgctxt "tfrmoptionskeyboard.lblctrlalt.caption"
msgid "Ctrl+Alt+Le&tters:"
msgstr "&Ctrl+Alt+Lletres:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "&Lletres:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
#, fuzzy
#| msgid "Flat buttons"
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr "Botons plans"
#: tfrmoptionslayout.cbflatinterface.caption
#, fuzzy
#| msgid "Flat interface"
msgctxt "tfrmoptionslayout.cbflatinterface.caption"
msgid "Flat i&nterface"
msgstr "Interfície plana"
#: tfrmoptionslayout.cbflattoolbar.caption
#, fuzzy
#| msgid "Flat buttons"
msgctxt "tfrmoptionslayout.cbflattoolbar.caption"
msgid "Flat b&uttons"
msgstr "Botons plans"
#: tfrmoptionslayout.cbfreespaceind.caption
#, fuzzy
#| msgid "Show free space indicator on drive label"
msgctxt "tfrmoptionslayout.cbfreespaceind.caption"
msgid "Show fr&ee space indicator on drive label"
msgstr "Mostra l'espai lliure a l'etiqueta del disc"
#: tfrmoptionslayout.cblogwindow.caption
#, fuzzy
#| msgid "Show log window"
msgctxt "tfrmoptionslayout.cblogwindow.caption"
msgid "Show lo&g window"
msgstr "Finestra de registre"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "tfrmoptionslayout.cbpanelofoperations.caption"
msgid "Show panel of operation in background"
msgstr "Panell d'operació en segon pla"
#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "tfrmoptionslayout.cbproginmenubar.caption"
msgid "Show common progress in menu bar"
msgstr "Progrés en barra de menú"
#: tfrmoptionslayout.cbshowcmdline.caption
#, fuzzy
#| msgid "Show command &line"
msgctxt "tfrmoptionslayout.cbshowcmdline.caption"
msgid "Show command l&ine"
msgstr "Mostra &línia d'ordres"
#: tfrmoptionslayout.cbshowcurdir.caption
#, fuzzy
#| msgid "Show &current directory"
msgctxt "tfrmoptionslayout.cbshowcurdir.caption"
msgid "Show current director&y"
msgstr "Mostra carpeta actual"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "tfrmoptionslayout.cbshowdiskpanel.caption"
msgid "Show &drive buttons"
msgstr "Mostra botons &d'unitats"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
#, fuzzy
#| msgid "Show free space label"
msgctxt "tfrmoptionslayout.cbshowdrivefreespace.caption"
msgid "Show free s&pace label"
msgstr "Mostra la etiqueta de espai lliure"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Mostra botó amb llista d'unitats"
#: tfrmoptionslayout.cbshowkeyspanel.caption
#, fuzzy
#| msgid "Show &function key buttons"
msgctxt "tfrmoptionslayout.cbshowkeyspanel.caption"
msgid "Show function &key buttons"
msgstr "Mostra botons de tecla de &funció"
#: tfrmoptionslayout.cbshowmainmenu.caption
#, fuzzy
#| msgid "Show main menu"
msgctxt "tfrmoptionslayout.cbshowmainmenu.caption"
msgid "Show &main menu"
msgstr "Mostra menú principal"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
#, fuzzy
#| msgid "Show &button bar"
msgctxt "tfrmoptionslayout.cbshowmaintoolbar.caption"
msgid "Show tool&bar"
msgstr "Mostra barra de &botons"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Mostra petita etiqueta d'espai lliure"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "tfrmoptionslayout.cbshowstatusbar.caption"
msgid "Show &status bar"
msgstr "Mostra barra de e&stat"
#: tfrmoptionslayout.cbshowtabheader.caption
#, fuzzy
#| msgid "Show &tabstop header"
msgctxt "tfrmoptionslayout.cbshowtabheader.caption"
msgid "S&how tabstop header"
msgstr "Mostra salts de tabulació"
#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "tfrmoptionslayout.cbshowtabs.caption"
msgid "Sho&w folder tabs"
msgstr "Mostra &pestanyes de carpetes"
#: tfrmoptionslayout.cbtermwindow.caption
#, fuzzy
#| msgid "Show terminal window"
msgctxt "tfrmoptionslayout.cbtermwindow.caption"
msgid "Show te&rminal window"
msgstr "Mostra finestra de terminal"
#: tfrmoptionslayout.cbtwodiskpanels.caption
#, fuzzy
#| msgid "Show two drive button bars (fixed width, above file windows)"
msgctxt "tfrmoptionslayout.cbtwodiskpanels.caption"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Barra de &botons d'unitats (amplada fixa, sobre llista de fitxers)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgctxt "tfrmoptionslayout.gbscreenlayout.caption"
msgid " Screen layout "
msgstr " Aparença de pantalla"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr ""
#: tfrmoptionslog.cblogarcop.caption
#, fuzzy
#| msgid "Pack/Unpack"
msgctxt "tfrmoptionslog.cblogarcop.caption"
msgid "&Pack/Unpack"
msgstr "Comprimeix/Descomprimeix"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr ""
#: tfrmoptionslog.cblogcpmvln.caption
#, fuzzy
#| msgid "Copy/Move/Create link/symlink"
msgctxt "tfrmoptionslog.cblogcpmvln.caption"
msgid "Cop&y/Move/Create link/symlink"
msgstr "Copia/Mou/Crea enllaç/enllaç simbòlic"
#: tfrmoptionslog.cblogdelete.caption
#, fuzzy
#| msgid "Delete"
msgctxt "tfrmoptionslog.cblogdelete.caption"
msgid "&Delete"
msgstr "Esborra"
#: tfrmoptionslog.cblogdirop.caption
#, fuzzy
#| msgid "Create/Delete directories"
msgctxt "tfrmoptionslog.cblogdirop.caption"
msgid "Crea&te/Delete directories"
msgstr "Crea/Esborra carpetes"
#: tfrmoptionslog.cblogerrors.caption
msgctxt "tfrmoptionslog.cblogerrors.caption"
msgid "Log &errors"
msgstr "Registra &errors"
#: tfrmoptionslog.cblogfile.caption
#, fuzzy
#| msgid "&Create a log file:"
msgctxt "tfrmoptionslog.cblogfile.caption"
msgid "C&reate a log file:"
msgstr "Crea un Fitxer de registre:"
#: tfrmoptionslog.cbloginfo.caption
#, fuzzy
#| msgid "Log information messages"
msgctxt "tfrmoptionslog.cbloginfo.caption"
msgid "Log &information messages"
msgstr "Registra missatges d'informació"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr ""
#: tfrmoptionslog.cblogsuccess.caption
msgctxt "tfrmoptionslog.cblogsuccess.caption"
msgid "Log &successful operations"
msgstr "Registra operacions exito&ses"
#: tfrmoptionslog.cblogvfs.caption
#, fuzzy
#| msgid "File system plugins"
msgctxt "tfrmoptionslog.cblogvfs.caption"
msgid "&File system plugins"
msgstr "Complements de sistema de fitxers"
#: tfrmoptionslog.gblogfile.caption
msgctxt "tfrmoptionslog.gblogfile.caption"
msgid "File operation log file"
msgstr "Registre de les operacions amb Fitxers"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Registre de les operacions"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Estat de les operacions"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "Esborra miniatures de fitxers que ja no existeixen"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
msgid "Create new with the encoding:"
msgstr ""
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Sempre va a l'arrel de la unitat quan es canvia d'unitat"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
#, fuzzy
#| msgid "Show warning messages (\"OK\" button only)"
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Mostra missatges d'avís (només botó \"Accepta\")"
#: tfrmoptionsmisc.chkthumbsave.caption
#, fuzzy
#| msgid "Save thumbnails in cache"
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
msgid "&Save thumbnails in cache"
msgstr "Desa miniatures en caché"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
msgid "Thumbnails"
msgstr "Miniatures"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr ""
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr ""
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
msgid "Default encoding:"
msgstr ""
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr ""
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr ""
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr ""
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "píxels"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr ""
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "Mida de les miniatures"
#: tfrmoptionsmouse.cbselectionbymouse.caption
#, fuzzy
#| msgid "Selection by mouse"
msgctxt "tfrmoptionsmouse.cbselectionbymouse.caption"
msgid "&Selection by mouse"
msgstr "Selecció per ratolí"
#: tfrmoptionsmouse.gbscrolling.caption
msgctxt "tfrmoptionsmouse.gbscrolling.caption"
msgid "Scrolling"
msgstr "Desplaçament"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Selecció"
#: tfrmoptionsmouse.lblmousemode.caption
#, fuzzy
#| msgid "Mode:"
msgctxt "tfrmoptionsmouse.lblmousemode.caption"
msgid "&Mode:"
msgstr "Mode:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
#, fuzzy
#| msgid "Line by line"
msgctxt "tfrmoptionsmouse.rbscrolllinebyline.caption"
msgid "&Line by line"
msgstr "Número de línies"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
#, fuzzy
#| msgid "Line by line with cursor movement"
msgctxt "tfrmoptionsmouse.rbscrolllinebylinecursor.caption"
msgid "Line by line &with cursor movement"
msgstr "Linia a linia amb moviment de cursor"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
#, fuzzy
#| msgid "Page by page"
msgctxt "tfrmoptionsmouse.rbscrollpagebypage.caption"
msgid "&Page by page"
msgstr "Pàgina a pàgina"
#: tfrmoptionsplugins.btnaddplugin.caption
#, fuzzy
#| msgid "Add"
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "Afegeix"
#: tfrmoptionsplugins.btnconfigplugin.caption
#, fuzzy
#| msgid "Configure"
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "Configura"
#: tfrmoptionsplugins.btnenableplugin.caption
#, fuzzy
#| msgid "Enable"
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
msgid "E&nable"
msgstr "Registre"
#: tfrmoptionsplugins.btnremoveplugin.caption
#, fuzzy
#| msgid "Remove"
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "Elimina"
#: tfrmoptionsplugins.btntweakplugin.caption
#, fuzzy
#| msgid "Tweak"
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
msgid "&Tweak"
msgstr "&Ajusta"
#: tfrmoptionsplugins.lbldsxdescription.caption
#, fuzzy
#| msgid "Search plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Permet als complements de cerca l'us d'algoritmes de cerca alternatius o eines externes (com \"locate\", etc.)"
#: tfrmoptionsplugins.lblwcxdescription.caption
#, fuzzy
#| msgid "Packer plugins are used to work with archives."
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
msgid "Pack&er plugins are used to work with archives"
msgstr "Els complements de compresors són utilitzats per treballar amb Fitxers."
#: tfrmoptionsplugins.lblwdxdescription.caption
#, fuzzy
#| msgid "Content plugins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Permet als complements de contingut mostrar detalls extesos del fitxer com les etiquetes mp3 o en llista de fitxer els atributs d'imatge, o usar-los amb les eines de cerca o de reanomenat múltiple"
#: tfrmoptionsplugins.lblwfxdescription.caption
#, fuzzy
#| msgid "File system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Permet als complements de sistema de fitxers accedir a discos inaccessibles pel sistema operatiu o a aparells externs com palm/PocketPC."
#: tfrmoptionsplugins.lblwlxdescription.caption
#, fuzzy
#| msgid "Viewer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Permet als complements de visionat mostrar fomats de fitxer com imatges, fulles de càlcul, bases de dades, etc. en Visualitza (F3, Ctrl+A)"
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Actiu"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Complement"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Registrat per"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Nom de fitxer"
#: tfrmoptionsplugins.tsdsx.caption
#, fuzzy
#| msgid "Search plugins (.DSX)"
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
msgid "&Search plugins (.DSX)"
msgstr "Complements de cerca (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
#, fuzzy
#| msgid "Packer plugins (.WCX)"
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
msgid "Pac&ker plugins (.WCX)"
msgstr "Complements de compresors (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
#, fuzzy
#| msgid "Content plugins (.WDX)"
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
msgid "Content pl&ugins (.WDX)"
msgstr "Complements de contingut(.WDX)"
#: tfrmoptionsplugins.tswfx.caption
#, fuzzy
#| msgid "File system plugins (.WFX)"
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
msgid "F&ile system plugins (.WFX)"
msgstr "Complements del sistema de Fitxers (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
#, fuzzy
#| msgid "Viewer plugins (.WLX)"
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
msgid "&Viewer plugins (.WLX)"
msgstr "Complements de visionat (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "tfrmoptionsquicksearchfilter.cbexactbeginning.caption"
msgid "&Beginning (name must start with first typed character)"
msgstr "&Començament (el nom ha de començar amb el primer caràcter)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "tfrmoptionsquicksearchfilter.cbexactending.caption"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "Fi&nal (ha de coincidir el últim caràcter abans d'un punt . )"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "tfrmoptionsquicksearchfilter.cgpoptions.caption"
msgid "Options"
msgstr "Opcions"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Coincidència de nom exacte"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Us de Majúscules"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Recerca d'aquests elements"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr ""
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "tfrmoptionstabs.cbtabsactivateonclick.caption"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Activa &panell cuando es clica en una de les seves pestanyes"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "tfrmoptionstabs.cbtabsalwaysvisible.caption"
msgid "&Show tab header also when there is only one tab"
msgstr "&Mostra pestanyes també si n'hi ha només una"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr ""
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
#, fuzzy
#| msgid "&Confirm close all tabs"
msgctxt "tfrmoptionstabs.cbtabsconfirmcloseall.caption"
msgid "Con&firm close all tabs"
msgstr "&Confirma tancament de totes les pestanyes"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr ""
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr "&Limita títol pestanya a"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "tfrmoptionstabs.cbtabslockedasterisk.caption"
msgid "Show locked tabs &with an asterisk *"
msgstr "Mostra les pestanyes bloquejades amb un asterisc *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "tfrmoptionstabs.cbtabsmultilines.caption"
msgid "&Tabs on multiple lines"
msgstr "&Pestanyes en varies linies"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "tfrmoptionstabs.cbtabsopenforeground.caption"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&Up obre una nova pestanya en primer pla"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "tfrmoptionstabs.cbtabsopennearcurrent.caption"
msgid "Open &new tabs near current tab"
msgstr "Obre una &nova pestanya al costat de l'actual"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr ""
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
#, fuzzy
#| msgid "Show tab close button"
msgctxt "tfrmoptionstabs.cbtabsshowclosebutton.caption"
msgid "Show ta&b close button"
msgstr "Mostra pestanya de botó de tancament"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr ""
#: tfrmoptionstabs.gbtabs.caption
msgctxt "tfrmoptionstabs.gbtabs.caption"
msgid "Folder tabs headers"
msgstr "Capçaleres de les pestanyes de carpeta"
#: tfrmoptionstabs.lblchar.caption
msgctxt "tfrmoptionstabs.lblchar.caption"
msgid "characters"
msgstr "caràcters"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr ""
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr "Posició de pestanyes\""
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
#, fuzzy
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "No"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr ""
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr ""
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr ""
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr ""
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr ""
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Comandament:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Paràmetres:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Comandament:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Paràmetres:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Comandament:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Paràmetres:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "Botó de clonació"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
msgid "&Delete"
msgstr "&Esborra"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgctxt "tfrmoptionstoolbar.btnedithotkey.caption"
msgid "Edit hot&key"
msgstr "Edita drecera"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgctxt "tfrmoptionstoolbar.btninsertbutton.caption"
msgid "&Insert new button"
msgstr "&Insereix nou botó"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr ""
#: tfrmoptionstoolbar.btnopenfile.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Un altre..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr "Esborra drecera"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr ""
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
#: tfrmoptionstoolbar.cbflatbuttons.caption
#, fuzzy
#| msgid "Flat b&uttons"
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "Botons plans"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr ""
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Entra paràmetres de comandament, cadascun en una línia separada. Premeu F1 per veure l'ajuda sobre paràmetres"
#: tfrmoptionstoolbar.gbgroupbox.caption
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
msgid "Appearance"
msgstr "Aparença"
#: tfrmoptionstoolbar.lblbarsize.caption
#, fuzzy
#| msgid "Ba&r size:"
msgctxt "tfrmoptionstoolbar.lblbarsize.caption"
msgid "&Bar size:"
msgstr "Mida de Ba&rra"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblexternalcommand.caption"
msgid "Comman&d:"
msgstr "Ordres:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Paràmetres"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr ""
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Drecera"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Icona"
#: tfrmoptionstoolbar.lbliconsize.caption
#, fuzzy
#| msgid "Ic&on size:"
msgctxt "tfrmoptionstoolbar.lbliconsize.caption"
msgid "Icon si&ze:"
msgstr "Mida ic&ones"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "Comandaments"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "Paràmetres"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Ruta d'inici"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "Indicador de funció"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr ""
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr ""
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr ""
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr ""
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr ""
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr ""
#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr ""
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr ""
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr ""
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr ""
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr ""
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Tipus de botons"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
#, fuzzy
#| msgid "Keep terminal window open after executing program"
msgctxt "tfrmoptionstoolbase.cbtoolskeepterminalopen.caption"
msgid "&Keep terminal window open after executing program"
msgstr "Manté oberta la finestra del terminal després d'executar el programa"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
#, fuzzy
#| msgid "Execute in terminal"
msgctxt "tfrmoptionstoolbase.cbtoolsruninterminal.caption"
msgid "&Execute in terminal"
msgstr "Executa en el terminal"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
#, fuzzy
#| msgid "Use external program"
msgctxt "tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption"
msgid "&Use external program"
msgstr "Programa extern"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
#, fuzzy
#| msgid "Additional parameters"
msgctxt "tfrmoptionstoolbase.lbltoolsparameters.caption"
msgid "A&dditional parameters"
msgstr "Paràmetres addicionals"
#: tfrmoptionstoolbase.lbltoolspath.caption
#, fuzzy
#| msgid "Path to program to execute"
msgctxt "tfrmoptionstoolbase.lbltoolspath.caption"
msgid "&Path to program to execute"
msgstr "Ruta del programa a executar"
#: tfrmoptionstooltips.btnaddfields.caption
#, fuzzy
#| msgid "Add"
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "Afegeix"
#: tfrmoptionstooltips.btnapplyfields.caption
#, fuzzy
#| msgid "Apply"
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "Aplica"
#: tfrmoptionstooltips.btndeletefields.caption
#, fuzzy
#| msgid "Delete"
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "Esborra"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Plantilla..."
#: tfrmoptionstooltips.chkshowtooltip.caption
#, fuzzy
#| msgid "Show tool tip"
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
msgid "&Show tooltip for files in the file panel"
msgstr "Mostra informació emergent"
#: tfrmoptionstooltips.gbcustomfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
msgid "Custom fields by file type"
msgstr "Camps d'usuari per tipus de fitxer"
#: tfrmoptionstooltips.lblfieldslist.caption
#, fuzzy
#| msgid "Category hint:"
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Atributs de la categoria:"
#: tfrmoptionstooltips.lblfieldsmask.caption
#, fuzzy
#| msgid "Category mask:"
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Màscara de la categoria:"
#: tfrmoptionstooltips.lblfieldsname.caption
#, fuzzy
#| msgid "Category name:"
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "Nom de la categoria:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Color de cursor:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "tfrmoptionsviewer.btnbackviewercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "tfrmoptionsviewer.btnfontviewercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgctxt "tfrmoptionsviewer.gbviewerbookmode.caption"
msgid "Viewer Book Mode"
msgstr "Visualitza en mode llibre"
#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "tfrmoptionsviewer.gbviewerexample.caption"
msgid "Example"
msgstr "Exemple"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
#, fuzzy
#| msgid "Background color in book viewer"
msgctxt "tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption"
msgid "&Background color in book viewer"
msgstr "Color de segon pla en vista de llibre"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
#, fuzzy
#| msgid "Font color in book viewer"
msgctxt "tfrmoptionsviewer.lblfontcolorviewerbook.caption"
msgid "&Font color in book viewer"
msgstr "Color de Font en vista de llibre"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
#, fuzzy
#| msgid "Number of columns in book viewer"
msgctxt "tfrmoptionsviewer.lblnumbercolumnsviewer.caption"
msgid "&Number of columns in book viewer"
msgstr "Número de columnes en vista de llibre"
#: tfrmpackdlg.btnconfig.caption
#, fuzzy
#| msgid "&Configure"
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "&Configura"
#: tfrmpackdlg.caption
msgctxt "tfrmpackdlg.caption"
msgid "Pack files"
msgstr "Comprimeix fitxers"
#: tfrmpackdlg.cbcreateseparatearchives.caption
#, fuzzy
#| msgid "Create separate archives, o&ne per selected file/dir"
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Crea fitxers separats, u&n per Fitxer/carpeta"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Crea fitxer autoe&xtraible"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "Encr&iptar"
#: tfrmpackdlg.cbmovetoarchive.caption
#, fuzzy
#| msgid "M&ove to archive"
msgid "Mo&ve to archive"
msgstr "Mou &original(s) a fitxer Comprimit"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "Fitxer de disc &múltiple"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
#, fuzzy
#| msgid "Put in the TAR archive first"
msgid "P&ut in the TAR archive first"
msgstr "Insereix primer en un fitxer TAR"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Incloure noms de car&petes (només recursiu)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Comprimeix en el fitxer:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Compressor"
#: tfrmpackinfodlg.btnclose.caption
#, fuzzy
#| msgid "Close"
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Tanca"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Descomprimeix tot i executa"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "Descomprimeix i executa"
#: tfrmpackinfodlg.caption
msgctxt "tfrmpackinfodlg.caption"
msgid "Properties of packed file"
msgstr "Propietats del fitxer Comprimit"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Atributs:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Ratio de compressió:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Data:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Mètode:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Mida orginal:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Fitxer:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Mida Comprimit:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Compressor:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Temps:"
#: tfrmquicksearch.btncancel.caption
msgctxt "tfrmquicksearch.btncancel.caption"
msgid "X"
msgstr ""
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr ""
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr ""
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr ""
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Sensibilitat a Majúscules"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "D"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Carpetes"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Fitxers"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr ""
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Començament l'acció"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr ""
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Final de l'acció"
#: tfrmquicksearch.tglfilter.caption
msgctxt "tfrmquicksearch.tglfilter.caption"
msgid "Filter"
msgstr "Filtre"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Canvi entre recerca i filtre"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr ""
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr ""
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Complement"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Valor"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr ""
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr ""
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "tfrmselecttextrange.btppanel.cancelbutton.caption"
msgid "Cancel"
msgstr "Cancel·la"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "tfrmselecttextrange.btppanel.closebutton.caption"
msgid "&Close"
msgstr "&Tanca"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "tfrmselecttextrange.btppanel.helpbutton.caption"
msgid "&Help"
msgstr "A&juda"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
msgid "&OK"
msgstr "&Accepta"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr ""
#: tfrmsetfileproperties.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmsetfileproperties.caption
msgctxt "tfrmsetfileproperties.caption"
msgid "Change attributes"
msgstr "Canvia atributs"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Adhesiu"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "Fitxer"
#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Creat:"
#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "Ocult"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Accedit:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Modificat:"
#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "Només lectura"
#: tfrmsetfileproperties.chkrecursive.caption
#, fuzzy
#| msgid "Recursive"
msgid "Including subfolders"
msgstr "Incloent subcarpetes"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "Sistema"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Propietats de la data"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributs"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributs"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grup"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(camp gris significa valor sense canvi)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Altres"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Propietari"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Text:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Execució"
#: tfrmsetfileproperties.lblmodeinfo.caption
#, fuzzy
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(camp gris significa valor sense canvi)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Octal"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lectura"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Escriptura"
#: tfrmsplitter.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
#, fuzzy
#| msgid "OK"
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmsplitter.caption
msgctxt "tfrmsplitter.caption"
msgid "Splitter"
msgstr "Separador"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr ""
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Nom de Fitxer"
#: tfrmsplitter.grbxsize.caption
#, fuzzy
#| msgid "File size"
msgid "Size and number of parts"
msgstr "Mida"
#: tfrmsplitter.lbdirtarget.caption
#, fuzzy
#| msgid "Directory target"
msgid "Directory &target"
msgstr "Ruta de desti"
#: tfrmsplitter.lbfilesource.caption
#, fuzzy
#| msgid "File source"
msgid "File &source"
msgstr "Fitxer orígen"
#: tfrmsplitter.lblnumberparts.caption
#, fuzzy
#| msgid "Number of parts"
msgid "&Number of parts"
msgstr "Número de parts"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr ""
#: tfrmsplitter.rbtngigab.caption
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr ""
#: tfrmsplitter.rbtnkilob.caption
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr ""
#: tfrmsplitter.rbtnmegab.caption
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr ""
#: tfrmstartingsplash.caption
msgctxt "tfrmstartingsplash.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "tfrmstartingsplash.lblbuild.caption"
msgid "Build"
msgstr "Fet"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr ""
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr ""
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr ""
#: tfrmstartingsplash.lblrevision.caption
msgctxt "tfrmstartingsplash.lblrevision.caption"
msgid "Revision"
msgstr "Revisió"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "tfrmstartingsplash.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "tfrmstartingsplash.lblversion.caption"
msgid "Version"
msgstr "Versió"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""
#: tfrmsymlink.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Accepta"
#: tfrmsymlink.caption
#, fuzzy
#| msgid "Create symlink"
msgid "Create symbolic link"
msgstr "Crea enllaç Simbòlic"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
#, fuzzy
#| msgid "Destination that the link will point to"
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Destí (on s'enllaçarà)"
#: tfrmsymlink.lbllinktocreate.caption
#, fuzzy
#| msgid "Link name"
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Nom de l'enllaç"
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
msgid "Close"
msgstr "Tanca"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
msgid "Compare"
msgstr "Compara"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr ""
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr ""
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr ""
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr ""
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr ""
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr ""
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Nom"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Mida"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Data"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Data"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Mida"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Nom"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr ""
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Compara"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr ""
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr ""
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
msgid "<"
msgstr ""
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
msgid ">"
msgstr ""
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr ""
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr ""
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr ""
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr ""
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr ""
#: tfrmsyncdirsperformdlg.caption
msgctxt "tfrmsyncdirsperformdlg.caption"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr ""
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr ""
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr ""
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmtweakplugin.btnadd.caption
#, fuzzy
#| msgid "Add new"
msgid "A&dd new"
msgstr "Afegeix nou"
#: tfrmtweakplugin.btncancel.caption
#, fuzzy
#| msgid "Cancel"
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancel·la"
#: tfrmtweakplugin.btnchange.caption
#, fuzzy
#| msgid "Change"
msgid "C&hange"
msgstr "Canvia"
#: tfrmtweakplugin.btndefault.caption
#, fuzzy
#| msgid "Default"
msgid "De&fault"
msgstr "Per defecte"
#: tfrmtweakplugin.btnok.caption
#, fuzzy
#| msgid "OK"
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "Accepta"
#: tfrmtweakplugin.btnremove.caption
#, fuzzy
#| msgid "Remove"
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "Elimina"
#: tfrmtweakplugin.caption
msgctxt "tfrmtweakplugin.caption"
msgid "Tweak plugin"
msgstr "Connecta complement"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
#, fuzzy
#| msgid "Detect archive type by content"
msgid "De&tect archive type by content"
msgstr "Detecta tipus de fitxer per contingut"
#: tfrmtweakplugin.cbpk_caps_delete.caption
#, fuzzy
#| msgid "Can delete files"
msgid "Can de&lete files"
msgstr "Podeu Esborrar Fitxers"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
#, fuzzy
#| msgid "Supports encryption"
msgid "Supports e&ncryption"
msgstr "Suporta encriptació"
#: tfrmtweakplugin.cbpk_caps_hide.caption
#, fuzzy
#| msgid "Show as normal files (hide packer icon)"
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Mostra com Fitxers normals (oculta icona Comprimida)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
#, fuzzy
#| msgid "Supports packing in memory"
msgid "Supports pac&king in memory"
msgstr "Suporta compressió en memòria"
#: tfrmtweakplugin.cbpk_caps_modify.caption
#, fuzzy
#| msgid "Can modify existing archives"
msgid "Can &modify existing archives"
msgstr "Podeu modificar els fitxers existents"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
#, fuzzy
#| msgid "Archive can contain multiple files"
msgid "&Archive can contain multiple files"
msgstr "El fitxer pot contenir múltiples fitxers"
#: tfrmtweakplugin.cbpk_caps_new.caption
#, fuzzy
#| msgid "Can create new archives"
msgid "Can create new archi&ves"
msgstr "Podeu crear nous fitxers"
#: tfrmtweakplugin.cbpk_caps_options.caption
#, fuzzy
#| msgid "Supports the options dialogbox"
msgid "S&upports the options dialogbox"
msgstr "Suporta la finestra de diàleg amb opcions"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
#, fuzzy
#| msgid "Allow searching for text in archives"
msgid "Allow searchin&g for text in archives"
msgstr "Permet Cerca de text dins dels fitxers"
#: tfrmtweakplugin.lbldescription.caption
#, fuzzy
#| msgid "Description:"
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "Descripció:"
#: tfrmtweakplugin.lbldetectstr.caption
#, fuzzy
#| msgid "Detect string:"
msgid "D&etect string:"
msgstr "Detectar cadena:"
#: tfrmtweakplugin.lblextension.caption
#, fuzzy
#| msgid "Extension:"
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "Extensió:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Banderes:"
#: tfrmtweakplugin.lblname.caption
#, fuzzy
#| msgid "Name:"
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "Nom:"
#: tfrmtweakplugin.lblplugin.caption
#, fuzzy
#| msgid "Plugin:"
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "Complement:"
#: tfrmtweakplugin.lblplugin1.caption
#, fuzzy
#| msgid "Plugin:"
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "Complement:"
#: tfrmviewer.actabout.caption
msgctxt "tfrmviewer.actabout.caption"
msgid "About Viewer..."
msgstr "Quant al Visualitzador..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Mostra el missatge Quant a"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "tfrmviewer.actcopyfile.caption"
msgid "Copy File"
msgstr "Copia fitxer"
#: tfrmviewer.actcopyfile.hint
msgctxt "tfrmviewer.actcopyfile.hint"
msgid "Copy File"
msgstr "Copia fitxer"
#: tfrmviewer.actcopytoclipboard.caption
#, fuzzy
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Copia al portapapers"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr ""
#: tfrmviewer.actdeletefile.caption
msgctxt "tfrmviewer.actdeletefile.caption"
msgid "Delete File"
msgstr "Esborra fitxer"
#: tfrmviewer.actdeletefile.hint
msgctxt "tfrmviewer.actdeletefile.hint"
msgid "Delete File"
msgstr "Esborra fitxer"
#: tfrmviewer.actexitviewer.caption
#, fuzzy
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "&Surt"
#: tfrmviewer.actfind.caption
#, fuzzy
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Cerca"
#: tfrmviewer.actfindnext.caption
#, fuzzy
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Cerca següent"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr ""
#: tfrmviewer.actfullscreen.caption
#, fuzzy
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Pantalla completa"
#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr ""
#: tfrmviewer.actloadnextfile.caption
msgctxt "tfrmviewer.actloadnextfile.caption"
msgid "&Next"
msgstr "&Següent"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Carrega següent fitxer"
#: tfrmviewer.actloadprevfile.caption
msgctxt "tfrmviewer.actloadprevfile.caption"
msgid "&Previous"
msgstr "&Anterior"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Carrega el fitxer previ"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr ""
#: tfrmviewer.actmirrorhorz.hint
#, fuzzy
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr "Mirall"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr ""
#: tfrmviewer.actmovefile.caption
msgctxt "tfrmviewer.actmovefile.caption"
msgid "Move File"
msgstr "Mou fitxer"
#: tfrmviewer.actmovefile.hint
msgctxt "tfrmviewer.actmovefile.hint"
msgid "Move File"
msgstr "Mou fitxer"
#: tfrmviewer.actpreview.caption
#, fuzzy
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Vista prèvia"
#: tfrmviewer.actreload.caption
msgctxt "tfrmviewer.actreload.caption"
msgid "Reload"
msgstr "Recarrega"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Recarrega fitxer actual"
#: tfrmviewer.actrotate180.caption
#, fuzzy
#| msgid "Rotate 180"
msgctxt "tfrmviewer.actrotate180.caption"
msgid "+ 180"
msgstr "Rotació de 180"
#: tfrmviewer.actrotate180.hint
#, fuzzy
#| msgid "Rotate 180"
msgctxt "tfrmviewer.actrotate180.hint"
msgid "Rotate 180 degrees"
msgstr "Rotació de 180"
#: tfrmviewer.actrotate270.caption
#, fuzzy
#| msgid "Rotate 270"
msgctxt "tfrmviewer.actrotate270.caption"
msgid "- 90"
msgstr "Rotació de 270"
#: tfrmviewer.actrotate270.hint
#, fuzzy
#| msgid "Rotate 270"
msgctxt "tfrmviewer.actrotate270.hint"
msgid "Rotate -90 degrees"
msgstr "Rotació de 270"
#: tfrmviewer.actrotate90.caption
#, fuzzy
#| msgid "Rotate 90"
msgctxt "tfrmviewer.actrotate90.caption"
msgid "+ 90"
msgstr "Rotació de 90"
#: tfrmviewer.actrotate90.hint
#, fuzzy
#| msgid "Rotate 90"
msgctxt "tfrmviewer.actrotate90.hint"
msgid "Rotate +90 degrees"
msgstr "Rotació de 90"
#: tfrmviewer.actsave.caption
#, fuzzy
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Desa"
#: tfrmviewer.actsaveas.caption
msgctxt "tfrmviewer.actsaveas.caption"
msgid "Save As..."
msgstr "Desa com..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Anomena i desa"
#: tfrmviewer.actscreenshot.caption
#, fuzzy
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Captura"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr ""
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr ""
#: tfrmviewer.actselectall.caption
#, fuzzy
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Selecciona tot"
#: tfrmviewer.actshowasbin.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "Mostra com &Binari"
#: tfrmviewer.actshowasbook.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "Mostra com un llibre"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr ""
#: tfrmviewer.actshowashex.caption
#, fuzzy
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "Mostra com &Hex"
#: tfrmviewer.actshowastext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "Mostra com &Text"
#: tfrmviewer.actshowaswraptext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "Ajusta linies"
#: tfrmviewer.actshowgraphics.caption
#, fuzzy
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Gràfics"
#: tfrmviewer.actshowplugins.caption
#, fuzzy
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Complements"
#: tfrmviewer.actstretchimage.caption
msgctxt "tfrmviewer.actstretchimage.caption"
msgid "Stretch"
msgstr "Aprima"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr ""
#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr ""
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr ""
#: tfrmviewer.actzoomin.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Apropar"
#: tfrmviewer.actzoomout.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Allunya"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Copia"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Copia"
#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Retalla"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Esborra"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Esborra"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Pantalla completa"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr ""
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr ""
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Realça"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Mou"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Mou"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr ""
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Dibuixa"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr ""
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Ulls Vermells"
#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Canvia mida"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Desfà"
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Visualitzador"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Diapositives"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Llapis"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Destaca"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Pinta"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Diapositives"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Visualització"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr ""
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "Quant a"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Edita"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codificació"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Fitxer"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Imatge"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Imprimeix..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Rota"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Captura"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Visualització"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Selecciona tot"
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Quan el fitxer existeix"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Quan el fitxer existeix"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
#, fuzzy
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Copia Data/Hora"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Treballa al fons"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Quan el fitxer existeix"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Alt"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Amplada"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Cancel·la el filtre ràpid"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Cancel·la l'operació current"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr ""
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr ""
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr ""
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr ""
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr ""
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr ""
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr ""
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr ""
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr ""
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr ""
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "El portapapers no conté dades d'una barra d'eines vàlida"
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr ""
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr ""
#: ulng.rscolattr
msgid "Attr"
msgstr "Atribut"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Data"
#: ulng.rscolext
msgid "Ext"
msgstr "Ext"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Nom"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Mida"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Alinia"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Text"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Esborra"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Continguts de camps"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Mou"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Amplada"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Columna personalitzada"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr ""
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr ""
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Copia (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr ""
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr ""
#: ulng.rsdiffadds
msgid " Adds: "
msgstr ""
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr ""
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr ""
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr ""
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr ""
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Av&orta"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "Tots"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Afegeix"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr ""
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Cancel·la"
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Continua"
#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "Copia dins"
#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "Copia tot a dins"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "Surt del programa"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr ""
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Ignora-ho tot"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&No"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "&Cap"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&Accepta"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr ""
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "Sobrescriu"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Sobr. &Tot"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr ""
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Sobr. antics"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr ""
#: ulng.rsdlgbuttonrename
#, fuzzy
#| msgid "Rename"
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Reanomena"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "Reprèn"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Reintenta"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Omet"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Omet Tots"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Si"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Copia fitxer(s)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Mou Fitxer(s)"
#: ulng.rsdlgoppause
#, fuzzy
#| msgid "Pause"
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "Pausa"
#: ulng.rsdlgopstart
#, fuzzy
#| msgid "Start"
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "Inicia"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Cua"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Velocitat %s/s"
#: ulng.rsdlgspeedtime
#, fuzzy
#| msgid "Speed %s/s, time remaining s%"
msgid "Speed %s/s, time remaining %s"
msgstr "Velocitat %s/s, temps restant %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr ""
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr ""
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Editor intern de Double Commander."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr ""
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr ""
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "nou.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Nom de fitxer:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Obre Fitxer"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "Enrera"
#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Cerca"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "Endavant"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Reemplaçar"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr ""
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr ""
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr ""
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr ""
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr ""
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr ""
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr ""
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
msgid "Ask;Merge;Skip"
msgstr ""
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr ""
#: ulng.rsfileopsetpropertyerroroptions
msgctxt "ulng.rsfileopsetpropertyerroroptions"
msgid "Ask;Don't set anymore;Ignore errors"
msgstr ""
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "Filtre"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Defineix plantilla"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s nivell(s)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "Tot (profunditat sense límits)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "només carpeta actual"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "¡La carpeta %s no existeix!"
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Trobat: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Desa platilla de cerca"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Nom de plantilla:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Trobats: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Cercant"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Cerca fitxers"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr ""
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Inicia a"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr " %s de %s bytes lliures"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s bytes lliures"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Data/temps d'acces"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Atributs"
#: ulng.rsfunccomment
msgid "Comment"
msgstr "Comentari"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Mida comrpimida"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "data/temps de creació"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Extensió"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Grup"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr ""
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Enllaça a"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Data/temps de modificació"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Nom"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Nom sense extensió"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Propietari"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Ruta"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Mida"
#: ulng.rsfunctype
msgid "Type"
msgstr "Tipus"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Error creant l'enllaç fort"
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr ""
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Copia/mou dialeg"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Differ(comparador)"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr ""
#: ulng.rshotkeycategoryeditor
#, fuzzy
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rshotkeycategoryfindfiles
#, fuzzy
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Cerca fitxers"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Principal"
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Visualitzador"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr ""
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Màscara a deselecció"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Màscara de Selecció"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Màscara d'entrada:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr ""
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr ""
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Configura columnes a mida"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr ""
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Accions"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr ""
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Edita"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Expulsa"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr ""
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr ""
#: ulng.rsmnumount
msgid "Mount"
msgstr "Munta"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Nou"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "No hi ha cap medi disponible"
#: ulng.rsmnuopen
#, fuzzy
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Obre"
#: ulng.rsmnuopenwith
#, fuzzy
#| msgid "Open with ..."
msgid "Open with"
msgstr "Obre amb ..."
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Un altre..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr ""
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Ordena"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Desmunta"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Visualització"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Compte:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Paràmetres addicionals per a la linia d'ordres de l'arxivador:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "No es pot copiar/moure un Fitxer \"%s\" dins d'ell mateix"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr ""
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Impossible canviar a [%s]!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "¿Tanca totes les pestanyes inactives?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Aquesta pestanya (%s) està blocada! La tanco? "
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr ""
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr ""
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr ""
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Copia %d Fitxers/carpetes seleccionats?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Copia \"%s\"?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr ""
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr ""
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr ""
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr ""
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Esborra %d Fitxers/carpetes seleccionats?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Envia %d Fitxers/carpetes seleccionats a la paperera?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Esborra \"%s\"?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Envia \"%s\" a la paperera?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "No puc enviar \"%s\" a la paperera!¿Ho esborro directament?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Disc no disponible"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr ""
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Introduiu l'extensió del fitxer:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Introduiu el nom:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr ""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Error de CRC en les dades"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Dades corruptes"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "No puc connectar amb el servidor: \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "No puc Copiar el fitxer %s a %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Ja existeix una carpeta anomenada \"%s\"."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "La data %s no es suporta"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "La carpeta %s ja existeix!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Funció abortada per l'usuari"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Error tancant el fitxer"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Impossible Crea el fitxer"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "No hi ha més Fitxers a l'arxiu"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Impossible Obre el fitxer existent"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Error llegint del fitxer"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Error escrivint en el fitxer"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "No es pot crear la carpeta %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Enllaç no vàlid"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "No s'han trobat Fitxers"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Memòria insuficient"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Funció no suportada!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Error en el context del menú de comandament"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Error carregant configuració"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Error de sintaxi en expresió regular!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "No es pot reanomenar el fitxer %s a %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "No es pot desar l'associació"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "No es pot desar el fitxer"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "No es pot fixar atributs per \"%s"
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "No es pot fixar data/temps per \"%s"
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "No es pot establir el propietari/grup de \"%s\""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr ""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Buffer massa petit"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Massa fitxers per comprimir!"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Format de fitxer desconegut"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr ""
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr ""
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr ""
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr ""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "%s ha canviat, Desa?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr ""
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr ""
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "%s existeix ¿sobreescriure"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr ""
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr ""
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Operacions de fitxer actives"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Algunes operacions de fitxer no han acabat encara. Si tanca Double Commander pot perdre dades."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
#, fuzzy
#| msgid "File %s is marked as read-only. Delete it?"
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "El fitxer %s s'ha marcat com de només lectura, l'esborro?"
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "La Mida del fitxer de \"%s\" és massa gran per al seu destí!"
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "La carpeta %s existeix, la sobreescric?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "¿Segueis l'enllaç simbòlic \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr ""
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr ""
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr ""
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr ""
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr ""
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr ""
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr ""
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr ""
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr ""
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr ""
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr ""
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr ""
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr ""
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr ""
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr ""
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr ""
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr ""
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Ruta:"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr ""
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr ""
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr ""
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr ""
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr ""
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr ""
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr ""
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr ""
#: ulng.rsmsghotdirsimplecommand
#, fuzzy
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Comandament:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr ""
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr ""
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Nom:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr ""
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr ""
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr ""
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr ""
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr ""
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr ""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Error a la línia d'ordres"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Nom no vàlid"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Format invàlid de fitxer de configuració"
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Ruta invàlida"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "La ruta %s conté caràcters prohibits"
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Aquest no és un complement vàlid"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr ""
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Cita invàlida"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Selecció no vàlida"
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Carregant la llista de fitxers ..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr ""
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr ""
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Copia fitxer %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Esborra fitxer %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Error: "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr ""
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Extreu Fitxer %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Informació: "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Crea enllaç %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Crea carpeta %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Mou Fitxer %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Comprimeix en fitxer %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Elimina carpeta %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Fet: "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Crea enllaç Simbòlic %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Examinar la integritat del fitxer %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr ""
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr ""
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Contrasenya mestra"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Per favor, introduiu la contrasenya mestra:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Nou Fitxer"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Es descomprimirà el següent volum"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "No hi ha fitxers"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Cap fitxer seleccionat."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Espai insuficient en disc de destí, Continuar?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Espai insuficient en disc de destí, Reintentar?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Impossible Esborra %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "No implementat"
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Contrasenya:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Passwords son diferents"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Per favor, introduiu la contrasenya:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Contrasenya (Firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Si us plau torneu a escriure el password de verificació"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Esborra %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "La configuració \"%s\" ja exiteix.¿Sobreescriure?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr ""
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr ""
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr ""
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr ""
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Reanomena/Mou %d fitxers/carpetes seleccionats?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Reanomena/Mou \"%s\"?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Per favor, reinicieu Double Commander per aplicar els canvis"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr ""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Seleccionat: %s de %s, fitxers: %d de %d, carpetes: %d de %d\""
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr ""
#: ulng.rsmsgselectonlychecksumfiles
#, fuzzy
#| msgid "Please select only check sum files!"
msgid "Please select only checksum files!"
msgstr "Per favor, seleccioneu només fitxers de comprovació"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Escull localització del següent volum"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Posa etiqueta al volum"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr ""
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr ""
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr ""
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr ""
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr ""
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr ""
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr ""
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr ""
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Reanomena pestanya"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Nom de la nova pestanya:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Ruta destí:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr ""
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr ""
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr ""
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Massa fitxers seleccionats."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr ""
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""
#: ulng.rsmsgurl
msgid "URL:"
msgstr ""
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr ""
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr ""
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Nom d'usuari:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Nom d'usuari (Firewall):"
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Etiqueta del Volum:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Si us plau, introduiu el nom del volum:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Destrueix %d Fitxers/carpetes seleccionats?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Destrueix \"%s\"?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
#, fuzzy
#| msgid "No change;UPPERCASE;lowercase;First Char Big;"
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Sense canvis;MAJÚSCULES;minúscules;Primera Majúscula;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Interromput"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr ""
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr ""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr ""
#: ulng.rsopercalculatingstatictics
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "Calculant"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Calculant \"%s\""
#: ulng.rsopercombining
msgid "Joining"
msgstr ""
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr ""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Copiant"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr ""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Copiant \"%s\" to \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Creant directori"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Creant directori \"%s\""
#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "Esborrant"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Esborrant en \"%s\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Esborrant \"%s\""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Executant"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Executant \"%s\""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Extreient"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Extraient de \"%s\" a \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Finalitzat"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Llistant"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Llistant \"%s\""
#: ulng.rsopermoving
msgid "Moving"
msgstr "Movent"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Movent from \"%s\" to \"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Movent \"%s\" to \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "No iniciat"
#: ulng.rsoperpacking
msgid "Packing"
msgstr ""
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Pausat"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Pausant"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Funcionant"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr ""
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr ""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr ""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr ""
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Iniciant"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Parat"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Parant"
#: ulng.rsopertesting
msgid "Testing"
msgstr ""
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr ""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr ""
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr ""
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr ""
#: ulng.rsoperverifyingchecksumof
#, fuzzy
#| msgid "Verifying check sum of \"%s\""
msgid "Verifying checksum of \"%s\""
msgstr "Verificació del checksum de \"%s\""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Esperant per accedir al fitxer"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Esperant per la resposta del usuario"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Netejant"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Netejant a \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Netejant \"%s\""
#: ulng.rsoperworking
msgid "Working"
msgstr "Treballant"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr ""
#: ulng.rsoptarchivedelete
msgctxt "ulng.rsoptarchivedelete"
msgid "Delete:"
msgstr "Esborra"
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Extreu sense ruta:"
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr "Format mode d'anàlisis"
#: ulng.rsoptarchiveid
msgctxt "ulng.rsoptarchiveid"
msgid "ID:"
msgstr ""
#: ulng.rsoptarchiveidpos
msgctxt "ulng.rsoptarchiveidpos"
msgid "ID Position:"
msgstr "Posició ID:"
#: ulng.rsoptarchiveidseekrange
msgctxt "ulng.rsoptarchiveidseekrange"
msgid "ID Seek Range:"
msgstr "Rang de cerca ID:"
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr "Paràmetre"
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr "Pregunta per la contrasenya:"
#: ulng.rsoptarchiveselfextract
msgctxt "ulng.rsoptarchiveselfextract"
msgid "Create self extracting archive:"
msgstr "Crea fitxer autoextraible:"
#: ulng.rsoptarchivetest
msgctxt "ulng.rsoptarchivetest"
msgid "Test:"
msgstr "Prova:"
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Nom del tipus de fitxer:"
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Valor"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Complement associat \"%s\" con:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Primer;Últim;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr ""
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Deshabilita"
#: ulng.rsoptenable
msgctxt "ulng.rsoptenable"
msgid "Enable"
msgstr "Registre"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Introduir extensió"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr ""
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "finestra diferent; finestra diferent minimitzada; panell d'operacions"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "flotant;B;K;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Drecera %s per a cm_Delete es registrarà, així es podrà utilitzar per revertir aquest ajust."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Afegeix drecera per a %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Afegeix accés directe"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "No es pot establir l'accés directe"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Canvia l'accés directe"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Comandament"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Drecera %s per a cm_Delete té un paràmetre que anul·la aquesta configuració. Voleu canviar aquest paràmetre per utilitzar la configuració global?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Drecera %s per a cm_Delete necessita canviar un paràmetre perquè coincideixi amb l'accés directe %s. El voleu canviar?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Descripció"
#: ulng.rsopthotkeysedithotkey
#, fuzzy,badformat
msgid "Edit hotkey for %s"
msgstr "Fixa Tecles ràpides"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Fixa paràmetres"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Tecles ràpides"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Tecles ràpides"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<res>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Paràmetres"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Tria drecera per esborrar fitxer"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Perque aquesta configuració funcioni amb la drecera %s, la drecera %ss'ha d'assignar a cm_Delete però ja està assignada a %s. Ho voleu canviar?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "La drecera %s per a cm_Delete és una sequènciae de drecera per a la quals una tecla d'accés directe amb la tecla shift invertidat no es pot assignar. Aquesta configuració no funciona."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Drecera en us"
#: ulng.rsopthotkeysshortcutusedtext1
#, fuzzy
#| msgid "Shortcut %s is already used for %s."
msgid "Shortcut %s is already used."
msgstr "La Drecera %s ja el fa servir "
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Canviar-lo a %s ?"
#: ulng.rsopthotkeysusedby
#, fuzzy
#| msgid "used by"
msgid "used for %s in %s"
msgstr "Usat per %s %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "usat per aquest comandament, però amb diferents paràmetres"
#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Compressors"
#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Actualitza"
#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Comportament"
#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr "Reduïda"
#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Colors"
#: ulng.rsoptionseditorcolumnsview
msgctxt "ulng.rsoptionseditorcolumnsview"
msgid "Columns"
msgstr "Columnes"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Configuració"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Personalitza columnes"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Carpetes freqüents"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Drag & drop (Arrossega i deixa anar)"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Butó llista d'unitats"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr ""
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr ""
#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Associacions de fitxers"
#: ulng.rsoptionseditorfilenewfiletypes
#, fuzzy
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Nou"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Operacions amb fitxers"
#: ulng.rsoptionseditorfilepanels
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Panells de fitxers"
#: ulng.rsoptionseditorfilesearch
#, fuzzy
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Cerca de fitxers"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Visualitzadors de fitxers"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Tipus de fitxers"
#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Pestanyes de carpeta"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr ""
#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Fonts"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Realçats"
#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Tecles ràpides"
#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Icones"
#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Ignora llista"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Tecles"
#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Idioma"
#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr "Aparença"
#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Registre"
#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Varis"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Ratolí"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Complements"
#: ulng.rsoptionseditorquicksearch
#, fuzzy
#| msgid "Quick search"
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Cerca ràpida"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr ""
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Barra d'eines"
#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Eines"
#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Informació emergent"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr ""
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr ""
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Res;Línia de comandaments;Cerca ràpida;Filtre ràpid"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Botó esquerra; Botó dret;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "a la part superior de la llista de fitxers;després de directoris (si els directoris s'ordenen abans que els arxius);en la posició ordenada;a la part inferior de la llista de fitxers "
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "El complement %s s'ha assignat ja a la següent extensió:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Actiu"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Ruta del complement"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Nom"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Registrat per a"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Sensitiu;&No sensitiu"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Fitxers;Di&rectoris;Fitxers &i Directoris"
#: ulng.rsoptsearchopt
#, fuzzy
#| msgid "&Hide filter panel when not focused"
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "&amaga el panell de filtre quan no se centra"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "No sensitiu majúscules/minúscules, d'acord amb les opcions locals (aAbBcC); primer majúscules, després minúscules (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "Ordena per nom i mostra primer; ordena com a fitxer i mostra primer; Ordena com a fitxer"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Alfabèticament, considerant accents; Ordre natural: alfabètic i números"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Amunt;Avall;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "S&eparador;Comandament inte&rn;Comandament e&xtern;Men&ú"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr ""
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "No canvia posició; usa la mateixa configuració per a nous fitxers; a la posició ordenada "
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Fitxers: %d, Carpetes: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "No es pot canviar els drets d'accés per \"%s\""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "No es pot canviar el Propietari per \"%s\""
#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "Fitxer"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Carpeta"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Caanalització del nom"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Socket"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Fitxer de blocs especial"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Fitxer de caràcter especial"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Enllaç simbòlic"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Tipus desconegut"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Cerca resultat"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "Cerca"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<Plantilla sense nom"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Escull una carpeta"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "Mo&stra Ajuda per a %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Tot"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr ""
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr ""
#: ulng.rssimplewordcommand
#, fuzzy
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Comandament"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr ""
#: ulng.rssimplewordfiles
msgid "files"
msgstr "Fitxers"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr ""
#: ulng.rssimplewordresult
msgid "Result"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr ""
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr ""
#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr ""
#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr ""
#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr ""
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr ""
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Fitxers: %d, Carpetas: %d, Mida: %s (%s bytes)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "No s'ha pogut Crea carpeta al destí!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Format de Mida incorrecte!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Impossible dividir el fitxer!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "La quantitat de parts es superior a 100! ¿Voleu continuar?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Escull carpeta:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr ""
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr ""
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Error creant l'enllaç simbòlic."
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr "Text per defecte"
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr "Text pla"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr ""
#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Dia(s)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Hora(s)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minut(s)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Mes(es)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Segon(s)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Setmana(s)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Any(s)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr ""
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr ""
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Differ(comparador)"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Error obrint comparador"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Error obrint l'Editor"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Error obrint Terminal"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Error obrint el Visualitzador"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr ""
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Visualitzador"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Si us plau, informeu d'aquest error al programador amb una descripcio del que estaveu fent: %sPremeu %s per continuar o %s per avortar el programa."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr ""
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr ""
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr ""
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr ""
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr ""
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr ""
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr ""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr ""
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr ""
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr ""
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr ""
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr ""
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr ""
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr ""
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr ""
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr ""
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr ""
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr ""
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr ""
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr ""
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr ""
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr ""
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr ""
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr ""
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr ""
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr ""
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr ""
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr ""
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr ""
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr ""
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr ""
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr ""
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr ""
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Xarxa"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Visualitzador intern de Double Commander."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr ""
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Codificant"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr ""
#: ulng.rsviewnewsize
#, fuzzy
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Nova Mida"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s no trobat!"
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr ""
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr ""
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr ""
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr ""