doublecmd/language/doublecmd.da.po
2017-09-19 19:35:04 +00:00

12699 lines
328 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.6.5 beta\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2015-09-13 11:52+ZONE\n"
"Last-Translator: Full Name <Bolle_Barnewitz@sol.dk>\n"
"Language-Team: Language <email@address>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Dansk\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Læser mapper: %d%% (ESC for at afbryde)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr ""
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Filer fundet: %d (Identiske: %d, Forskellige: %d, Unikke venstre: %d, Unikke højre: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Venstre til højre: Kopiér %d fil(er), totalt: %d bytes"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Højre til venstre: Kopiér %d fil(er), totalt: %d bytes"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Vælg skabelon..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Kontrollér ledig &plads"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Kopiér a&ttributter"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Kopiér ejerskab"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopiér &dato/tid"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Korrigér lin&ks"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
msgid "Drop readonly fla&g"
msgstr "Fjern skri&vebeskyttet attribut"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
#, fuzzy
msgctxt "tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption"
msgid "E&xclude empty directories"
msgstr "&Udelad tomme mapper"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Fø&lg links"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "&Reservér plads"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Hvad skal gøres, når filens tid, attributter, etc. ikke kan indstilles"
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Brug filskabelon"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Hvis mappen findes:"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When &file exists"
msgstr "Hvis filen findes:"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Hvis egenskaber ikke kan indstilles:"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<ingen skabelon>"
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr "&Luk"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Kopiér til Udklipsholder"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "Om"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr ""
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr ""
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Hjemmeside"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr ""
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr ""
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr ""
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr ""
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr ""
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Annu&ller"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Nulstil"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Vælg attributter"
#: tfrmattributesedit.cbarchive.caption
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
msgid "&Archive"
msgstr "&Arkiv"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "K&omprimeret"
#: tfrmattributesedit.cbdirectory.caption
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
msgid "&Directory"
msgstr "&Mappe"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "Krypt&eret"
#: tfrmattributesedit.cbhidden.caption
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
msgid "&Hidden"
msgstr "S&kjult"
#: tfrmattributesedit.cbreadonly.caption
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
msgid "Read o&nly"
msgstr "Sk&rivebeskyttet"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "Tyn&d"
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Klæbrig"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Symbolsk link"
#: tfrmattributesedit.cbsystem.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "S&ystem"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "Midler&tidig"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "NTFS-attributter"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Generelle attributter"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bit:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppe"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Andre"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Ejer"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Udfør"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Læs"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Som tekst:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Skriv"
#: tfrmchecksumcalc.caption
#, fuzzy
#| msgid "Calculate check sum..."
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Dan CRC-kontrolsumfil"
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Åbn kontrolsumfil efter opgaven er færdig"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "Dan en &separat kontrolsumfil for hver fil"
#: tfrmchecksumcalc.lblsaveto.caption
#, fuzzy
#| msgid "&Save check sum file(s) to:"
msgid "&Save checksum file(s) to:"
msgstr "Gem kontrol&sum-fil(er) som:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Luk"
#: tfrmchecksumverify.caption
#, fuzzy
#| msgid "Verify check sum..."
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Kontroller kontrolsum"
#: tfrmconnectionmanager.btnadd.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "Tilføj"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "F&orbind"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "Slet"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "R&ediger"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Forbindelsesmanager"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Forbind til:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "&Føj til køen"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "&Indstillinger"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "&Gem indstillingerne som standard"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Kopier fil(er)"
#: tfrmcopydlg.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Ny kø"
#: tfrmcopydlg.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Kø 1"
#: tfrmcopydlg.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Kø 2"
#: tfrmcopydlg.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Kø 3"
#: tfrmcopydlg.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Kø 4"
#: tfrmcopydlg.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Kø 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Gem beskrivelse"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Filkommmentar"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "Re&diger kommentar for:"
#: tfrmdescredit.lblencoding.caption
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "Kod&er:"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "&Om sammenligneren..."
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Sammenlign automatisk"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "&Binær tilstand"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "&Annuller"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "&Annuller"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Kopier blok til &højre"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Kopier blok til højre"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Kopier blok til &venstre"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Kopier blok til venstre"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopier"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Klip"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Slet"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Sæt ind"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Gentag"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Vælg &alle"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Fortryd"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "&Afslut"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "F&ørste forskel"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "tfrmdiffer.actfirstdifference.hint"
msgid "First Difference"
msgstr "Første forskel"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Ignorer forskel på STORE og små bogstaver"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Ignorer tomme felter"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Fortsæt rulning"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "S&idste forskel"
#: tfrmdiffer.actlastdifference.hint
msgctxt "tfrmdiffer.actlastdifference.hint"
msgid "Last Difference"
msgstr "Sidste forskel"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Linjeforskel"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "&Næste forskel"
#: tfrmdiffer.actnextdifference.hint
msgctxt "tfrmdiffer.actnextdifference.hint"
msgid "Next Difference"
msgstr "Næste forskel"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Åbn venstre..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Åbn højre..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Farvet baggrund"
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "&Forrige forskel"
#: tfrmdiffer.actprevdifference.hint
msgctxt "tfrmdiffer.actprevdifference.hint"
msgid "Previous Difference"
msgstr "Forrige forskel"
#: tfrmdiffer.actreload.caption
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
msgid "&Reload"
msgstr "Genindlæs"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Genindlæs"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "&Gem"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "&Gem"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Gem som..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Gem som..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Gem venstre"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Gem venstre"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Gem venstre som..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Gem venstre som..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Gem højre"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Gem højre"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Gem højre som..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Gem højre som..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "&Sammenlign"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Sammenlign"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Koder"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Koder"
#: tfrmdiffer.caption
msgctxt "tfrmdiffer.caption"
msgid "Compare files"
msgstr "Sammenlign indhold"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "Venstre"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "Højre"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "H&andlinger"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Rediger"
#: tfrmdiffer.mnuencoding.caption
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "&Koder"
#: tfrmdiffer.mnufile.caption
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "&Filer"
#: tfrmdiffer.mnuoptions.caption
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
msgid "&Options"
msgstr "&Indstillinger"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Tilføj ny genvej til sekvens"
#: tfrmedithotkey.btncancel.caption
msgctxt "tfrmedithotkey.btncancel.caption"
msgid "&Cancel"
msgstr "Af&bryd"
#: tfrmedithotkey.btnok.caption
msgctxt "tfrmedithotkey.btnok.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Fjern sidste genvej fra sekvens"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
#, fuzzy
msgctxt "tfrmedithotkey.cghkcontrols.caption"
msgid "Only for these controls"
msgstr "Kun for disse kontrolelementer"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parametre (hver i egen linje):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Genveje:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "&Om"
#: tfrmeditor.actabout.hint
msgctxt "tfrmeditor.actabout.hint"
msgid "About"
msgstr "&Om sammenligneren..."
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Indstillinger"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Indstillinger"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "K&opier"
#: tfrmeditor.acteditcopy.hint
msgctxt "tfrmeditor.acteditcopy.hint"
msgid "Copy"
msgstr "Kopier"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "&Klip"
#: tfrmeditor.acteditcut.hint
msgctxt "tfrmeditor.acteditcut.hint"
msgid "Cut"
msgstr "Klip"
#: tfrmeditor.acteditdelete.caption
#, fuzzy
msgctxt "tfrmeditor.acteditdelete.caption"
msgid "Delete"
msgstr "Slet"
#: tfrmeditor.acteditdelete.hint
msgctxt "tfrmeditor.acteditdelete.hint"
msgid "Delete"
msgstr "Slet"
#: tfrmeditor.acteditfind.caption
#, fuzzy
#| msgid "&Find "
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "S&øg..."
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Find"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "&Find næste"
#: tfrmeditor.acteditfindnext.hint
msgctxt "tfrmeditor.acteditfindnext.hint"
msgid "Find next"
msgstr "&Find næste"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr ""
#: tfrmeditor.acteditgotoline.caption
msgctxt "tfrmeditor.acteditgotoline.caption"
msgid "Goto Line..."
msgstr "Gå til linje"
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr ""
#: tfrmeditor.acteditlineendcr.hint
msgctxt "tfrmeditor.acteditlineendcr.hint"
msgid "Mac (CR)"
msgstr ""
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr ""
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
msgid "Windows (CRLF)"
msgstr ""
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr ""
#: tfrmeditor.acteditlineendlf.hint
msgctxt "tfrmeditor.acteditlineendlf.hint"
msgid "Unix (LF)"
msgstr ""
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Sæt i&nd"
#: tfrmeditor.acteditpaste.hint
msgctxt "tfrmeditor.acteditpaste.hint"
msgid "Paste"
msgstr "Sæt ind"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Annuller fortryd"
#: tfrmeditor.acteditredo.hint
msgctxt "tfrmeditor.acteditredo.hint"
msgid "Redo"
msgstr "Annuller fortryd"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Erstat..."
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Erstat"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "&Markér alt"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Vælg alle"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Fo&rtryd"
#: tfrmeditor.acteditundo.hint
msgctxt "tfrmeditor.acteditundo.hint"
msgid "Undo"
msgstr "Fortryd"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Luk"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "&Luk"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Afslut"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Afslut"
#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "&Ny"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Ny"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "Å&bn..."
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Åbn"
#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Gem"
#: tfrmeditor.actfilesave.hint
msgctxt "tfrmeditor.actfilesave.hint"
msgid "Save"
msgstr "&Gem"
#: tfrmeditor.actfilesaveas.caption
#, fuzzy
#| msgid "Save &As.."
msgid "Save &As..."
msgstr "Gem &som..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Gem som"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Gem alle"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Gem alle"
#: tfrmeditor.caption
msgctxt "TFRMEDITOR.CAPTION"
msgid "Editor"
msgstr "Editor"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "&Hjælp"
#: tfrmeditor.menuitem1.caption
#, fuzzy
msgctxt "tfrmeditor.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Rediger"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Koder"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Åbn som"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Gem som"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Filer"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Fremhæv syntaks"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Linjeafslutning"
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n5.caption
msgctxt "tfrmeditor.n5.caption"
msgid "-"
msgstr "-"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
msgid "C&ase sensitivity"
msgstr ""
"Forskel på STORE\n"
"og små &bogstaver\n"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
msgid "S&earch from caret"
msgstr ""
"Søg fra &lodret tegn\n"
"(pipe)\n"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "&Regulære udtryk"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
msgid "Selected &text only"
msgstr "Kun den valgt &tekst"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
msgid "&Whole words only"
msgstr "Kun hele ord"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
msgid "Option"
msgstr "Indstillinger"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
msgid "&Replace with:"
msgstr "E&rstat med:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
msgid "&Search for:"
msgstr "&Søg efter:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
msgid "Direction"
msgstr "Retning"
#: tfrmextractdlg.caption
msgctxt "tfrmextractdlg.caption"
msgid "Unpack files"
msgstr "Udpak filer"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Udpak stinavn, hvis gemt med fil(er)"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Udpak hvert arkiv til en &separate mapper (med navn som arkiv)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "&Overskriv eksisterende filer"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Udpak filer fra arkivet til:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "Fil(er), der skal &pakkes ud: "
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "Adgangskode for krypterede filer:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Luk"
#: tfrmfileexecuteyourself.caption
msgctxt "tfrmfileexecuteyourself.caption"
msgid "Wait..."
msgstr "Vent.."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Filnavn:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "Fra:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Klik på Luk, når den midlertidige fil kan slettes!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&Til handlingsvindue"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Vis alle"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Aktuel handling:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Fra:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Til:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Luk"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "Ind&stil egenskaber"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Indstil &alle valgte filer"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "S&pring filen over"
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr "Egenskaber"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Klæbrig"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Ejer"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bit:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppe:"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Andre:"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Ejer:"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr ""
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Tekst:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "tfrmfileproperties.lblcontains.caption"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Indeholder:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Udfør"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Filnavn"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Navn:"
#: tfrmfileproperties.lblfolder.caption
#, fuzzy
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Placering:"
#: tfrmfileproperties.lblgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
msgid "&Group"
msgstr "Gruppe:"
#: tfrmfileproperties.lbllastaccess.caption
#, fuzzy
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Åbnet:"
#: tfrmfileproperties.lbllastmodif.caption
#, fuzzy
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Ændret:"
#: tfrmfileproperties.lbllaststchange.caption
#, fuzzy
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Attributter ændret:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Oktal:"
#: tfrmfileproperties.lblownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
msgid "O&wner"
msgstr "Ejer:"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Læs"
#: tfrmfileproperties.lblsize.caption
#, fuzzy
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Størrelse:"
#: tfrmfileproperties.lblsymlink.caption
#, fuzzy
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Symlink til:"
#: tfrmfileproperties.lbltype.caption
#, fuzzy
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Filtype:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Skriv"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Navn"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Værdi"
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attributter"
#: tfrmfileproperties.tsimage.caption
msgid "Image"
msgstr ""
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Egenskaber"
#: tfrmfinddlg.actcancel.caption
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "&Annuller"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "&Luk"
#: tfrmfinddlg.actclose.caption
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "&Luk"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Rediger"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "Ko&pier til listboks"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "G&å til fil"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Find data"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "Sidste søg&ning"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "Ny s&øgning"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr ""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr ""
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr ""
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr ""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr ""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Start"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Vis"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Tilfø&j"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Hjælp"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Gem"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "Sl&et"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "&Hent"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "&Gem"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Gem &med \"Start i mappe\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Når der gemmes med \"Start i mappe\" vil afgrænsningen blive gendannet ved indlæsing af skabelon. Brug den, hvis du vil afgrænse søgningen til en bestemt mappe "
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Anvend skabelon"
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Find filer"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr ""
"Forskel på STORE \n"
"og små &bogstaver\n"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "Fra dato:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Til dato:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "&Filstørrelse fra:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "F&ilstørrelse til:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr ""
#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "&Find tekst:"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION"
msgid "Follow s&ymlinks"
msgstr "Følg s&ymbolske links"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "Find filer, der IKKE indeholder &teksten"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Ikke &ældre end:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr ""
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Søg efter en del af fi&lnavnet "
#: tfrmfinddlg.cbregexp.caption
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "&Regulære udtryk"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "Erst&at med:"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Søg kun i &valgte mapper/filer"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "Regulære &udtryk"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "Fra tid:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "Til tid:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "Anvend søge-plug&in:"
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Indtast mappenavnene, som skal udelades i søgningen adskilt med \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Indtast filnavnene, som skal udelades i søgningen adskilt med \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Indtast filnavne adskilt med \";\""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Mapper"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Filer"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Find data"
#: tfrmfinddlg.lblattributes.caption
msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION"
msgid "Attri&butes"
msgstr "A&ttributter"
#: tfrmfinddlg.lblencoding.caption
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
msgid "Encodin&g:"
msgstr "Ko&der:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "Udelad undermapper"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Ud&elad filer"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "Søg &efter:"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Søg &i mappe:"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Søg i under&mapper:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Tidligere søgninger:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr ""
#: tfrmfinddlg.mioptions.caption
#, fuzzy
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Indstillinger"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Fjern fra liste"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.miseparator1.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.miseparator2.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Vis alle fundne elementer"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr ""
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Vis i fremviser"
#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Vis"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Avanceret"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Hent/gem"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Plugins"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Resultater"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Generelt"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "Find"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Find"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "STORE og små bogstaver"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Dan hårdt link"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Destination, som linket skal pege på:"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Navn på linket:"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTALL.CAPTION"
msgid "Import all!"
msgstr "Importér alle"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTIONDONE.CAPTION"
msgid "Import selected"
msgstr "Importér valgte"
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr "Vælg de poster, du vil importere"
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Hvis du klikker på en undermenu, vælges hele menuen"
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Hold CTRL nede og klik på posterne for at vælge dem enkeltvist"
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgctxt "tfrmlinker.caption"
msgid "Linker"
msgstr "Saml filer"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Saml ovenstående filer til"
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Element"
#: tfrmlinker.lblfilename.caption
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "filnavnet:"
#: tfrmlinker.spbtndown.caption
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "Ned"
#: tfrmlinker.spbtndown.hint
#, fuzzy
msgctxt "tfrmlinker.spbtndown.hint"
msgid "Down"
msgstr "Ned"
#: tfrmlinker.spbtnrem.caption
#, fuzzy
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "Fjern"
#: tfrmlinker.spbtnrem.hint
#, fuzzy
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "Slet"
#: tfrmlinker.spbtnup.caption
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "Op"
#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Op"
#: tfrmmain.actabout.caption
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
msgid "&About"
msgstr "&Om Double Commander"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Tilføj filnavn til kommandolinje"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Tilføj sti og filnavn til kommandolinje"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Kopier sti til kommandolinje"
#: tfrmmain.actbriefview.caption
#, fuzzy
#| msgid "Brief"
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr "&Kort visning"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Kort visning"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "B&eregn brugt plads..."
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Skift mappe"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Gå til home-mappen"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Gå til overmappe"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Gå til rod-mappe"
#: tfrmmain.actchecksumcalc.caption
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "&Dan CRC-kontrolsumfil(er)..."
#: tfrmmain.actchecksumverify.caption
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "Kontroller CRC-kontrolsu&m (fra kontrolsum-filer)..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Tøm logfil"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Tøm logvindue"
#: tfrmmain.actclosealltabs.caption
msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION"
msgid "Close &All Tabs"
msgstr "Luk &alle faneblade"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr ""
#: tfrmmain.actclosetab.caption
msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION"
msgid "&Close Tab"
msgstr "Luk faneblad"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Næste kommandolinje"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Indstil kommandolinje til næste kommando i historikken"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Forrige kommandolinje"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Indstil kommandolinje til forrige kommando i historikken"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "&Lang visning"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Kolonnevisning"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Sammenlign &indhold..."
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr "&Sammenlign vinduer"
#: tfrmmain.actcomparedirectories.hint
msgctxt "tfrmmain.actcomparedirectories.hint"
msgid "Compare Directories"
msgstr "Sammenligner vinduerne"
#: tfrmmain.actconfigdirhotlist.caption
#, fuzzy
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Konfiguration af Favoritmapper"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr ""
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr ""
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr ""
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Vis kontekstmenu"
#: tfrmmain.actcopy.caption
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Kopier"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr ""
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Kopiér alle viste &kolonner"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "K&opier filnavn + sti til Udklipsholder"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "&Kopier filnavn til Udklipsholder"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Kopier filer uden bekræftelse"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr ""
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr ""
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Kopier til samme panel"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Kopier"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Vis &brugt plads"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Klip"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr ""
#: tfrmmain.actdelete.caption
#, fuzzy
msgctxt "tfrmmain.actdelete.caption"
msgid "Delete"
msgstr "Slet"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "Mappehistorik"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Favorit&mapper"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr ""
#: tfrmmain.actedit.caption
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Rediger"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Rediger &filkommentar"
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Rediger ny fil"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Rediger stifeltet over fillisten"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Ombyt vind&uer"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "Afslu&t"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "&Udpak filer..."
#: tfrmmain.actfileassoc.caption
#, fuzzy
#| msgid "File &Associations..."
msgid "Configuration of File &Associations"
msgstr "Asso&ciering..."
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "&Saml filer..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "E&genskaber..."
#: tfrmmain.actfilespliter.caption
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
msgid "Spl&it File..."
msgstr "&Opdel fil..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "&Flad visning"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Fokus på kommandolinjen"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Placer markøren på første fil på listen"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Placer markøren på sidste fil på listen"
#: tfrmmain.acthardlink.caption
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
msgid "Create &Hard Link..."
msgstr "Dan et &hårdt link..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Indeks"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "Horisontal visnin&g"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Tastatur"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr ""
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr ""
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Venstre &= Højre"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr ""
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Åbn venstre drevliste"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr ""
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr ""
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr ""
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr ""
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr ""
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr ""
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr ""
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr ""
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "He&nt valg fra Udklipsholder"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "&Hent valg fra fil"
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "Ind&læs faneblade fra fil"
#: tfrmmain.actmakedir.caption
#, fuzzy
#| msgid "MakeDir"
msgid "Create &Directory"
msgstr "Ny mappe"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Vælg alle af samme &type"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "&Inverter valg"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "Vælg &alle"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "In&dskrænk valg..."
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "&Udvid valg..."
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "&Fravælg alle"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimer vindue"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Multi-omd&øbning..."
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Forbind til netværk..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "Afbryd til netværk"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Hurtig netværksforbindelse..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Dublér faneblad"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Skift til næs&te faneblad"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Åbn"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Prøv at åbne arkiv"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Åbn panelfil"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Åbn mappe i et nyt faneblad"
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
msgid "Open &VFS List"
msgstr "Andre Computere"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "&Vis handlinger"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Indstillinger..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "&Pak filer..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Indstil vidueopdelerens position"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "Sæt ind"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Skift til forrige faneblad"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Hurtigt filter"
#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Hurtig søgning"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "&Hurtig visning"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Opdatér vindue"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Flyt"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Flyt/omdøb filer uden at spørge"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Omdøb"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "&Omdøb fane"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Gendan valg"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "O&mvendt sortering"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr ""
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr ""
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Højre &= venstre"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr ""
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Åbn højre drevliste"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr ""
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr ""
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr ""
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr ""
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr ""
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr ""
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr ""
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Åbn terminal (komman&do-prompt)"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr ""
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "G&em valg"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Gem &valg i fil"
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "&Gem faneblad som fil"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "Find fi&ler..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr ""
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr ""
#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "&Ændre attributter..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Lås faneblad med mapper åbnet i nyt faneblad"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normal"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "L&ås faneblad"
#: tfrmmain.actsettaboptionpathresets.caption
#, fuzzy
msgctxt "tfrmmain.actsettaboptionpathresets.caption"
msgid "Locked with &Directory Changes Allowed"
msgstr "Lås faneblad, men &tillad mappeskift"
#: tfrmmain.actshellexecute.caption
msgctxt "tfrmmain.actshellexecute.caption"
msgid "Open"
msgstr "Åbn"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Åbner ved brug af systemassociationer (eksterne programmer)"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Vis knappemenu"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Vis kommandolinjehistorik"
#: tfrmmain.actshowmainmenu.caption
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Menu"
#: tfrmmain.actshowsysfiles.caption
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "Vis skj&ulte/system-filer"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Sortering efter &attributter"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Sorter&ing efter dato"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Sortering efter t&ype"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Sortering efter &navn"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Sortering efter &størrelse"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr ""
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Aktiver/deaktiver filliste for ikke at vist filnavne"
#: tfrmmain.actsymlink.caption
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "Dan symbolsk &link..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr "Synkronisér mapper..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Mål &= kilde"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Ko&ntroller arkiv(er)"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Miniaturebilleder"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Visning af miniaturebilleder"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr ""
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Overfør "
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Flyt mappe under markøren til højre vindue"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr ""
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr ""
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "F&ravælg alle af samme type"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Vis"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Vis historikken for brugte stier i aktivt vindue"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Gå til næste postering i historik"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Gå til forrige postering i historik"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr ""
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "Double Commander på &WWW"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Sikker sletning"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr ""
#: tfrmmain.btnf10.caption
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Afslut"
#: tfrmmain.btnf7.caption
msgctxt "TFRMMAIN.BTNF7.CAPTION"
msgid "Directory"
msgstr "Mappe"
#: tfrmmain.btnf8.caption
msgctxt "tfrmmain.btnf8.caption"
msgid "Delete"
msgstr "Slet"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminal"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*.*"
#: tfrmmain.btnleftdirectoryhotlist.hint
#, fuzzy
#| msgid "Directory hotlist"
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Favoritmapper"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Vis mappen fra det højre vindue i dette vindue"
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
msgid "Go to home directory"
msgstr "Gå til home-mappen"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
msgid "Go to root directory"
msgstr "Gå til roden"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
msgid "Go to parent directory"
msgstr "Gå til overordnet mappe"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*.*"
#: tfrmmain.btnrightdirectoryhotlist.hint
#, fuzzy
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Favoritmappe"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Vis mappen fra det venstre vindue i dette vindue"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "tfrmmain.caption"
msgid "Double Commander"
msgstr ""
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Sti:"
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr ""
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr ""
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr ""
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr ""
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr ""
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr ""
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr ""
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "&Annuller"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Kopier..."
#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Dan link..."
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline10.caption
#, fuzzy
msgctxt "tfrmmain.miline10.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline11.caption
#, fuzzy
msgctxt "tfrmmain.miline11.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline21.caption
#, fuzzy
msgctxt "tfrmmain.miline21.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline23.caption
#, fuzzy
msgctxt "tfrmmain.miline23.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline26.caption
#, fuzzy
msgctxt "tfrmmain.miline26.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline33.caption
msgctxt "tfrmmain.miline33.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline37.caption
#, fuzzy
msgctxt "TFRMMAIN.MILINE37.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline38.caption
msgctxt "TFRMMAIN.MILINE38.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline39.caption
#, fuzzy
msgctxt "tfrmmain.miline39.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline40.caption
#, fuzzy
msgctxt "tfrmmain.miline40.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline50.caption
#, fuzzy
msgctxt "TFRMMAIN.MILINE50.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline55.caption
#, fuzzy
msgctxt "tfrmmain.miline55.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Tøm"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Kopi"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Skjul"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Vælg alle"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Flyt..."
#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Dan symlink..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Faneindstillinger"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "Afslut"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Gendan"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "tfrmmain.mnualloperstart.caption"
msgid "Start"
msgstr "Start"
#: tfrmmain.mnualloperstop.caption
msgctxt "tfrmmain.mnualloperstop.caption"
msgid "Cancel"
msgstr "&Annuller"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Kommandoer"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "&Opsætning"
#: tfrmmain.mnucontextline1.caption
#, fuzzy
msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mnucontextline2.caption
#, fuzzy
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr ""
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Filer"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "&Hjælp"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Markér"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Netværk"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Vis"
#: tfrmmain.mnutaboptions.caption
#, fuzzy
#| msgid "&Options"
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "&Indstillinger"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "F&aner"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Kopier"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Klip"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Slet"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "&Rediger..."
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Sæt ind"
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmaincommandsdlg.btncancel.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmmaincommandsdlg.btnok.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr ""
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr ""
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr ""
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr ""
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr ""
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr ""
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr ""
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Hjælp"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Genvejstast"
#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Tilfø&j"
#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "&Hjælp"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Definer..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Forskel på STORE og små bogstaver"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Angiv filtype:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "Eller vælg fast definition:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Opret ny mappe"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "Ny mappe (directory):"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr "Ny størrelse"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Højde:"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgctxt "tfrmmodview.lblpath2.caption"
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgctxt "tfrmmodview.lblpath3.caption"
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "JPG-komprimering"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Bredde:"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Højde"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Bredde"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Luk"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Slet maske"
#: tfrmmultirename.btnedit.caption
#, fuzzy
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "&Rediger"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "&Indlæs maske"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Start!"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Nulstil alle"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Gem maske"
#: tfrmmultirename.caption
msgctxt "tfrmmultirename.caption"
msgid "MultiRename"
msgstr "Multi-omdøbning"
#: tfrmmultirename.cblog.caption
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "&Aktiver logning"
#: tfrmmultirename.cbregexp.caption
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "Regulære &udtryk"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "Brug su&bstituter"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] &Type"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Definer tæller [C]"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Søg && erstat"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Log-resultat"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Omdøb maske"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Forvalg"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "Fil&type"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "Sø&g efter:"
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "St&ep:"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "Fil&navn"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "Erstat &med:"
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "Start &ved:"
#: tfrmmultirename.lbwidth.caption
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "&Cifre:"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] T&æller"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Dag"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Dag (to cifre)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Ugedag (kort, f.eks. \"man\")"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Ugedag (lang, f.eks. mandag\")"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Tegn ved position x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Tegn fra position x til y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Time"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Time (to cifre)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minut"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minut (to cifre)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Måned"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Måned (to cifre)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Månedsnavn (kort, f.eks. \"jan\")"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Månedsnavn (langt, f.eks. januar\")"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Navn"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Tegn ved position x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Tegn fra position x til y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Tid..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Type..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Navn..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Plugin"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Sekund"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Sekund (to cifre)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] År (to cifre)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] År (fire cifre)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr ""
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr ""
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
msgid "Old File Name"
msgstr "Gammelt navn"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
msgid "New File Name"
msgstr "Nyt navn"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
msgid "File Path"
msgstr "Placering"
#: tfrmmultirenamewait.caption
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr ""
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Åbn med"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Brugerdefineret kommando"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Gem association"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Brug altid det valgte program til at åbne denne type fil"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Filtype som skal åbnes: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Flere filnavne"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr ""
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Flere URL'er"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr ""
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Enkelt filnavn"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr ""
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "Enkelt URL"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr ""
#: tfrmoptions.btnapply.caption
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
msgid "&Apply"
msgstr "&Udfør"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Indstillinger"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Vælg venligst en af undersiderne. Denne side indeholder ingen indstillinger."
#: tfrmoptionsarchivers.btnautoconfig.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNAUTOCONFIG.CAPTION"
msgid "A&uto Configure"
msgstr "A&uto-konfiguration"
#: tfrmoptionsarchivers.btnmultiarcadd.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcadd.caption"
msgid "A&dd"
msgstr "Tilføj"
#: tfrmoptionsarchivers.btnmultiarcapply.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption"
msgid "A&pply"
msgstr "Udfør"
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption"
msgid "D&elete"
msgstr "Sl&et"
#: tfrmoptionsarchivers.btnmultiarcrename.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcrename.caption"
msgid "&Rename"
msgstr "&Start!"
#: tfrmoptionsarchivers.btnrelativearchiver.hint
#, fuzzy
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCDEBUG.CAPTION"
msgid "De&bug mode"
msgstr "Fejlretningstilstand"
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCENABLED.CAPTION"
msgid "E&nabled"
msgstr "Aktiveret"
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCOUTPUT.CAPTION"
msgid "S&how console output"
msgstr "Vi&s konsollens output"
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "tfrmoptionsarchivers.gbarchiveroptions.caption"
msgid "Options"
msgstr "Indstillinger"
#: tfrmoptionsarchivers.lblarchiveadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEADD.CAPTION"
msgid "Add&ing:"
msgstr "Tilføjer:"
#: tfrmoptionsarchivers.lblarchiveextension.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTENSION.CAPTION"
msgid "E&xtension:"
msgstr "Type:"
#: tfrmoptionsarchivers.lblarchiveextract.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTRACT.CAPTION"
msgid "Ex&tract:"
msgstr "Udpak:"
#: tfrmoptionsarchivers.lblarchivelist.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELIST.CAPTION"
msgid "&List:"
msgstr "Op&liste:"
#: tfrmoptionsarchivers.lblarchivelistend.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTEND.CAPTION"
msgid "Listing &finish (optional):"
msgstr "Oplistnings-afslutning (valgfrit):"
#: tfrmoptionsarchivers.lblarchivelistformat.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTFORMAT.CAPTION"
msgid "Listing for&mat:"
msgstr "Oplistnings-format:"
#: tfrmoptionsarchivers.lblarchiveliststart.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTSTART.CAPTION"
msgid "Listin&g start (optional):"
msgstr "Oplistnings-begyndelse (valgfrit):"
#: tfrmoptionsarchivers.lblarchiver.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVER.CAPTION"
msgid "Arc&hiver:"
msgstr "Pakkeprogram:"
#: tfrmoptionsarchivers.lbldescription.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLDESCRIPTION.CAPTION"
msgid "De&scription:"
msgstr "Be&skrivelse:"
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "tfrmoptionsarchivers.tbarchiveradditional.caption"
msgid "Additional"
msgstr "Ekstra"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr "Generelt"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgctxt "tfrmoptionsautorefresh.cbwatchattributeschange.caption"
msgid "When &size, date or attributes change"
msgstr "Når størrelse, dato/tid eller attributter &ændres"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "For de følgende &stier og deres undermapper:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
msgid "When &files are created, deleted or renamed"
msgstr "N&år filer oprettes, slettes eller omdøbes "
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgctxt "tfrmoptionsautorefresh.cbwatchonlyforeground.caption"
msgid "When application is in the &background"
msgstr "Når &Double Commander er i baggrunden"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgctxt "tfrmoptionsautorefresh.gbautorefreshdisable.caption"
msgid "Disable auto-refresh"
msgstr "Slå automatisk opdatering fra"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgctxt "tfrmoptionsautorefresh.gbautorefreshenable.caption"
msgid "Refresh file list"
msgstr "Automatisk opdatering ved ændringer i filsystemet"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
msgid "Al&ways show tray icon"
msgstr "&Vis altid ikon i systembakke"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Skjul automatisk enheder, der ikke længere er monteret (Linux: Unmounted)"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "tfrmoptionsbehavior.cbminimizetotray.caption"
msgid "Mo&ve icon to system tray when minimized"
msgstr "Flyt iko&n til systembakke, når minimeret"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
msgid "A&llow only one copy of DC at a time"
msgstr "&Tillad kun en kopi af Double Commander ad gangen"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Her kan du indtaste et eller flere drev eller mount-points, adskilt med \";\"."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Sortlist følgende drev:"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr ""
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Vis filendelser"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "Justeret (med Tab)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "Umiddelbart efter filnavn"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr ""
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "&Tilpas tekst til kolonnebredde"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "&Horisontale linjer"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "&Vertikale linjer"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "A&uto-fyld kolonner"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Vis gitter i panel"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Indstil kolonnestørrelsen automatisk"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Indstil kolonnestørrelsen automatisk:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "tfrmoptionsconfiguration.btnconfigapply.caption"
msgid "A&pply"
msgstr "Udfør"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "tfrmoptionsconfiguration.btnconfigedit.caption"
msgid "&Edit"
msgstr "&Rediger"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "&Gamle kommandolinjer"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
msgid "&Directory history"
msgstr "Mappehistorik"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "Søge&filterets historik"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "Indstillinger"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "Søg/erstat historik"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Mapper"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Placering af konfigurationsfiler"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Gem ved afslut"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Sorteringsrækkefølge af konfigurationsrækkefølgen i venstre træ"
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Angiv i kommandolinje"
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "P&rogrammappe (transportabel version)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "Br&ugermappe"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Alle"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "&Slet"
#: tfrmoptionscustomcolumns.btnfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr ""
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Ny"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr ""
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr ""
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Omdøb"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Gem som"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "&Gem"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Tillad farveoverlapning"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr ""
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "Generelt"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Markør-grænser"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr ""
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr ""
#: tfrmoptionscustomcolumns.lblbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "&Baggrund:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Baggrund &2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
#, fuzzy
#| msgid "Con&figure columns for file system:"
msgid "Con&figure columns view:"
msgstr "Konfigurer visninger for &filsystem:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr ""
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "&Markørfarve:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Mar&kørskrift:"
#: tfrmoptionscustomcolumns.lblfontname.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Skrifttype"
#: tfrmoptionscustomcolumns.lblfontsize.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Størrelse"
#: tfrmoptionscustomcolumns.lblforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "&Skriftfarve:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "&Valgt farve:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr ""
#: tfrmoptionscustomcolumns.miaddcolumn.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Tilføj kolonne"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Vinduets position efter sammenligning"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr "Tilføj en kopi af den valgte postering"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Tilføj en separator"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr "Tilføj mappe, som jeg indtaster"
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Sammenfold alle"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Slet valgte elementer"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr "Indsæt mappe, som jeg indtaster"
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Åbn alle grene"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Tilføj..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Slet..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Eksportér..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "Hjælp"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Importér..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Sæt ind..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "Forskelligt..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVETARGET.HINT"
msgid "Some functions to select appropriate target"
msgstr "Nogle funktioner til at vælge egnet destination"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Sortering..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "Tilføj også destination, når mappe tilføjes"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Udvid altid træ"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Vis kun gyldige miljøvariabler"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr "I popup vis [også sti]"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRPATH.TEXT"
msgid "Name, a-z"
msgstr "Navn, a-å"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr "Navn, a-å"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Favoritmappe (omsorteret med træk && slip)"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Andre indstillinger"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr "Navn:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr "Sti:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRTARGET.EDITLABEL.CAPTION"
msgid "&Target:"
msgstr "Destination:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "...kun det aktuelle niveau af valgte element(er)"
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHEXIST.CAPTION"
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Skan alle favoritmappers sti for at validere, dem som reelt findes"
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHTARGETEXIST.CAPTION"
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "Skan alle favoritmappers sti && destination for at validere, dem som reelt findes"
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "til en favoritmappe-fil (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "til en \"wincmd.ini\" i TC (beholder eksisterende)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "til en \"wincmd.ini\" i TC (sletter eksisterende)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Gå til konfigurer TC-relateret information"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
msgid "Go to &configure TC related info"
msgstr "Gå til konfigurer TC-relateret information"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "Favoritmappe-testmenu"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "fra en favoritmappe-fil (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "fra \"wincmd.ini\" i TC"
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "Gendan en backup af en favoritmappe"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "Gem en backup af den aktuelle favoritmappe"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...alt, fra A til Å"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "...kun en gruppe af element(er)"
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "...indhold af undermenu(er) valgt, ingen underniveauer"
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "...indhold af undermenu(er) valgt og alle underniveauer"
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MITESTRESULTINGHOTLISTMENU.CAPTION"
msgid "Test resultin&g menu"
msgstr "Menu af testresultat"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr "Tilføjelse fra hovedvindue:"
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Fra alle understøttede formater. Spørg altid, hvilket der skal anvendes"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Når Unicode-tekst skal gemmes, gem i UTF8-format (ellers bliver det som UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Når tekst slippes, generer automatisk filnavn (ellers bliver brugeren sprugt)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Vi&s bekræftelse efter træk && slip"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Når træk && slip bruges:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Placér det mest sandsynlige format i toppen af listen (brug træk && slip):"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(hvis det mest sandsynlige ikke er til stede, tages det næstmestsandsynlige osv.)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(virker ikke med alle kildeprogrammer. Prøv at løse problemet ved at fjerne markering"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Vis &filsystem"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Vis l&edig plads"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
#, fuzzy
msgctxt "tfrmoptionsdriveslistbutton.cbshowlabel.caption"
msgid "Show &label"
msgstr "Vis drevnavn"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Drev-valgboks"
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Baggrund:"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
msgid "Bac&kground"
msgstr "Bag&grund:"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Nulstil"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr "Gem"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Elementets attributter"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Fo&rgrund"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
msgid "Fo&reground"
msgstr "Fo&rgrund:"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "&Tekstmarkering"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Brug (og rediger) &globale skemaindstillinger"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Brug &lokale skemaindstillinger"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgctxt "tfrmoptionseditorcolors.textboldcheckbox.caption"
msgid "&Bold"
msgstr "Fed"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
msgid "In&vert"
msgstr "In&verteret"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgctxt "tfrmoptionseditorcolors.textitaliccheckbox.caption"
msgid "&Italic"
msgstr "Kurs&iv"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
msgid "In&vert"
msgstr "In&verteret"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "Gennem&streget"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
msgid "In&vert"
msgstr "In&verteret"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgctxt "tfrmoptionseditorcolors.textunderlinecheckbox.caption"
msgid "&Underline"
msgstr "Understreget"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "In&verteret"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionsfavoritetabs.btnadd.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr "Tilføj..."
#: tfrmoptionsfavoritetabs.btndelete.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr "Slet..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr ""
#: tfrmoptionsfavoritetabs.btninsert.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr "Sæt ind..."
#: tfrmoptionsfavoritetabs.btnrename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Omdøb"
#: tfrmoptionsfavoritetabs.btnsort.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr "Sortering..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr "Udvid altid træ"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Nej"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr ""
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr "Andre indstillinger"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem1.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr "en separator"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr "en undermenu"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr "Tilføj en undermenu"
#: tfrmoptionsfavoritetabs.micollapseall.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr "Sammenfold alle"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr "...kun det aktuelle niveau af valgte element(er)"
#: tfrmoptionsfavoritetabs.micutselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Klip"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr "slet alle"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr "undermenu og alle dets elementer"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr "kun undermenu men behold element(er)"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr "valgte element"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr "Slet valgte elementer"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr ""
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr "Åbn alle grene"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Sæt ind"
#: tfrmoptionsfavoritetabs.mirename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Omdøb"
#: tfrmoptionsfavoritetabs.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr "...alt, fra A til Å"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr "...kun en gruppe af element(er)"
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr "Sorter kun en gruppe af elemet(er)"
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "...indhold af undermenu(er) valgt, ingen underniveauer"
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "...indhold af undermenu(er) valgt og alle underniveauer"
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr "Menu af testresultat"
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDACT.CAPTION"
msgid "Add"
msgstr "Tilføj"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
msgid "&Add"
msgstr "Tilføj"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
msgid "A&dd"
msgstr "Tilføj"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr ""
#: tfrmoptionsfileassoc.btndownact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNDOWNACT.CAPTION"
msgid "&Down"
msgstr "Ne&d"
#: tfrmoptionsfileassoc.btneditext.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edit"
msgstr "Rediger"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btnremoveact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVEACT.CAPTION"
msgid "Remo&ve"
msgstr "Fjern"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVEEXT.CAPTION"
msgid "Re&move"
msgstr "Fjern"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
msgid "&Remove"
msgstr "Fjern"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNRENAMETYPE.CAPTION"
msgid "R&ename"
msgstr "Omdøb"
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
msgid "&Up"
msgstr "Op"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr ""
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr ""
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "TFRMOPTIONSFILEASSOC.GBACTIONS.CAPTION"
msgid "Actions"
msgstr "Handlinger"
#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "TFRMOPTIONSFILEASSOC.GBEXTS.CAPTION"
msgid "Extensions"
msgstr "Filendelser"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "TFRMOPTIONSFILEASSOC.GBFILETYPES.CAPTION"
msgid "File types"
msgstr "Filtyper"
#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "TFRMOPTIONSFILEASSOC.GBICON.CAPTION"
msgid "Icon"
msgstr "Ikon"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lblaction.caption
#, fuzzy
#| msgid "Action:"
msgctxt "TFRMOPTIONSFILEASSOC.LBLACTION.CAPTION"
msgid "Action name:"
msgstr "Handling:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "TFRMOPTIONSFILEASSOC.LBLCOMMAND.CAPTION"
msgid "&Command:"
msgstr "Kommando:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parametre:"
#: tfrmoptionsfileassoc.lblstartpath.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "&Start-mappe:"
#: tfrmoptionsfileassoc.menuitem1.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr ""
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr ""
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
msgid "Edit"
msgstr "Redigér"
#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIEDITOR.CAPTION"
msgid "Open in Editor"
msgstr "Åben i editor"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr ""
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIGETOUTPUTFROMCOMMAND.CAPTION"
msgid "Get output from command"
msgstr "Tag output fra kommando-prompt"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr ""
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr ""
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
msgid "Open"
msgstr "Åbn"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr ""
#: tfrmoptionsfileassoc.miseparator.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgctxt "TFRMOPTIONSFILEASSOC.MISHELL.CAPTION"
msgid "Run in terminal"
msgstr "Kør i terminal"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
msgid "View"
msgstr "Vis"
#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEWER.CAPTION"
msgid "Open in Viewer"
msgstr "Åbn i fremviser"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr ""
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr ""
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr ""
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr ""
#: tfrmoptionsfileoperations.bvlconfirmations.caption
#, fuzzy
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr "Bed om bekræftelse ved"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Kopiering"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Sletning"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "F8/Delete sletter til &Papirkurv (Shift+F8/Skift+Delete =sletter direkte)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Sl&et til Papirkurv"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
msgid "D&rop readonly flag"
msgstr "Fjern skrivebeskyttelse-attribut"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "Flytning"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "Kopier kommentarer sammen med filer/mapper"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Vælg &filnavn uden endelse ved omdøbning"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Vis &valgboks for faner i kopier/flyt-dialog"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "Ignorer fejl ved operationer og s&kriv dem i log-vindue"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Udfør handlinger"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Brugergrænseflade"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "&Bufferstørrelse for filhandlinger (i kB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Vis handlingernes fremskridt i:"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
#, fuzzy
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr "Stil for auto-omdøbning af dubletter:"
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "A&ntal overskrivninger ved sikker sletning:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "tfrmoptionsfilepanelscolors.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnindbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnindcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr ""
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Tillad farveoverlapning"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Vis markeret kun som ramme"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Anvend flydende farveovergange (grøn - gul - rød)"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "Brug inverteret v&alg"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Markør-grænser"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
msgid "Drive Free Space Indicator"
msgstr "Bar for brugt/ledig plads"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "&Baggrund:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
msgid "Backg&round 2:"
msgstr "Baggrund &2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
msgid "C&ursor Color:"
msgstr "&Markørfarve:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
msgid "Cursor Te&xt:"
msgstr "Mar&kørskrift:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "Lysstyrke i det inaktive vindue"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Farve for le&dig plads:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Farve for brugt plads:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
msgid "&Mark Color:"
msgstr "&Valgt farve:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
msgid "T&ext Color:"
msgstr "&Skriftfarve:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "Sø&g efter en del af filnavnet"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr ""
#: tfrmoptionsfilesearch.gbfilesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Find filer"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr ""
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Brug hukommelses-mapping ved tekstsøgning i filer"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "Br&ug Stream til tekstsøgning i filer"
#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "Tilfø&j"
#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "&Hjælp"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "I&ndlæs ikke filliste førend et faneblad er aktiveret"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "Vis firkantede parenteser [ ] &omkring mappenavne"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Fremhæv nye og ændrede filer"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Tillad øjeblikkelig omdøbning ved dobbeltklik på navn"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
msgid "Load &file list in separate thread"
msgstr "Indlæs &filliste i separat tråd"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
msgid "Load icons af&ter file list"
msgstr "Indlæs ikoner ef&ter filliste"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
msgid "Show s&ystem and hidden files"
msgstr "Vis &skjulte/system-filer (kun for eksperter!)"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Når valgt med <mellemrum>, flyt ned til næste fil (som med <insert>)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independant attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formater"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgctxt "tfrmoptionsfilesviews.gbsorting.caption"
msgid "Sorting"
msgstr "Sortering"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr ""
"Forskel på STORE \n"
"og små &bogstaver:\n"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Forkert format"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "&Dato- og tidsformat:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Vis &filstørrelse i:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "&Indsæt nye filer:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.lblsortfoldermode.caption"
msgid "So&rting directories:"
msgstr "So&rter mapper:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "Sorteringsme&tode:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "Flyt ændrede filer:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "tfrmoptionsfiletypescolors.btnaddcategory.caption"
msgid "A&dd"
msgstr "Tilføj"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "tfrmoptionsfiletypescolors.btnapplycategory.caption"
msgid "A&pply"
msgstr "Udfør"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "tfrmoptionsfiletypescolors.btncategorycolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "tfrmoptionsfiletypescolors.btndeletecategory.caption"
msgid "D&elete"
msgstr "Sl&et"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
msgid "Template..."
msgstr "Skabelon..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Filtypers farver (sortér med træk && slip)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "Kategori-&attributter:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Katergori-farve:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
msgid "Category &mask:"
msgstr "Katergori-filter:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr "Kategori-&navn:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "tfrmoptionsfonts.btnseleditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "tfrmoptionsfonts.btnsellogfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "tfrmoptionsfonts.btnselmainfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "tfrmoptionsfonts.btnselviewerbookfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "tfrmoptionsfonts.btnselviewfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr ""
#: tfrmoptionsfonts.lbleditorfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
msgid "&Editor font"
msgstr "Intern &editors (F4) skrifttype:"
#: tfrmoptionsfonts.lbllogfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
msgid "&Log font"
msgstr "&Log-skrifttype:"
#: tfrmoptionsfonts.lblmainfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
msgid "Main &font"
msgstr "&Fillister:"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr ""
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr ""
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
msgid "Viewer&Book Font"
msgstr "&Bogviserens skrifttype:"
#: tfrmoptionsfonts.lblviewerfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
msgid "&Viewer font"
msgstr "Frem&viserens (F3) skrifttype:"
#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Tilføj genvejstast"
#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Kopier"
#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Slet"
#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "Slet genvejstast"
#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "Rediger genvejstast"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Omdøb"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
msgid "&Filter"
msgstr "&Filter:"
#: tfrmoptionshotkeys.lblcategories.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION"
msgid "C&ategories:"
msgstr "K&ategorier:"
#: tfrmoptionshotkeys.lblcommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION"
msgid "Co&mmands:"
msgstr "Ko&mmandoer:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
msgid "&Shortcut files:"
msgstr "Fil for genvej&staster:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Kommando"
#: tfrmoptionshotkeys.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "tfrmoptionsicons.cbiconsexclude.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "For de følgende &stier og deres undermapper:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Vis ikoner ud for punkter i &hovedmenuen"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
msgid "16x16"
msgstr ""
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
msgid "Show o&verlay icons, e.g. for links"
msgstr "Vis overlæg til ikoner, (f.eks. &pile ved links)"
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Slå specielle ikoner fra"
#: tfrmoptionsicons.gbiconssize.caption
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
msgid " Icon size "
msgstr "Ikonstørrelse "
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "tfrmoptionsicons.gbshowiconsmode.caption"
msgid " Show icons to the left of the filename "
msgstr "Vis ikoner til venstre for filnavnet"
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
msgid "A&ll"
msgstr "A&lle"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "tfrmoptionsicons.rbiconsshowallandexe.caption"
msgid "All associated + &EXE/LNK (slow)"
msgstr "&Alle associerede filer inkl. EXE/LNK (langsomt)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "tfrmoptionsicons.rbiconsshownone.caption"
msgid "&No icons"
msgstr "Ingen ik&oner"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
msgid "Only &standard icons"
msgstr "&Kun standardikoner"
#: tfrmoptionsignorelist.btnaddsel.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
msgid "A&dd selected names"
msgstr "Tilføj valgte navne"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "tfrmoptionsignorelist.btnaddselwithpath.caption"
msgid "Add selected names with &full path"
msgstr "Tilføj valgte navne med hele stien"
#: tfrmoptionsignorelist.btnrelativesavein.hint
#, fuzzy
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "tfrmoptionsignorelist.chkignoreenable.caption"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignorer (vis ikke) følgende filer og mapper:"
#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "tfrmoptionsignorelist.lblsavein.caption"
msgid "&Save in:"
msgstr "&Gem i:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Venstre- hhv. højrepil skifter mellem mapper (Linux-agtig navigation)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Tastning"
#: tfrmoptionskeyboard.lblalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
msgid "Alt+L&etters:"
msgstr "Alt+bogstav&er:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+bogs&taver:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
msgid "&Letters:"
msgstr "Bogstaver:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr "Fla&de ikoner"
#: tfrmoptionslayout.cbflatinterface.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
msgid "Flat i&nterface"
msgstr "Flad &brugerflade"
#: tfrmoptionslayout.cbflattoolbar.caption
msgctxt "tfrmoptionslayout.cbflattoolbar.caption"
msgid "Flat b&uttons"
msgstr "Flade iko&ner"
#: tfrmoptionslayout.cbfreespaceind.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
msgid "Show fr&ee space indicator on drive label"
msgstr "Vis bar for ledig plads på drevknap"
#: tfrmoptionslayout.cblogwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
msgid "Show lo&g window"
msgstr "Vis lo&g-vindue"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "tfrmoptionslayout.cbpanelofoperations.caption"
msgid "Show panel of operation in background"
msgstr "Vis &handlingsvindue i baggrund"
#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "tfrmoptionslayout.cbproginmenubar.caption"
msgid "Show common progress in menu bar"
msgstr "Vis fremskridt i menulin&je"
#: tfrmoptionslayout.cbshowcmdline.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
msgid "Show command l&ine"
msgstr "Vis k&ommandolinje"
#: tfrmoptionslayout.cbshowcurdir.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
msgid "Show current director&y"
msgstr "Vis &aktuel mappe"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "tfrmoptionslayout.cbshowdiskpanel.caption"
msgid "Show &drive buttons"
msgstr "Vis dr&ev-knapper"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
msgid "Show free s&pace label"
msgstr "Vis tal for ledig &plads på drevknap"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Vis drev-&valgboks"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
msgid "Show function &key buttons"
msgstr "Vis knappanel for &funktionstaster"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
msgid "Show &main menu"
msgstr "Vis &menulinje"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
#, fuzzy
#| msgid "Show &button bar"
msgctxt "tfrmoptionslayout.cbshowmaintoolbar.caption"
msgid "Show tool&bar"
msgstr "Vis &knappanel"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Vis tal for ledig plads p&å drevknap (kort visning)"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "tfrmoptionslayout.cbshowstatusbar.caption"
msgid "Show &status bar"
msgstr "Vis &statuslinje"
#: tfrmoptionslayout.cbshowtabheader.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
msgid "S&how tabstop header"
msgstr "Vis &tabulatorlinje"
#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "tfrmoptionslayout.cbshowtabs.caption"
msgid "Sho&w folder tabs"
msgstr "Vis faneb&lade"
#: tfrmoptionslayout.cbtermwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
msgid "Show te&rminal window"
msgstr "Vis te&rminalvindue"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "V&is to knappaneler for drev (fast bredde, over filvindue)"
#: tfrmoptionslayout.gbscreenlayout.caption
#, fuzzy
msgctxt "tfrmoptionslayout.gbscreenlayout.caption"
msgid " Screen layout "
msgstr "Skærmlayout"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Se indholdet af logfilen"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Medtag dato i logfilens navn"
#: tfrmoptionslog.cblogarcop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
msgid "&Pack/Unpack"
msgstr "&Pakning/Udpakning/Test af pakkede filer"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr ""
#: tfrmoptionslog.cblogcpmvln.caption
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
msgid "Cop&y/Move/Create link/symlink"
msgstr "&Kopiering/Flytning/Oprettelse af link && symlink"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "tfrmoptionslog.cblogdelete.caption"
msgid "&Delete"
msgstr "&Slet"
#: tfrmoptionslog.cblogdirop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
msgid "Crea&te/Delete directories"
msgstr "Oprettelse/Sletning af &mapper"
#: tfrmoptionslog.cblogerrors.caption
msgctxt "tfrmoptionslog.cblogerrors.caption"
msgid "Log &errors"
msgstr "Log &fejl"
#: tfrmoptionslog.cblogfile.caption
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
msgid "C&reate a log file:"
msgstr "&Opret en logfil i:"
#: tfrmoptionslog.cbloginfo.caption
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
msgid "Log &information messages"
msgstr "Log informationsmeddelelser"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Start/luk ned"
#: tfrmoptionslog.cblogsuccess.caption
msgctxt "tfrmoptionslog.cblogsuccess.caption"
msgid "Log &successful operations"
msgstr "Log su&ccesfulde operationer"
#: tfrmoptionslog.cblogvfs.caption
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
msgid "&File system plugins"
msgstr "Fils&ystem-plugins"
#: tfrmoptionslog.gblogfile.caption
msgctxt "tfrmoptionslog.gblogfile.caption"
msgid "File operation log file"
msgstr "Logfil for filoperationer"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Log følgende operationer"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Log følgende udfald"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
#, fuzzy
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Fjern miniaturebilleder for slettede filer"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
msgid "View log file content"
msgstr "Vis logfilens indhold"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
msgid "Create new with the encoding:"
msgstr ""
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Gå &altid til drevets rod ved skift af drev"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgctxt "tfrmoptionsmisc.chkshowwarningmessages.caption"
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Vis advarsler (kun med \"OK\"-knappen)"
#: tfrmoptionsmisc.chkthumbsave.caption
msgctxt "tfrmoptionsmisc.chkthumbsave.caption"
msgid "&Save thumbnails in cache"
msgstr "Gem miniaturebilleder i cache"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
msgid "Thumbnails"
msgstr "Miniaturebilleder"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr ""
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "Angående TC-eksport/-import"
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
msgid "Default encoding:"
msgstr ""
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Konfigurationsfil:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "TC exe-fil:"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Sti til værktøjslinjens output:"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "pixel"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Bredde x højde:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "Valg med mus"
#: tfrmoptionsmouse.gbscrolling.caption
msgctxt "tfrmoptionsmouse.gbscrolling.caption"
msgid "Scrolling"
msgstr "Rulning med musehjul"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Valg"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "Tilstand:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "Antal linje(r) ad gangen:"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Én linje ad gangen, markøren følger med"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "Én side ad gangen"
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "Tilføj"
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "Konfigurer"
#: tfrmoptionsplugins.btnenableplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
msgid "E&nable"
msgstr "Aktiver"
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "Fjern"
#: tfrmoptionsplugins.btntweakplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
msgid "&Tweak"
msgstr "Tilpas"
#: tfrmoptionsplugins.lbldsxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Søge-plugins giver mulighed for alternative søgealgoritmer eller eksterne værktøjer (som \"locate\", etc.)"
#: tfrmoptionsplugins.lblwcxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
msgid "Pack&er plugins are used to work with archives"
msgstr "Pakke-plugins bruges til at åbne arkivtyper, som ikke er understøttet af Double Commander internt."
#: tfrmoptionsplugins.lblwdxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Indholds-plugins tillader at vise udvidede fildetaljer f.eks. mp3-tags eller fotooplysninger i fillister. Kan bruges i søgning og multi-omdøbning."
#: tfrmoptionsplugins.lblwfxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Filsystem-plugins giver adgang til diske, som er utilgængelige for operativsystemet eller til eksterne enheder som Palm/PocketPC."
#: tfrmoptionsplugins.lblwlxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Lister-pluins giver mulighed for at vise dataformater som f.eks. billeder, regneark, databaser etc. i Vis (F3, Ctrl+Q)."
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Aktiv"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[1].title.caption"
msgid "Plugin"
msgstr "Plugin"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Associer med"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[3].title.caption"
msgid "File name"
msgstr "Navn:"
#: tfrmoptionsplugins.tsdsx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
msgid "&Search plugins (.DSX)"
msgstr "Søge-plugins (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
msgid "Pac&ker plugins (.WCX)"
msgstr "Pakke-plugins (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
msgid "Content pl&ugins (.WDX)"
msgstr "Indholds-plugins (.WDX)"
#: tfrmoptionsplugins.tswfx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
msgid "F&ile system plugins (.WFX)"
msgstr "Filsystem-plugins (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
msgid "&Viewer plugins (.WLX)"
msgstr "Liste-plugins (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "tfrmoptionsquicksearchfilter.cbexactbeginning.caption"
msgid "&Beginning (name must start with first typed character)"
msgstr "&I starten (navnet skal starte med første indtastede tegn)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "tfrmoptionsquicksearchfilter.cbexactending.caption"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "I slut&ningen (sidste tegn før et punktum . skal matche)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "tfrmoptionsquicksearchfilter.cgpoptions.caption"
msgid "Options"
msgstr "Indstillinger"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Præcis navne-match"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "STORE og små bogstaver"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Søg efter disse elementer"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr ""
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "tfrmoptionstabs.cbtabsactivateonclick.caption"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Aktiver fil&panel ved klik på fane"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "tfrmoptionstabs.cbtabsalwaysvisible.caption"
msgid "&Show tab header also when there is only one tab"
msgstr "Vis fane, selv om der kun er &et enkelt faneblad"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr ""
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
msgid "Con&firm close all tabs"
msgstr "Bekræft lukning af &alle faner"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr ""
#: tfrmoptionstabs.cbtabslimitoption.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
msgid "&Limit tab title length to"
msgstr "&Begræns tekst på faner til:"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "tfrmoptionstabs.cbtabslockedasterisk.caption"
msgid "Show locked tabs &with an asterisk *"
msgstr "&Markér låste faneblade med stjerne (*) på fanen"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "tfrmoptionstabs.cbtabsmultilines.caption"
msgid "&Tabs on multiple lines"
msgstr "Tillad visning af faner på flere &linjer"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "tfrmoptionstabs.cbtabsopenforeground.caption"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+Op åbner nyt faneblad i &forgrunden"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "tfrmoptionstabs.cbtabsopennearcurrent.caption"
msgid "Open &new tabs near current tab"
msgstr "Åbn &nye faneblade ved siden af aktive fane"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr ""
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
msgid "Show ta&b close button"
msgstr "Vis luk-knap på fane"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr ""
#: tfrmoptionstabs.gbtabs.caption
msgctxt "tfrmoptionstabs.gbtabs.caption"
msgid "Folder tabs headers"
msgstr "Faner"
#: tfrmoptionstabs.lblchar.caption
msgctxt "tfrmoptionstabs.lblchar.caption"
msgid "characters"
msgstr "tegn"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr ""
#: tfrmoptionstabs.lbltabsposition.caption
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
msgid "Ta&bs position"
msgstr "Tabulatorposition:"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
#, fuzzy
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Nej"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr ""
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr ""
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr ""
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr ""
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr ""
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Kommando:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Parametre:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Kommando:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Parametre:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Kommando:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Parametre:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "K&lon knap"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
msgid "&Delete"
msgstr "&Slet"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION"
msgid "Edit hot&key"
msgstr "Rediger genvejstast"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgctxt "tfrmoptionstoolbar.btninsertbutton.caption"
msgid "&Insert new button"
msgstr "&Indsæt ny knap"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr ""
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Andre..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION"
msgid "Remove hotke&y"
msgstr "Fjern genvejstast"
#: tfrmoptionstoolbar.btnstartpath.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr ""
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "Fla&de ikoner"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Rapportér fejl med kommandolinje"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Indtast kommandoparamertre, kun én pr. linje. Tryk F1 for mere hjælp til prametre."
#: tfrmoptionstoolbar.gbgroupbox.caption
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
msgid "Appearance"
msgstr "Udseende"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "St&ørrelse på panelet:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION"
msgid "Comman&d:"
msgstr "Komman&do:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parametre:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr "Hjælp"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Genvejstast:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Iko&n:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Størrelse på ik&on:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "Ko&mmando:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "&Parametre:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "&Start-mappe:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgctxt "tfrmoptionstoolbar.lbltooltip.caption"
msgid "&Tooltip:"
msgstr "&Ballon-hjælp:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr ""
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "for en ekstern kommando"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "for en intern kommando"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "for en separator"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "for en under-værktøjslinje"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr ""
#: tfrmoptionstoolbar.miexport.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr "Eksportér..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Aktuel værktøjslinje"
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
msgid "to a Toolbar File (.toolbar)"
msgstr "til en værktøjslinjefil (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
msgid "to a TC .BAR file (keep existing)"
msgstr "til en TC .BAR-fil (beholder eksisterende)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
msgid "to a TC .BAR file (erase existing)"
msgstr "til en TC .BAR-fil (sletter eksisterende)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "til en \"wincmd.ini i TC (beholder eksisterende)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "til en \"wincmd.ini\" i TC (sletter eksisterende)"
#: tfrmoptionstoolbar.miexportseparator1.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Øverste værktøjslinje..."
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Gem en backup af værktøjslinjen"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "til en værktøjslinjefil (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "til en TC .BAR-fil (beholder eksisterende)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "til en TC .BAR-fil (sletter eksisterende)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "til en \"wincmd.ini\" i TC (beholder eksisterende)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "til en \"wincmd.ini\" i TC (sletter eksisterende)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "lige efter aktuelle valg"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "som første element"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "som sidste element"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "lige før aktuelle valg"
#: tfrmoptionstoolbar.miimport.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr "Importér..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Gendan en backup af værktøjslinjen"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "for at tilføje til aktuelle værktøjslinje"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
#, fuzzy
#| msgid "to add to a new toobar to current toolbar"
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "for at tilføje en ny værktøjslinje til aktuelle værktøjslinje"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "for at tilføje en ny værktøjslinje til øverste værktøjslinje"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "for at tilføje til øverste værktøjslinje"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "for at erstatte øverste værktøjslinje"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "fra en værktøjslinjefil (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "for at tilføje til aktuelle værktøjslinje"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "for at tilføje en ny værktøjslinje til aktuelle værktøjslinje"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "for at tilføje en ny værktøjslinje til øverste værktøjslinje"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "for at tilføje til øverste værktøjslinje"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "for at erstatte øverste værktøjslinje"
#: tfrmoptionstoolbar.miimportseparator.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "fra en enkelt TC .BAR-fil"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "for at tilføje til aktuelle værktøjslinje"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
#, fuzzy
#| msgid "to add to a new toobar to current toolbar"
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "for at tilføje en ny værktøjslinje til aktuelle værktøjslinje"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "for at tilføje en ny værktøjslinje til øverste værktøjslinje"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "for at tilføje til øverste værktøjslinje"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "for at erstatte øverste værktøjslinje"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "fra \"wincmd.ini\" i TC..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "for at tilføje til aktuelle værktøjslinje"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
#, fuzzy
#| msgid "to add to a new toobar to current toolbar"
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "for at tilføje en ny værktøjslinje til aktuelle værktøjslinje"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "for at tilføje en ny værktøjslinje til øverste værktøjslinje"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "for at tilføje til øverste værktøjslinje"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "for at erstatte øverste værktøjslinje"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "lige efter aktuelle valg"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "som første element"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "som sidste element"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "lige før aktuelle valg"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr ""
#: tfrmoptionstoolbar.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
#, fuzzy
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "lige efter aktuelle valg"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "som første element"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "som sidste element"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "lige før aktuelle valg"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr ""
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr ""
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "lige efter aktuelle valg"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "som første element"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "som sidste element"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "lige før aktuelle valg"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Knaptype"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
#, fuzzy
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "Bevar terminalvindue åbent efter udførelse af program"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "Udfør i t&erminal"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "Brug &eksternt program"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "Ekstra parametre:"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "Sti til det eksterne program:"
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "Tilføj"
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "Udfør"
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "Slet"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Skabelon..."
#: tfrmoptionstooltips.chkshowtooltip.caption
#, fuzzy
#| msgid "Show tool tip"
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
msgid "&Show tooltip for files in the file panel"
msgstr "Værktøjshjælp"
#: tfrmoptionstooltips.gbcustomfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
msgid "Custom fields by file type"
msgstr "Tilpas felter efter filtype"
#: tfrmoptionstooltips.lblfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Kategori-tip:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Kategori-filter:"
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "Kategori-navn:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "&Markørfarve:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "tfrmoptionsviewer.btnbackviewercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "tfrmoptionsviewer.btnfontviewercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgctxt "tfrmoptionsviewer.gbviewerbookmode.caption"
msgid "Viewer Book Mode"
msgstr "Bogvisning"
#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "tfrmoptionsviewer.gbviewerexample.caption"
msgid "Example"
msgstr "Eksempel"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "&Baggrundsfarve for bogvisning:"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "Skriftfarve i bogvisning:"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "A&ntal kolonner i bogvisning:"
#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "&Indstillinger"
#: tfrmpackdlg.caption
msgctxt "tfrmpackdlg.caption"
msgid "Pack files"
msgstr "Pak filer"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Dan &separate arkiver, ét for hver valgt fil/mappe"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "&Dan selvudpakkende arkiv"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "&Kryptér"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Fl&yt til arkiv"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Fordel arkiv over flere diske"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr ""
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "Ko&m i TAR-arkivet først"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Gem &også sti (kun rekursivt)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Pak fil(er) i arkivet:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Pakkeprogram"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Luk"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Udpak &alle og udfør"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "&Udpak og udfør"
#: tfrmpackinfodlg.caption
msgctxt "tfrmpackinfodlg.caption"
msgid "Properties of packed file"
msgstr "Egenskaber for pakket fil"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Attributter:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Komprimering:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Dato"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Metode"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Oprindelig størrelse:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Fil:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Pakket størrelse:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Pakkeprogram:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Tid:"
#: tfrmquicksearch.btncancel.caption
msgctxt "tfrmquicksearch.btncancel.caption"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Luk filtervindue"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Indtast teksten, som der søges eller filteres efter"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr ""
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Forskel på STORE og små bogstaver"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "M"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Mapper"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr ""
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Filer"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr ""
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Matcher begyndelsen"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr ""
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Match slutningen"
#: tfrmquicksearch.tglfilter.caption
msgctxt "tfrmquicksearch.tglfilter.caption"
msgid "Filter"
msgstr "Filter:"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Skift mellem søgning eller filtrering"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "Flere regler"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "Færre regler"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Anvend indholds-plugin. Kombinér med:"
#: tfrmsearchplugin.headercontrol.sections[0].text
#, fuzzy
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
msgid "Plugin"
msgstr "Plugin"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Felt"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[3].TEXT"
msgid "Value"
msgstr "Værdi"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&AND (alle operatorer er sande el. falske)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&OR (mindst én operator er sand el. falsk)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "tfrmselecttextrange.btppanel.cancelbutton.caption"
msgid "Cancel"
msgstr "&Annuller"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "tfrmselecttextrange.btppanel.closebutton.caption"
msgid "&Close"
msgstr "&Luk"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "tfrmselecttextrange.btppanel.helpbutton.caption"
msgid "&Help"
msgstr "&Hjælp"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "Vælg bog&staverne, som skal indsættes:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsetfileproperties.caption
msgctxt "tfrmsetfileproperties.caption"
msgid "Change attributes"
msgstr "Ændre attributter"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr ""
"SGIDS&GID\n"
"(Set group id)\n"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Stic&ky"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr ""
"SUID&SUID\n"
"(Set user id)\n"
#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "&a Arkiv"
#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Oprettet:"
#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "&h Skjult"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Åbnet:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Ændret:"
#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "&r Skrivebeskyttet"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Medtag filer i &undermapper"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "&s System"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Ændre dato/tid"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Ændre attributter "
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attributter"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bit"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppe"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(gråt=uændret, markeret=sæt attribut)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Andre"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Ejer"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr ""
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Tekst:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Udfør"
#: tfrmsetfileproperties.lblmodeinfo.caption
#, fuzzy
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(gråt=uændret, markeret=sæt attribut)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Oktal:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Læs"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Skriv"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Nogle funktioner til at vælge egnet sti"
#: tfrmsplitter.caption
msgctxt "tfrmsplitter.caption"
msgid "Splitter"
msgstr "Opdel fil"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Der behøves en CRC32 verifikationsfil"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1,44 MB - 3,5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Filnavn"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Størrelse og antal dele"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "Opdel filen til mappen:"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Kildefil:"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "Antal dele:"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr ""
#: tfrmsplitter.rbtngigab.caption
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr ""
#: tfrmsplitter.rbtnkilob.caption
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr ""
#: tfrmsplitter.rbtnmegab.caption
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr ""
#: tfrmstartingsplash.caption
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
msgid "Double Commander"
msgstr ""
#: tfrmstartingsplash.lblbuild.caption
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
msgid "Build"
msgstr ""
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
msgid "Free Pascal"
msgstr ""
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
msgid "Lazarus"
msgstr ""
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Operativsystem"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr ""
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr ""
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr ""
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr ""
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Dan symbolsk link"
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Destination, som linket skal pege på:"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Navn på linket:"
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr "&Luk"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr "&Sammenlign..."
#: tfrmsyncdirsdlg.btnseldir1.caption
#, fuzzy
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
#, fuzzy
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "S&ynkroniser..."
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Synkroniser mapper"
#: tfrmsyncdirsdlg.cbextfilter.text
#, fuzzy
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "&Asymetrisk"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "&Efter indhold"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "&Ignorer dato"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "&Kun valgte"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "&Undermapper"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Vis"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Navn"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Størrelse"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Dato"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Dato"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Størrelse"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Navn"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(i hovedvindue)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
msgid "Compare"
msgstr "Sammenlign"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Vis venstre"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Vis højre"
#: tfrmsyncdirsdlg.sbcopyleft.caption
#, fuzzy
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
#, fuzzy
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "Dubletter"
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr ""
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr "≠"
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "Unikke"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Klik venligst \"Sammenlign\" for at starte"
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr "Synkronisering"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Bekræft overskrivning"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr ""
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr ""
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "Tilføj nyt"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuller"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "Ændr"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Standard"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "Fjern"
#: tfrmtweakplugin.caption
msgctxt "tfrmtweakplugin.caption"
msgid "Tweak plugin"
msgstr "Tilpas-plugin"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Bestem arkivtype efter indhold"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Kunne ikke slette filer"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Understøtter kryptering"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Vis som normale filer (skjul pakke-ikon)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Understøtter komprimering i hukommelsen"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Kan ændre eksisterende arkiver"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "Arkiv kan indeholde flere filer"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Kan oprette nye arkiver"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "Understøtter indstillings-dialogboks"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Tillad tekstsøgning i arkiver"
#: tfrmtweakplugin.lbldescription.caption
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "Beskrivelse:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "Registrer streng:"
#: tfrmtweakplugin.lblextension.caption
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "Type:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Flag"
#: tfrmtweakplugin.lblname.caption
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "Navn:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr ""
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr ""
#: tfrmviewer.actabout.caption
msgctxt "tfrmviewer.actabout.caption"
msgid "About Viewer..."
msgstr "Om fremviseren..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Vis \"Om\" dialogen"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "tfrmviewer.actcopyfile.caption"
msgid "Copy File"
msgstr "Kopier fil"
#: tfrmviewer.actcopyfile.hint
msgctxt "tfrmviewer.actcopyfile.hint"
msgid "Copy File"
msgstr "Kopier fil"
#: tfrmviewer.actcopytoclipboard.caption
#, fuzzy
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Kopier til Udklipsholder"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr ""
#: tfrmviewer.actdeletefile.caption
msgctxt "tfrmviewer.actdeletefile.caption"
msgid "Delete File"
msgstr "Slet fil"
#: tfrmviewer.actdeletefile.hint
msgctxt "tfrmviewer.actdeletefile.hint"
msgid "Delete File"
msgstr "Slet fil"
#: tfrmviewer.actexitviewer.caption
#, fuzzy
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "Afslut"
#: tfrmviewer.actfind.caption
#, fuzzy
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Find"
#: tfrmviewer.actfindnext.caption
#, fuzzy
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "&Find næste"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr ""
#: tfrmviewer.actfullscreen.caption
#, fuzzy
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Fuldskærm"
#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr ""
#: tfrmviewer.actloadnextfile.caption
msgctxt "tfrmviewer.actloadnextfile.caption"
msgid "&Next"
msgstr "&Næste"
#: tfrmviewer.actloadnextfile.hint
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT"
msgid "Load Next File"
msgstr "Indlæs næste fil"
#: tfrmviewer.actloadprevfile.caption
msgctxt "tfrmviewer.actloadprevfile.caption"
msgid "&Previous"
msgstr "&Forrige"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Indlæs forrige fil"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr ""
#: tfrmviewer.actmirrorhorz.hint
#, fuzzy
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr "Spejlvend"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr ""
#: tfrmviewer.actmovefile.caption
msgctxt "tfrmviewer.actmovefile.caption"
msgid "Move File"
msgstr "Flyt fil"
#: tfrmviewer.actmovefile.hint
msgctxt "tfrmviewer.actmovefile.hint"
msgid "Move File"
msgstr "Flyt fil"
#: tfrmviewer.actpreview.caption
#, fuzzy
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Preview"
#: tfrmviewer.actreload.caption
msgctxt "tfrmviewer.actreload.caption"
msgid "Reload"
msgstr "Genindlæs"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Genindlæs aktuel fil"
#: tfrmviewer.actrotate180.caption
#, fuzzy
#| msgid "Rotate 180"
msgctxt "tfrmviewer.actrotate180.caption"
msgid "+ 180"
msgstr "Rotér 180°"
#: tfrmviewer.actrotate180.hint
#, fuzzy
#| msgid "Rotate 180"
msgctxt "tfrmviewer.actrotate180.hint"
msgid "Rotate 180 degrees"
msgstr "Rotér 180°"
#: tfrmviewer.actrotate270.caption
#, fuzzy
#| msgid "Rotate 270"
msgctxt "tfrmviewer.actrotate270.caption"
msgid "- 90"
msgstr "Rotér 270°"
#: tfrmviewer.actrotate270.hint
#, fuzzy
#| msgid "Rotate 270"
msgctxt "tfrmviewer.actrotate270.hint"
msgid "Rotate -90 degrees"
msgstr "Rotér 270°"
#: tfrmviewer.actrotate90.caption
#, fuzzy
#| msgid "Rotate 90"
msgctxt "tfrmviewer.actrotate90.caption"
msgid "+ 90"
msgstr "Rotér 90°"
#: tfrmviewer.actrotate90.hint
#, fuzzy
#| msgid "Rotate 90"
msgctxt "tfrmviewer.actrotate90.hint"
msgid "Rotate +90 degrees"
msgstr "Rotér 90°"
#: tfrmviewer.actsave.caption
#, fuzzy
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "&Gem"
#: tfrmviewer.actsaveas.caption
msgctxt "tfrmviewer.actsaveas.caption"
msgid "Save As..."
msgstr "Gem &som..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Gemmer filen som..."
#: tfrmviewer.actscreenshot.caption
#, fuzzy
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Tag et skærmbillede"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr ""
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr ""
#: tfrmviewer.actselectall.caption
#, fuzzy
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Vælg &alt"
#: tfrmviewer.actshowasbin.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "Binær (fast linjelængde)"
#: tfrmviewer.actshowasbook.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "B&og"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr ""
#: tfrmviewer.actshowashex.caption
#, fuzzy
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "Hex"
#: tfrmviewer.actshowastext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "Kun tekst"
#: tfrmviewer.actshowaswraptext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "Ombryd tekst"
#: tfrmviewer.actshowgraphics.caption
#, fuzzy
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Billede/multimedie"
#: tfrmviewer.actshowplugins.caption
#, fuzzy
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Plugin"
#: tfrmviewer.actstretchimage.caption
msgctxt "tfrmviewer.actstretchimage.caption"
msgid "Stretch"
msgstr "Stræk"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Strækker billedet"
#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr ""
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr ""
#: tfrmviewer.actzoomin.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Zoom ind"
#: tfrmviewer.actzoomout.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Zoom ud"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Kopier"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Kopier"
#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Beskær"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Slet"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Slet"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Fuldskærm"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr ""
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Markér"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Flyt"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Flyt"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr ""
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Male"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr ""
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Røde øjne"
#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Tilpas størrelse"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Fortryd"
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Fremviser"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Slideshow"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Stift"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Markér"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Male"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Slideshow"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Visning"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr ""
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "&Om"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Rediger"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Kodning"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Fil"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "B&illede"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "&Udskriv..."
#: tfrmviewer.mirotate.caption
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
msgid "Rotate"
msgstr "Rotér"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Tag et skærmbillede"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Vis"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Vælg alle"
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Hvis filen findes:"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Hvis filen findes:"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
#, fuzzy
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopiér &dato/tid"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Til &baggrund"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Hvis fil findes"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Højde"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Bredde"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
#, fuzzy
#| msgid ""
#| "This file cannot be found and could help to validate final combination of files:\n"
#| "%s\n"
#| "\n"
#| "Could you make it available and press \"OK\" when ready,\n"
#| "or press \"CANCEL\" to continue without it?\n"
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
"Filen kan ikke findes men den kunne hjælpe med at validere den endelige kombination af filer:\n"
"%s\n"
"\n"
"Find den venligst og klik \"OK\" når du er klar,\n"
"eller klik \"Annuller\" for at fortsætte uden filen?\n"
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Annullér Hurtigt filter"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Annuller aktuel handling"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Indtast filnavn med filendelse for den 'sluppede' tekst"
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Tekstformat, som skal importeres"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Brudt:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Generelt:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Mangler:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Læsefejl"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Lykkedes:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Indtast kontrolsum og vælg algoritme:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Kontroller kontrolsum"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr ""
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Udklipsholderen indeholder ingen gyldige data for værktøjslinjen"
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr ""
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr ""
#: ulng.rscolattr
msgid "Attr"
msgstr "Attribut"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Dato"
#: ulng.rscolext
msgid "Ext"
msgstr "Type"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Navn"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Størrelse"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Justering"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Titel"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Slet"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Feltindhold"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Flyt"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Bredde"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Tilføj kolonne"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr ""
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr ""
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Kopier (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Importeret DC-værktøjslinje"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Importeret DC-værktøjslinje"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "_'Sluppet' tekst"
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "_'Sluppet' HTML-tekst"
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "_'Sluppet' RTF"
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "_'Sluppet' simpel tekst"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "_'Sluppet' UnicodeUTF16-tekst"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "_'Sluppet' UnicodeUTF8-tekst"
#: ulng.rsdiffadds
msgid " Adds: "
msgstr "Føj til:"
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr "Sletter:"
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr ""
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr "Matcher:"
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr "Ændret:"
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Afbryd"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "&Alle"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Tilføj"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "A&uto-omdøb kildefiler"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "Af&bryd"
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "Fortsæt"
#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "Kopier ind i"
#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "Kopier ind i alle"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "Afslut program"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr ""
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "I&gnorér alle"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Nej"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "Ing&en"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&OK"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "Flere &valg >>"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Overskriv"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Overskriv &alle"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Overskriv alle større"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Overskriv &ældre"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Overskriv alle mindre"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Omd&øb"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Tilføj"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Forsøg igen"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Spring over"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "S&pring alle over"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Ja"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Kopier fil(er)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Flyt fil(er)"
#: ulng.rsdlgoppause
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "Pau&se"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&OK"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Kø"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Hastighed %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Hastighed %s/s, resterende tid %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<ingen drev-etiket>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<intet medie>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Double Commaders interne editor"
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Gå til linje"
#: ulng.rseditgotolinetitle
msgctxt "ulng.rseditgotolinetitle"
msgid "Goto Line"
msgstr "Gå til linje"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "ny.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Filnavn:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Åbn fil"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "Til&bage"
#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Søg"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "&Fremad"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Erstat"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr ""
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr ""
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr ""
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr ""
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr ""
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr ""
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr ""
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Eksporteret_fra_DC"
#: ulng.rsfileopdirectoryexistsoptions
#, fuzzy
#| msgid "Ask;Overwrite;Copy into;Skip"
msgid "Ask;Merge;Skip"
msgstr "Spørg bruger;Overskriv alle filer;Kopier alle filer;Spring alle filer over"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Spørg bruger;Overskriv alle filer;Overskriv alle ældre filer;Spring alle filer over"
#: ulng.rsfileopsetpropertyerroroptions
msgctxt "ulng.rsfileopsetpropertyerroroptions"
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Spørg bruger;Undlad indstilling;Ignorér fejl"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "Filter:"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Definer valg"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s niveau(er)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "Alle (ubegrænset dybde)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "Kun aktuelle mappe"
#: ulng.rsfinddirnoex
msgctxt "ulng.rsfinddirnoex"
msgid "Directory %s does not exist!"
msgstr "Mappen %s findes ikke!"
#: ulng.rsfindfound
msgctxt "ulng.rsfindfound"
msgid "Found: %d"
msgstr "Fundet: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Gem søgningen som skabelon"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Navn på skabelon:"
#: ulng.rsfindscanned
msgctxt "ulng.rsfindscanned"
msgid "Scanned: %d"
msgstr "Skannet: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Skanner"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Find filer"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr ""
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Start ved"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Ledig plads: %sB. Kapacitet: %sB"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%sB ledige"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Åbnet dato/tid"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Attributter"
#: ulng.rsfunccomment
msgctxt "ulng.rsfunccomment"
msgid "Comment"
msgstr "Kommentar"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Komprimeret størrelse"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Oprettet dato/tid"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Type"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Gruppe"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr ""
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Link til"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Ændret dato/tid"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Navn"
#: ulng.rsfuncnamenoext
msgctxt "ulng.rsfuncnamenoext"
msgid "Name without extension"
msgstr "Navn uden filendelse"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Ejer"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Sti:"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Størrelse"
#: ulng.rsfunctype
msgid "Type"
msgstr "Type"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Kunne ikke danne hårdt link."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr ""
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Kopierings-/flytningsdialog"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Sammenligningsprogram"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Rediger kommentar dialog"
#: ulng.rshotkeycategoryeditor
#, fuzzy
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rshotkeycategoryfindfiles
#, fuzzy
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Find filer"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Hovedvindue"
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Fremviser"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "Kan ikke finde reference til standard-panelfil"
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Indskrænk valg"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Udvid valg"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Angiv filtype:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr ""
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr ""
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Indstillinger for kolonner"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr ""
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Handlinger"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr ""
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Rediger"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Skub ud"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr ""
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr ""
#: ulng.rsmnumount
msgid "Mount"
msgstr "Mount"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Ny"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Kan ikke finde medie"
#: ulng.rsmnuopen
#, fuzzy
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Åbn"
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Åbn med..."
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Andre..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr ""
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Sortér efter"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Skub eksternt medie ud"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Vis"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Konto:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Ekstra parametre til pakkeprograms kommandolinje:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Du kan ikke kopiere/flytte filen \"%s\" til sig selv!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Kan ikke slette mappen %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Ændre arbejdsmappe [ChDir] til [%s] mislykkedes!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Luk alle inaktive faneblade?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Fanebladet (%s) er låst! Luk alligevel?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Er du sikker på at ville afslutte?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr ""
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr ""
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Kopier %d valgte filer/mapper til:"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Kopier \"%s\" til:"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr ""
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Indtast placering og filnavn, for hvor DC værktøjslinjefilen skal gemmes"
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr ""
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Slet den delvist kopierede fil ?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Er du sikker på, at du vil slette de %d valgte filer/mapper?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Vil du flytte disse %d elementer til Papirkurv?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Er du sikker på, at du vil slette den valgte fil \"%s\" ?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Vil du flytte \"%s\" til Papirkurv?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Kan ikke flytte \"%s\" til Papirkurv! Slet direkte?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Drevet er ikke tilgængeligt."
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr ""
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Indtast filendelse:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Indtast navn:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr ""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "CRC-fejl i arkivdata"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Datafejl"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Kan ikke forbinde til server: \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Kan ikke kopiere fil %s til %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Der findes allerede en mappe med navnet \"%s\"."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Datoen %s understøttes ikke"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Fejl: Mappen \"%s\" eksisterer allerede! Angiv et andet navn."
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Brugerafbrydelse"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Kunne ikke lukke filen"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Kan ikke danne fil"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Ikke flere filer i arkivet"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Kan ikke åbne eksisterende fil"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Kunne ikke læse fil"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Kunne ikke skrive til fil"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Kan ikke oprette mappe %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Ugyldigt link"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Ingen filer fundet"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Ikke nok hukommelse"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Funktionen understøttes ikke!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Fejl i kontekstmenuens kommando"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Fejl ved indlæsning af konfigurationen"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Syntaksfejl i regulære udtryk!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Kan ikke omdøbe fil %s til %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Kan ikke gemme associationen"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Kan ikke gemme fil"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Kan ikke indstille attributter for \"%s\""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Kan ikke indstille dato/tid for \"%s\""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Kan ikke oprette ejer/gruppe for \"%s\""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr ""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Bufferen er for lille"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "For mange filer at pakke"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Arkivformat ukendt"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr ""
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr ""
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr ""
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabssubmenuname
#, fuzzy
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Undermenus navn"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr ""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr ""
"Filen \"%s\" er ændret.\n"
"Vil du gemme?\n"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr ""
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Overskriv:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr ""
"Filen \"%s\" findes allerede.\n"
"Vil du overskrive?\n"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Med fil:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Filen \"\"%s\" ikke funde"
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Aktive filhandlinger"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Der er uafsluttede filhandlinger. Lukkes Double Commander kan det medføre tab af data."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
#, fuzzy
#| msgid "File %s is marked as read-only. Delete it?"
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Filen %s er markeret som skrivebeskyttet. Vil du slette den?"
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "Størrelsen på filen \"%s\" er for stor til destinationens filsystem!"
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr ""
"Mappen %s eksisterer.\n"
"Vil du overskrive?\n"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Følg symlink \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Vælg tekstformatet som skal importeres"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Tilføj %d valgte mapper"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Tilføj valgte mapper: "
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Tilføj aktuel mappe: "
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Udfør kommando"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_noget"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Konfiguration af Favoritmapper"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Er du sikker på, at du vil fjerne alle poster i din Favoritmappe? (Handlingen kan ikke fortrydes!)"
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Dette udfører følgende kommando:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "Det er navnet på Favoritmappen "
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Dette ændrer det aktive vindue til følgende sti:"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "Og det inaktive vindue ændres til følgende sti:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Backup af posteringerne mislykkedes..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Eksport af posteringerne mislykkedes..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Eksportér alle"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Eksportér Favoritmappe - Vælg de posteringer, som du vil eksportere"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Eksport udvalgt"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Importér alle"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Importér Favoritmappe - Vælg de posteringer, som du vil importere"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Import udvalgt"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Sti"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Find \".hotlist\" filen, der skal importeres"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Favoritmappens navn"
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Antal nye poster: %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "Ikke valgt noget at eksportere"
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Favoritmappens sti"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Tilføj valgte mappe igen: "
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Tilføj aktuel mappe igen: "
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Indtast placering og filnavn på Favoritmappen, der skal gendannes"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Kommando:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(enden af undermenu)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Menunavn:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Navn"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(separator)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Undermenus navn"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Favoritmappens destination"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Undersøg, om du vil have det aktive vindue sorteret i en bestemt rækkefølge efter ændring af mappe"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Undersøg, om du vil have det inaktive vindue sorteret i en bestemt rækkefølge efter ændring af mappe"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Nogle funktioner til at vælge egnet sti - relative, absolutte, særlige windowsmapper etc."
#: ulng.rsmsghotdirtotalbackuped
#, fuzzy
#| msgid ""
#| "Total entries saved: %d\n"
#| "\n"
#| "Backup filename: %s\n"
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Samlede antal gemte posteringer: %d\n"
"Backuppens filnavn: %s\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Samlede antal eksportede posteringer: "
#: ulng.rsmsghotdirwhattodelete
#, fuzzy
#| msgid ""
#| "Do you want to delete all elements inside the sub-menu [%s]?\n"
#| "Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"Vil du slette alle elemeter i undermenu [%s]?\n"
"Svarer du NEJ, slettes kun menuskilletegn, mens elementer inde i undermenuen bevares.\n"
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Indtast placering og filnavn, for hvor Favoritmappe skal gemmes"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Ugyldig fillængde for fil : \"%s\""
#: ulng.rsmsginsertnextdisk
#, fuzzy
#| msgid ""
#| "Please insert next disk or something similar.\n"
#| "\n"
#| "It is to allow writing this file:\n"
#| "\"%s\"\n"
#| "\n"
#| "Number of bytes still to write: %d\n"
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Indsæt venligst næste disk eller noget lignende.\n"
"\n"
"Således det er muligt at skrive denne fil:\n"
"\"%s\"\n"
"\n"
"Antal bytes som mangler at blive skrevet: %d\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Fejl i kommandolinje"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Ugyldigt filnavn"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Ugyldigt format af konfigurationsfilen"
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Ugyldig sti"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Stien %s indeholder ugyldige tegn."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Dette er ikke et gyldigt plugin!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Dette plugin er lavet til Double Commander for %s.%sDet virker ikke sammen med Double Commander for %s!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Ugyldig citering"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Ugyldigt valg"
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Indlæser filliste..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr ""
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "Find TC-exe filen (totalcmd.exe or totalcmd64.exe)"
#: ulng.rsmsglogcopy
msgctxt "ulng.rsmsglogcopy"
msgid "Copy file %s"
msgstr "Kopiér fil %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Slet fil %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Fejl:"
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr ""
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Udpak fil %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Info:"
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Dan link %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Opret mappe %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Flyt fil %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Pak til fil %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Fjern mappe %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Færdig: "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Dan symlink %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Kontroller filintegritet %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr ""
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr ""
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Hovedadgangskode"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Indtast venligst hovedadgangskoden:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Ny fil"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Næste volumen bliver pakket ud"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Ingen filer"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Ingen filer valgt"
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr ""
"Ikke nok ledig plads på måldrevet.\n"
"Vil du fortsætte?\n"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr ""
"Ikke nok ledig plads på måldrevet.\n"
"\"Vil du forsøge igen?\n"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Kan ikke slette fil %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Ikke muligt."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Adgangskode:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Adgangskoderne er ikke ens!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Indtast venligst adgangskoden:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Adgangskode (firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "For kontrol af adgangskoden, indtast den venligst igen:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Fjern %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr ""
"Forudindstilling \"%s\" findes allerede.\n"
"Vil du overskrive?\n"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Filnavn for den 'sluppede' tekst"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Gør venligst denne fil tilgængelig. Vil du prøve igen?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr ""
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr ""
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Omdøbe/flytte %d valgte filer/mapper?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Omdøb/flyt \"%s\" til?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Genstart venligst Double Commander for at udføre ændringerne"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr ""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Valgte: %s af %s, filer: %d af %d, mapper: %d af %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr ""
#: ulng.rsmsgselectonlychecksumfiles
#, fuzzy
#| msgid "Please select only check sum files!"
msgid "Please select only checksum files!"
msgstr "Vælg venligst kun kontrolsumfiler!"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Vælg venligst placering af næste volumen"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Angiv volumen-etiket"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Særlige mapper"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Tilføj sti fra det aktive vindue"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Tilføj sti fra det inaktive vindue"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Gennemse og anvend valgte sti"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Anvend miljøvariabel..."
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Gå til særlig Double Commander sti..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Gå til miljøvariabel..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Gå til en anden særlig Windowsmappe..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Gå til særlig Windowsmappe (TC)..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr ""
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Gør stien absolut"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Gør relativ til særlig Double Commander sti..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Gør relativ til miljøvariabel..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Gør relativ til særlig Windowsmappe (TC)..."
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Gør relativ til anden særlig Windowsmappe..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Anvend særlig Double Commander sti..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr ""
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Anvend anden særlig Windowsmappe..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Anvend særlig Windowsmappe (TC)..."
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr ""
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Omdøb fane"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Nyt navn:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Sti:"
#: ulng.rsmsgtcconfignotfound
#, fuzzy
#| msgid ""
#| "Error! Cannot find the TC configuration file:\n"
#| "%s\n"
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Fejl! Kan ikke finde TC-konfigurationsfilen:\n"
"%s\n"
#: ulng.rsmsgtcexecutablenotfound
#, fuzzy
#| msgid ""
#| "Error! Cannot find the TC configuration executable:\n"
#| "%s\n"
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Fejl! Kan ikek finde TC-konfigurations EXE-fil:\n"
"%s\n"
#: ulng.rsmsgtcisrunning
#, fuzzy
#| msgid ""
#| "Error! TC is still running but it should be closed for this operation.\n"
#| "Close it and press OK or press CANCEL to abort.\n"
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Fejl! TC kører stadigvæk men burde være lukket i fm. denne handling.\n"
"Luk TC og tryk OK eller tryk Annuller for at afbryde.\n"
#: ulng.rsmsgtctoolbarnotfound
#, fuzzy
#| msgid ""
#| "Error! Cannot find the desired wanted TC toolbar output folder:\n"
#| "%s\n"
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Fejl! Kan ikek finde den ønskede TC-værktøjslinje outputmappe:\n"
"%s\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr ""
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr ""
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Find \".toolbar\" fil, der skal importeres"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Find \".BAR\" fil, der skal importeres"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Indtast placering og filnavn på værktøjslinjen, der skal gendannes"
#: ulng.rsmsgtoolbarsaved
#, fuzzy
#| msgid ""
#| "Saved!\n"
#| "Toolbar filename: %s\n"
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Gem!\n"
"Værktøjslinjens filnavn: %s\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Du har valgt for mange filer"
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Ikke fastslået"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""
#: ulng.rsmsgurl
msgid "URL:"
msgstr ""
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr ""
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr ""
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Brugernavn:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Brugernavn (firewall):"
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Volumen-etiket:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Indtast venligst volumen-størrelse:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Sikker sletning af %d valgte filer/mapper?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Sikker sletning af \"%s\"?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Uændret;STORE BOGSTAVER;små bogstaver;Første bogstav stort;Første Bogstav Stort I hvert Ord;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Afbrudt"
#: ulng.rsopercalculatingchecksum
#, fuzzy
#| msgid "Calculating check sum"
msgid "Calculating checksum"
msgstr "Danner kontrolsumfil"
#: ulng.rsopercalculatingchecksumin
#, fuzzy
#| msgid "Calculating check sum in \"%s\""
msgid "Calculating checksum in \"%s\""
msgstr "Danner kontrolsumfil i \"%s\""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr ""
#: ulng.rsopercalculatingstatictics
#, fuzzy
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "Beregner"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Beregner \"%s\""
#: ulng.rsopercombining
msgid "Joining"
msgstr "Samler"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Samler filer i \"%s\" til \"%s\""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Kopierer"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Kopierer fra \"%s\" til \"%s\""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Kopierer \"%s\" til \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Danner mappe"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Danner mappe \"\"%s\""
#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "Sletter"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Sletter i \"%s\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Sletter \"%s\""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Udfører"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Udfører \"%s\""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Pakker ud"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Pakker ud fra \"%s\" til \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Afsluttet"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Oplister"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Oplister \"%s\""
#: ulng.rsopermoving
msgid "Moving"
msgstr "Flytter"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Flytter fra \"%s\" til\"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Flytter \"%s\" til \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Ikke startet"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Pakker"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Pakker fra \"%s\" til \"%s\""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Pakker \"%s\" til \"%s\""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Sat på pause"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Pause"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Kører"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Indstiller egenskab"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Indstiller egenskab i \"%s\""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Indstiller egenskab af \"%s\""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Opdeler"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Opdeler \"%s\" til \"%s\""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Starter"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Stoppet"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Stopper"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Kontrollerer"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Kontrollerer i \"%s\""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Kontrollerer \"%s\""
#: ulng.rsoperverifyingchecksum
#, fuzzy
#| msgid "Verifying check sum"
msgid "Verifying checksum"
msgstr "Kontrollerer kontrolsum"
#: ulng.rsoperverifyingchecksumin
#, fuzzy
#| msgid "Verifying check sum in \"%s\""
msgid "Verifying checksum in \"%s\""
msgstr "Kontrollerer kontrolsum i \"%s\""
#: ulng.rsoperverifyingchecksumof
#, fuzzy
#| msgid "Verifying check sum of \"%s\""
msgid "Verifying checksum of \"%s\""
msgstr "Kontrollerer kontrolsum af \"%s\""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Venter på adgang til filkilde"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Venter på brugerrespons"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Sletter (fuldstændigt)"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Sletter (fuldstændigt) i \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Sletter (fuldstændigt) \"%s\""
#: ulng.rsoperworking
msgid "Working"
msgstr "Behandler"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Tilføj starten;Tilføj enden;Tilføj smart"
#: ulng.rsoptarchivedelete
msgctxt "ulng.rsoptarchivedelete"
msgid "Delete:"
msgstr "Slet:"
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Pak ud uden sti:"
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr "Format analyse-tilstand:"
#: ulng.rsoptarchiveid
msgctxt "ulng.rsoptarchiveid"
msgid "ID:"
msgstr ""
#: ulng.rsoptarchiveidpos
msgctxt "ulng.rsoptarchiveidpos"
msgid "ID Position:"
msgstr "ID-position:"
#: ulng.rsoptarchiveidseekrange
msgctxt "ulng.rsoptarchiveidseekrange"
msgid "ID Seek Range:"
msgstr "ID søge-interval:"
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr ""
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr "Password forespørgsel:"
#: ulng.rsoptarchiveselfextract
msgctxt "ulng.rsoptarchiveselfextract"
msgid "Create self extracting archive:"
msgstr "Dan selvudpakkende arkiv:"
#: ulng.rsoptarchivetest
msgctxt "ulng.rsoptarchivetest"
msgid "Test:"
msgstr ""
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Arkivtype-navn:"
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Værdi"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Associer plugin \"%s\" med:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Først;Sidst"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Klassisk, ældre måde;Alfabetisk (men stadig med sprog først)"
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Aktivt vindue til venstre, inaktive vindue til højre (ældre visning); Venstre vindue til venstre, højre til højre"
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Deaktiver"
#: ulng.rsoptenable
msgctxt "ulng.rsoptenable"
msgid "Enable"
msgstr "Aktiver"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Indtast filendelse"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr ""
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "Nyt vindue;Minimeret til proceslinjen;Handlingsvindue"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "Dynamisk (x B/k/M/G);bytes (B);kilobytes (kB);Megabytes (MB);Gigabytes (GB)"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Genvejen %s for cm_Delete vil blive registreret, så den kan bruges til at fortryde denne indstilling"
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Tilføj genvejstast for %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Tilføj genvejstast"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Kan ikke tilføje genvejstast"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Ændr genvejstast"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Kommando"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides"
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Genvejen %s for cm_Delete har en parameter som tilsidesætter denne indstilling. Vil du ændre den indstilling for at anvende de globale indstillinger?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists"
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Genvejen %s for cm_Delete skal have en parameter ændret for at matche genvejen %s. Vil du ændre parameteren?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Beskrivelse"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Rediger genvejstast for %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Ret parameter"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Genvejstast"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Genvejstaster"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<ingen>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parametre"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Indstil genvej for at slette fil"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "For at denne indstilling skal kunne virke med genvejen %s, skal genvejen %s tildeles til cm_Delete. Men den er allerede tildelt til %s. Vil du ændre det?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Genvejen %s for cm_Delete er en sekventiel genvej for hvilken en genvej med omvendt Shift ikke kan tildeles. Denne indstilling vil derfor måske ikke virke."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Genvejstast anvendes"
#: ulng.rsopthotkeysshortcutusedtext1
#, fuzzy,badformat
msgid "Shortcut %s is already used."
msgstr "Genvejstast %s anvendes allerede til %s."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Ændre den til %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "bruges af %s i %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "bruges til denne kommando men med andre parametre"
#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Pakkeprogrammer"
#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Opdater automatisk"
#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Egenskab"
#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr "Kort"
#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Farver"
#: ulng.rsoptionseditorcolumnsview
msgctxt "ulng.rsoptionseditorcolumnsview"
msgid "Columns"
msgstr "Kolonner"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Konfiguration"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Brugertilpassede kolonner"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Favoritmappe"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Træk & slip"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Drev-valgknap"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr ""
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr ""
#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Filassociationer"
#: ulng.rsoptionseditorfilenewfiletypes
#, fuzzy
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Ny"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Filhandlinger"
#: ulng.rsoptionseditorfilepanels
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Filvindue"
#: ulng.rsoptionseditorfilesearch
#, fuzzy
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Find filer"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Visning"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Filtyper"
#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Faneblade"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr ""
#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Skrifttype"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Fremhævere"
#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Genvejstaster"
#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Ikoner"
#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Ignorer-liste"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Taster"
#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Sprog"
#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr ""
#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Logfil"
#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Diverse"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Mus"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
#: ulng.rsoptionseditorplugins
#, fuzzy
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Plugin"
#: ulng.rsoptionseditorquicksearch
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Hurtig søgning/filtrering"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminal F9"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Værktøjslinje"
#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Værktøjer"
#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Værktøjshjælp"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr ""
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr ""
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Ingen;Kommandolinje;Hurtig søgning;Hurtigt filter"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Brug venstre knap;Brug højre knap;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "øverst i fillisten;efter mapper (hvis mapper sorteres før filer);på sorteret plads ;nederst i fillisten"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Plugin %s er allerede tildelt følgende filtyper:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Aktiv"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Filnavn"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Navn"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Registreret til"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Søg med forskel på STORE og små bogstaver; Søg &uden forskel på STORE og små bogstaver"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Filer;Mapper;Filer og mapper"
#: ulng.rsoptsearchopt
#, fuzzy
#| msgid "&Hide filter panel when not focused"
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "Skjul filterpanelet, når det ikke er valgt"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "ingen forskel;brug lokale indstillinger (aA-bB-cC);først STORE så små bogstaver (ABC-abc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "sortér efter navn og vis først;sortér som filer og vis først;sortér som filer"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Alfabetiske, inklusive tegn med accenter;Naturlig sortering: Alfabetisk og numerisk"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Top;Bund;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "S&eparator;Inte&rn kommando;E&kster kommando;Men&u"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "Ældre DC - Kopier (x) filnavn.ext;Windows - filnavn (x).ext;Andre - filnavn(x).ext"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "bevar positionen;brug samme indstilling som for nye filer;til sorteret plads"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Filer: %d, mapper: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Kan ikke ændre adgangsrettigheder for \"%s\""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Kan ikke ændre ejer for \"%s\""
#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "Fil"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Mappe"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Nævnte pipe"
#: ulng.rspropssocket
msgid "Socket"
msgstr ""
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Speciel blok-enhed"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Speciel tegn-enhed"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Symbolsk link"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Ukendt type"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Søgeresultat"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "Søg"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<unavngivet skabelon>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Vælg en mappe"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "Vi&s hjælp for %s"
#: ulng.rssimplewordall
#, fuzzy
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Alle"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr ""
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr ""
#: ulng.rssimplewordcommand
#, fuzzy
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Kommando"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr ""
#: ulng.rssimplewordfiles
msgid "files"
msgstr "Filer"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr ""
#: ulng.rssimplewordresult
msgid "Result"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr ""
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr ""
#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr ""
#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr ""
#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr ""
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr ""
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr ""
"Total brugt plads i fil(er): %d og mappe(r): %d\n"
"Størrelse: %s (= %s bytes)\n"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Kunne ikke danne mål-mappe!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Forkert filstørrelse-format!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Kan ikke opdele fil!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Der er mere end 100 dele! Vil du fortsætte?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Vælg mappe:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr ""
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr ""
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Kunne ikke danne symlink!"
#: ulng.rssyndefaulttext
msgctxt "ulng.rssyndefaulttext"
msgid "Default text"
msgstr "Standardtekst"
#: ulng.rssynlangplaintext
msgctxt "ulng.rssynlangplaintext"
msgid "Plain text"
msgstr "Ren tekst"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr ""
#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Dag(e)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Time(r)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minut(ter)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Måned(er)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Sekund(er)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Uge(r)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "År"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr ""
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr ""
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Sammenligningsprogram"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Fejl ved åbning af sammenligningsprogram"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Fejl ved åbning af editor"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Fejl ved åbning af terminal"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Fejl ved åbning af fremviser"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminal F9"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Fremviser"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Rapportér venligst denne fejl i bug-tracker med en beskrivelse af, hvad du gjorde og følgende fil: %s Tryk %s for at fortsætte eller %s at afbryde programmet."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr ""
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr ""
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr ""
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr ""
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr ""
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr ""
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr ""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr ""
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr ""
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr ""
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr ""
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr ""
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr ""
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr ""
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr ""
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr ""
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr ""
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr ""
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr ""
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr ""
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr ""
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr ""
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr ""
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr ""
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr ""
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr ""
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr ""
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr ""
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr ""
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr ""
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr ""
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr ""
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr ""
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Netværk"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Double Commanders interne fremviser"
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr ""
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Koder"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr ""
#: ulng.rsviewnewsize
#, fuzzy
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Ny størrelse"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s ikke fundet!"
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr ""
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr ""
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr ""
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr ""