mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-21 09:58:13 +00:00
12311 lines
407 KiB
Text
12311 lines
407 KiB
Text
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
|
||
"Report-Msgid-Bugs-To: \n"
|
||
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
|
||
"PO-Revision-Date: 2017-01-23 21:09+0200\n"
|
||
"Last-Translator: Anastasios Kazakis <orca.surfshark@gmail.com>\n"
|
||
"Language-Team: Anastasios Kazakis <orca.surfshark@gmail.com>\n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Native-Language: ελληνικά\n"
|
||
"X-Generator: Poedit 1.8.7.1\n"
|
||
"Language: el\n"
|
||
"Plural-Forms: nplurals=2; plural=(n != 1);\n"
|
||
"X-Language: el_GR\n"
|
||
"X-Source-Language: el\n"
|
||
|
||
#: fsyncdirsdlg.rscomparingpercent
|
||
msgid "Comparing... %d%% (ESC to cancel)"
|
||
msgstr "Σύγκριση... %d%% (ESC για ακύρωση)"
|
||
|
||
#: fsyncdirsdlg.rsdeleteright
|
||
msgid "Right: Delete %d file(s)"
|
||
msgstr "Δεξιά: Διαγραφή %d αρχείο(α)"
|
||
|
||
#: fsyncdirsdlg.rsfilesfound
|
||
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
||
msgstr "Ευρεθέντα αρχεία: %d (Όμοια: %d, : %d, Διαφορετικά: %d, Μοναδικά αριστερά: %d, Μοναδικά δεξιά: %d)"
|
||
|
||
#: fsyncdirsdlg.rslefttorightcopy
|
||
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
||
msgstr "Αριστερά προς Δεξιά: Αντιγραφή %d αρχεία, συνολικό μέγεθος: %d bytes"
|
||
|
||
#: fsyncdirsdlg.rsrighttoleftcopy
|
||
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
||
msgstr "Δεξιά προς Αριστερά: Αντιγραφή %d αρχεία, συνολικό μέγεθος: %d bytes"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
||
msgid "Choose template..."
|
||
msgstr "Επιλογή προτύπου..."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
||
msgid "C&heck free space"
|
||
msgstr "Έλεγχος ελεύθερου χώρου"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
||
msgid "Cop&y attributes"
|
||
msgstr "Αποθήκευση ιδιοτήτων"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
||
msgid "Copy o&wnership"
|
||
msgstr "Αντιγραφή ιδιοκτησίας"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
||
msgid "Copy &permissions"
|
||
msgstr "Αντιγραφή αδειών"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Αντιγραφή ημερομηνίας/ώρας"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
||
msgid "Correct lin&ks"
|
||
msgstr "Διόρθωση δεσμών"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "Drop readonly fla&g"
|
||
msgstr "Κατέβασμα σημαίας μόνο για ανάγνωση"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
||
msgid "E&xclude empty directories"
|
||
msgstr "Αποκλεισμός άδειων καταλόγων"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
||
msgid "Fo&llow links"
|
||
msgstr "Ακολουθείστε τους δεσμούς"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
||
msgid "&Reserve space"
|
||
msgstr "Κράτηση Χώρου"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
||
msgid "&Verify"
|
||
msgstr "Επαλήθευση"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
||
msgid "What to do when cannot set file time, attributes, etc."
|
||
msgstr "Τι να κάνετε όταν δεν μπορείτε να ορίσετε στα αρχεία χρόνο, ιδιότητες, κ.α"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
||
msgid "Use file template"
|
||
msgstr "Χρησιμοποιείστε πρότυπο αρχείου"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
||
msgid "When dir&ectory exists"
|
||
msgstr "Όταν ο κατάλογος υπάρχει"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When &file exists"
|
||
msgstr "Όταν το &αρχείο υπάρχει"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
||
msgid "When ca&nnot set property"
|
||
msgstr "Όταν υπάρχει αδυναμία καθορισμού ιδιότητας"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
||
msgid "<no template>"
|
||
msgstr "<Χωρίς πρότυπο>"
|
||
|
||
#: tfrmabout.btnclose.caption
|
||
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmabout.btncopytoclipboard.caption
|
||
msgid "Copy to clipboard"
|
||
msgstr "Αντιγραφή στο πρόχειρο"
|
||
|
||
#: tfrmabout.caption
|
||
msgctxt "TFRMABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "Σχετικά"
|
||
|
||
#: tfrmabout.lblbuild.caption
|
||
msgctxt "tfrmabout.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Εσωτερική έκδοση"
|
||
|
||
#: tfrmabout.lblfreepascalver.caption
|
||
msgctxt "tfrmabout.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmabout.lblhomepage.caption
|
||
msgid "Home Page:"
|
||
msgstr "Ιστοσελίδα προγράμματος"
|
||
|
||
#: tfrmabout.lblhomepageaddress.caption
|
||
msgid "http://doublecmd.sourceforge.net"
|
||
msgstr "http://doublecmd.sourceforge.net"
|
||
|
||
#: tfrmabout.lbllazarusver.caption
|
||
msgctxt "tfrmabout.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmabout.lblrevision.caption
|
||
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
|
||
msgid "Revision"
|
||
msgstr "Αναθεωρημένη έκδοση"
|
||
|
||
#: tfrmabout.lbltitle.caption
|
||
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmabout.lblversion.caption
|
||
msgctxt "tfrmabout.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Έκδοση"
|
||
|
||
#: tfrmattributesedit.btncancel.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmattributesedit.btnok.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmattributesedit.btnreset.caption
|
||
msgid "&Reset"
|
||
msgstr "Επαναφορά"
|
||
|
||
#: tfrmattributesedit.caption
|
||
msgid "Choose attributes"
|
||
msgstr "Επιλογή ιδιοτήτων"
|
||
|
||
#: tfrmattributesedit.cbarchive.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
|
||
msgid "&Archive"
|
||
msgstr "Αρχειοθήκη"
|
||
|
||
#: tfrmattributesedit.cbcompressed.caption
|
||
msgid "Co&mpressed"
|
||
msgstr "Συμπιεσμένο"
|
||
|
||
#: tfrmattributesedit.cbdirectory.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
|
||
msgid "&Directory"
|
||
msgstr "Κατάλογος"
|
||
|
||
#: tfrmattributesedit.cbencrypted.caption
|
||
msgid "&Encrypted"
|
||
msgstr "Κρυπτογραφημένο"
|
||
|
||
#: tfrmattributesedit.cbhidden.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
|
||
msgid "&Hidden"
|
||
msgstr "Κρυφό"
|
||
|
||
#: tfrmattributesedit.cbreadonly.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
|
||
msgid "Read o&nly"
|
||
msgstr "Μόνο για Ανάγνωση"
|
||
|
||
#: tfrmattributesedit.cbsgid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmattributesedit.cbsparse.caption
|
||
msgid "S&parse"
|
||
msgstr "Αραίωση"
|
||
|
||
#: tfrmattributesedit.cbsticky.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Κολημμένα"
|
||
|
||
#: tfrmattributesedit.cbsuid.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmattributesedit.cbsymlink.caption
|
||
msgid "&Symlink"
|
||
msgstr "Συμβολοδεσμός"
|
||
|
||
#: tfrmattributesedit.cbsystem.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
|
||
msgid "S&ystem"
|
||
msgstr "Σύστημα"
|
||
|
||
#: tfrmattributesedit.cbtemporary.caption
|
||
msgid "&Temporary"
|
||
msgstr "Προσωρινά Αρχεία"
|
||
|
||
#: tfrmattributesedit.gbntfsattributes.caption
|
||
msgid "NTFS attributes"
|
||
msgstr "NTFS ιδιότητες"
|
||
|
||
#: tfrmattributesedit.gbwingeneral.caption
|
||
msgid "General attributes"
|
||
msgstr "Γενικές ιδιότητες"
|
||
|
||
#: tfrmattributesedit.lblattrbitsstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Bits:"
|
||
|
||
#: tfrmattributesedit.lblattrgroupstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Γκρουπ"
|
||
|
||
#: tfrmattributesedit.lblattrotherstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Άλλοι"
|
||
|
||
#: tfrmattributesedit.lblattrownerstr.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Ιδιοκτήτης"
|
||
|
||
#: tfrmattributesedit.lblexec.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Εκτέλεση"
|
||
|
||
#: tfrmattributesedit.lblread.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Ανάγνωση"
|
||
|
||
#: tfrmattributesedit.lbltextattrs.caption
|
||
msgid "As te&xt:"
|
||
msgstr "Ως Κείμενο:"
|
||
|
||
#: tfrmattributesedit.lblwrite.caption
|
||
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Εγγραφή"
|
||
|
||
#: tfrmchecksumcalc.caption
|
||
msgctxt "TFRMCHECKSUMCALC.CAPTION"
|
||
msgid "Calculate checksum..."
|
||
msgstr "Υπολογισμός αθροίσματος ελέγχου..."
|
||
|
||
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
||
msgid "Open checksum file after job is completed"
|
||
msgstr "Άνοιγμα αρχείου αθροίσματος ελέγχου μετά την ολοκλήρωση της εργασίας"
|
||
|
||
#: tfrmchecksumcalc.cbseparatefile.caption
|
||
msgid "C&reate separate checksum file for each file"
|
||
msgstr "Δημιουργία ξεχωριστού αρχείου αθροίσματος ελέγχου για κάθε αρχείο"
|
||
|
||
#: tfrmchecksumcalc.lblsaveto.caption
|
||
msgid "&Save checksum file(s) to:"
|
||
msgstr "Αποθήκευση αρχείου(ων) αθροίσματος ελέγχου στο:"
|
||
|
||
#: tfrmchecksumverify.btnclose.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmchecksumverify.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
|
||
msgid "Verify checksum..."
|
||
msgstr "Επιβεβαίωση αθροίσματος ελέγχου..."
|
||
|
||
#: tfrmconnectionmanager.btnadd.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmconnectionmanager.btncancel.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmconnectionmanager.btnconnect.caption
|
||
msgid "C&onnect"
|
||
msgstr "Σύνδεση"
|
||
|
||
#: tfrmconnectionmanager.btndelete.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmconnectionmanager.btnedit.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmconnectionmanager.caption
|
||
msgid "Connection manager"
|
||
msgstr "Διαχειριστής συνδέσεων"
|
||
|
||
#: tfrmconnectionmanager.gbconnectto.caption
|
||
msgid "Connect to:"
|
||
msgstr "Σύνδεση σε:"
|
||
|
||
#: tfrmcopydlg.btnaddtoqueue.caption
|
||
msgid "A&dd To Queue"
|
||
msgstr "Προσθήκη στην Ουρά"
|
||
|
||
#: tfrmcopydlg.btncancel.caption
|
||
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmcopydlg.btnoptions.caption
|
||
msgid "O&ptions"
|
||
msgstr "Επιλογές"
|
||
|
||
#: tfrmcopydlg.btnsaveoptions.caption
|
||
msgid "Sa&ve these options as default"
|
||
msgstr "αποθήκευση αυτών των ιδιοτήτων ως προκαθορισμένες"
|
||
|
||
#: tfrmcopydlg.caption
|
||
msgctxt "TFRMCOPYDLG.CAPTION"
|
||
msgid "Copy file(s)"
|
||
msgstr "Αντιγραφή αρχείου(ων)"
|
||
|
||
#: tfrmcopydlg.mnunewqueue.caption
|
||
msgctxt "tfrmcopydlg.mnunewqueue.caption"
|
||
msgid "New queue"
|
||
msgstr "Νέα ουρά"
|
||
|
||
#: tfrmcopydlg.mnuqueue1.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue1.caption"
|
||
msgid "Queue 1"
|
||
msgstr "Ουρά 1"
|
||
|
||
#: tfrmcopydlg.mnuqueue2.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue2.caption"
|
||
msgid "Queue 2"
|
||
msgstr "Ουρά 2"
|
||
|
||
#: tfrmcopydlg.mnuqueue3.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue3.caption"
|
||
msgid "Queue 3"
|
||
msgstr "Ουρά 3"
|
||
|
||
#: tfrmcopydlg.mnuqueue4.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue4.caption"
|
||
msgid "Queue 4"
|
||
msgstr "Ουρά 4"
|
||
|
||
#: tfrmcopydlg.mnuqueue5.caption
|
||
msgctxt "tfrmcopydlg.mnuqueue5.caption"
|
||
msgid "Queue 5"
|
||
msgstr "Ουρά 5"
|
||
|
||
#: tfrmdescredit.actsavedescription.caption
|
||
msgid "Save Description"
|
||
msgstr "Αποθήκευση Περιγραφής"
|
||
|
||
#: tfrmdescredit.btncancel.caption
|
||
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmdescredit.btnok.caption
|
||
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmdescredit.caption
|
||
msgid "File/folder comment"
|
||
msgstr "Σχόλιο αρχείου/φακέλου"
|
||
|
||
#: tfrmdescredit.lbleditcommentfor.caption
|
||
msgid "E&dit comment for:"
|
||
msgstr "Επεξεργασία σχολίου για:"
|
||
|
||
#: tfrmdescredit.lblencoding.caption
|
||
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
|
||
msgid "&Encoding:"
|
||
msgstr "Κωδικοποίηση:"
|
||
|
||
#: tfrmdescredit.lblfilename.caption
|
||
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmdiffer.actabout.caption
|
||
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "Σχετικά"
|
||
|
||
#: tfrmdiffer.actautocompare.caption
|
||
msgid "Auto Compare"
|
||
msgstr "Αυτόματη Σύγκριση"
|
||
|
||
#: tfrmdiffer.actbinarycompare.caption
|
||
msgid "Binary Mode"
|
||
msgstr "Δυαδική Μορφή"
|
||
|
||
#: tfrmdiffer.actcancelcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmdiffer.actcancelcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
||
msgid "Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
|
||
msgid "Copy Block Right"
|
||
msgstr "Αντιγραφή Block Δεξιά"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
||
msgid "Copy Block Right"
|
||
msgstr "Αντιγραφή Block Δεξιά"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.caption
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
|
||
msgid "Copy Block Left"
|
||
msgstr "Αντιγραφή Block Αριστερά"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
||
msgid "Copy Block Left"
|
||
msgstr "Αντιγραφή Block Αριστερά"
|
||
|
||
#: tfrmdiffer.acteditcopy.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmdiffer.acteditcut.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Αποκοπή"
|
||
|
||
#: tfrmdiffer.acteditdelete.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmdiffer.acteditpaste.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Επικόλληση"
|
||
|
||
#: tfrmdiffer.acteditredo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Επανάληψη"
|
||
|
||
#: tfrmdiffer.acteditselectall.caption
|
||
msgid "Select &All"
|
||
msgstr "Επιλογή όλων"
|
||
|
||
#: tfrmdiffer.acteditundo.caption
|
||
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Αναίρεση"
|
||
|
||
#: tfrmdiffer.actexit.caption
|
||
msgctxt "TFRMDIFFER.ACTEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Έξοδος"
|
||
|
||
#: tfrmdiffer.actfirstdifference.caption
|
||
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION"
|
||
msgid "First Difference"
|
||
msgstr "Πρώτη Διαφορά"
|
||
|
||
#: tfrmdiffer.actfirstdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
|
||
msgid "First Difference"
|
||
msgstr "Πρώτη Διαφορά"
|
||
|
||
#: tfrmdiffer.actignorecase.caption
|
||
msgid "Ignore Case"
|
||
msgstr "Αγνόηση Κεφαλαίων"
|
||
|
||
#: tfrmdiffer.actignorewhitespace.caption
|
||
msgid "Ignore Blanks"
|
||
msgstr "Αγνόηση Κενών"
|
||
|
||
#: tfrmdiffer.actkeepscrolling.caption
|
||
msgid "Keep Scrolling"
|
||
msgstr "Συνέχιση Κύλισης"
|
||
|
||
#: tfrmdiffer.actlastdifference.caption
|
||
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION"
|
||
msgid "Last Difference"
|
||
msgstr "Τελευταία Διαφορά"
|
||
|
||
#: tfrmdiffer.actlastdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
|
||
msgid "Last Difference"
|
||
msgstr "Τελευταία Διαφορά"
|
||
|
||
#: tfrmdiffer.actlinedifferences.caption
|
||
msgid "Line Differences"
|
||
msgstr "Διαφορές Γραμμής"
|
||
|
||
#: tfrmdiffer.actnextdifference.caption
|
||
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION"
|
||
msgid "Next Difference"
|
||
msgstr "Επόμενη Διαφορά"
|
||
|
||
#: tfrmdiffer.actnextdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
|
||
msgid "Next Difference"
|
||
msgstr "Επόμενη Διαφορά"
|
||
|
||
#: tfrmdiffer.actopenleft.caption
|
||
msgid "Open Left..."
|
||
msgstr "Άνοιγμα Αριστερά..."
|
||
|
||
#: tfrmdiffer.actopenright.caption
|
||
msgid "Open Right..."
|
||
msgstr "Άνοιγμα Δεξιά..."
|
||
|
||
#: tfrmdiffer.actpaintbackground.caption
|
||
msgid "Paint Background"
|
||
msgstr "Σχεδιασμός Παρασκηνίου"
|
||
|
||
#: tfrmdiffer.actprevdifference.caption
|
||
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION"
|
||
msgid "Previous Difference"
|
||
msgstr "Προηγούμενη Διαφορά"
|
||
|
||
#: tfrmdiffer.actprevdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
|
||
msgid "Previous Difference"
|
||
msgstr "Προηγούμενη Διαφορά"
|
||
|
||
#: tfrmdiffer.actreload.caption
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
|
||
msgid "&Reload"
|
||
msgstr "Επαναφόρτωση"
|
||
|
||
#: tfrmdiffer.actreload.hint
|
||
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
|
||
msgid "Reload"
|
||
msgstr "Επαναφόρτωση"
|
||
|
||
#: tfrmdiffer.actsave.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmdiffer.actsave.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmdiffer.actsaveas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
|
||
msgid "Save as..."
|
||
msgstr "Αποθήκευση ως..."
|
||
|
||
#: tfrmdiffer.actsaveas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
||
msgid "Save as..."
|
||
msgstr "Αποθήκευση ως..."
|
||
|
||
#: tfrmdiffer.actsaveleft.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
|
||
msgid "Save Left"
|
||
msgstr "Αποθήκευση Αριστερά"
|
||
|
||
#: tfrmdiffer.actsaveleft.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
||
msgid "Save Left"
|
||
msgstr "Αποθήκευση Αριστερά"
|
||
|
||
#: tfrmdiffer.actsaveleftas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
|
||
msgid "Save Left As..."
|
||
msgstr "Αποθήκευση Αριστερά Ως..."
|
||
|
||
#: tfrmdiffer.actsaveleftas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
||
msgid "Save Left As..."
|
||
msgstr "Αποθήκευση Αριστερά Ως..."
|
||
|
||
#: tfrmdiffer.actsaveright.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
|
||
msgid "Save Right"
|
||
msgstr "Αποθήκευση Δεξιά"
|
||
|
||
#: tfrmdiffer.actsaveright.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
||
msgid "Save Right"
|
||
msgstr "Αποθήκευση Δεξιά"
|
||
|
||
#: tfrmdiffer.actsaverightas.caption
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
|
||
msgid "Save Right As..."
|
||
msgstr "Αποθήκευση Δεξιά Ως..."
|
||
|
||
#: tfrmdiffer.actsaverightas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
||
msgid "Save Right As..."
|
||
msgstr "Αποθήκευση Δεξιά Ως..."
|
||
|
||
#: tfrmdiffer.actstartcompare.caption
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Σύγκριση"
|
||
|
||
#: tfrmdiffer.actstartcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
||
msgid "Compare"
|
||
msgstr "Σύγκριση"
|
||
|
||
#: tfrmdiffer.btnleftencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Κωδικοποίηση"
|
||
|
||
#: tfrmdiffer.btnrightencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Κωδικοποίηση"
|
||
|
||
#: tfrmdiffer.caption
|
||
msgctxt "TFRMDIFFER.CAPTION"
|
||
msgid "Compare files"
|
||
msgstr "Σύγκριση αρχείων"
|
||
|
||
#: tfrmdiffer.midivider1.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider10.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider2.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider3.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider4.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider5.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider6.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider7.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider8.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider9.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miencodingleft.caption
|
||
msgid "&Left"
|
||
msgstr "Αριστερά"
|
||
|
||
#: tfrmdiffer.miencodingright.caption
|
||
msgid "&Right"
|
||
msgstr "Δεξιά"
|
||
|
||
#: tfrmdiffer.miseparator1.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miseparator2.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.mnuactions.caption
|
||
msgid "&Actions"
|
||
msgstr "Ενέργειες"
|
||
|
||
#: tfrmdiffer.mnuedit.caption
|
||
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmdiffer.mnuencoding.caption
|
||
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Κωδικοποίηση"
|
||
|
||
#: tfrmdiffer.mnufile.caption
|
||
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "Αρχείο"
|
||
|
||
#: tfrmdiffer.mnuoptions.caption
|
||
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
|
||
msgid "&Options"
|
||
msgstr "Επιλογές"
|
||
|
||
#: tfrmedithotkey.btnaddshortcut.hint
|
||
msgid "Add new shortcut to sequence"
|
||
msgstr "Προσθήκη νέας συντόμευσης στην ακολουθία"
|
||
|
||
#: tfrmedithotkey.btncancel.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmedithotkey.btnok.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmedithotkey.btnremoveshortcut.hint
|
||
msgid "Remove last shortcut from sequence"
|
||
msgstr "Αφαίρεση τελευταίας μικρογραφίας από την ακολουθία"
|
||
|
||
#: tfrmedithotkey.btnselectfromlist.hint
|
||
msgid "Select shortcut from list of remaining free available keys"
|
||
msgstr "Επιλογή συντόμευσης από τη λίστα των υπόλοιπων ελεύθερων διαθέσιμων κουμπιών"
|
||
|
||
#: tfrmedithotkey.cghkcontrols.caption
|
||
msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION"
|
||
msgid "Only for these controls"
|
||
msgstr "Μόνο για αυτά τα στοιχεία ελέγχου"
|
||
|
||
#: tfrmedithotkey.lblparameters.caption
|
||
msgid "&Parameters (each in a separate line):"
|
||
msgstr "Παράμετροι (κάθε μια σε ξεχωριστή γραμμή):"
|
||
|
||
#: tfrmedithotkey.lblshortcuts.caption
|
||
msgid "Shortcuts:"
|
||
msgstr "Συντομεύσεις:"
|
||
|
||
#: tfrmeditor.actabout.caption
|
||
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "Σχετικά"
|
||
|
||
#: tfrmeditor.actabout.hint
|
||
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
|
||
msgid "About"
|
||
msgstr "Σχετικά"
|
||
|
||
#: tfrmeditor.actconfhigh.caption
|
||
msgid "&Configuration"
|
||
msgstr "Διαμόρφωση"
|
||
|
||
#: tfrmeditor.actconfhigh.hint
|
||
msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT"
|
||
msgid "Configuration"
|
||
msgstr "Διαμόρφωση"
|
||
|
||
#: tfrmeditor.acteditcopy.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmeditor.acteditcopy.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmeditor.acteditcut.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Αποκοπή"
|
||
|
||
#: tfrmeditor.acteditcut.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
|
||
msgid "Cut"
|
||
msgstr "Αποκοπή"
|
||
|
||
#: tfrmeditor.acteditdelete.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmeditor.acteditdelete.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmeditor.acteditfind.caption
|
||
msgctxt "tfrmeditor.acteditfind.caption"
|
||
msgid "&Find"
|
||
msgstr "Εύρεση"
|
||
|
||
#: tfrmeditor.acteditfind.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITFIND.HINT"
|
||
msgid "Find"
|
||
msgstr "Εύρεση"
|
||
|
||
#: tfrmeditor.acteditfindnext.caption
|
||
msgctxt "tfrmeditor.acteditfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Εύρεση επόμενου"
|
||
|
||
#: tfrmeditor.acteditfindnext.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
|
||
msgid "Find next"
|
||
msgstr "Εύρεση επόμενου"
|
||
|
||
#: tfrmeditor.acteditfindprevious.caption
|
||
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
||
msgid "Find previous"
|
||
msgstr "Εύρεση Προηγούμενου"
|
||
|
||
#: tfrmeditor.acteditgotoline.caption
|
||
msgctxt "tfrmeditor.acteditgotoline.caption"
|
||
msgid "Goto Line..."
|
||
msgstr "Μετάβαση στη Γραμμή..."
|
||
|
||
#: tfrmeditor.acteditlineendcr.caption
|
||
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcr.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditpaste.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Επικόλληση"
|
||
|
||
#: tfrmeditor.acteditpaste.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
|
||
msgid "Paste"
|
||
msgstr "Επικόλληση"
|
||
|
||
#: tfrmeditor.acteditredo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Επανάληψη"
|
||
|
||
#: tfrmeditor.acteditredo.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
|
||
msgid "Redo"
|
||
msgstr "Επανάληψη"
|
||
|
||
#: tfrmeditor.acteditrplc.caption
|
||
msgid "&Replace"
|
||
msgstr "Αντικατάσταση"
|
||
|
||
#: tfrmeditor.acteditrplc.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT"
|
||
msgid "Replace"
|
||
msgstr "Αντικατάσταση"
|
||
|
||
#: tfrmeditor.acteditselectall.caption
|
||
msgid "Select&All"
|
||
msgstr "Επιλογή Όλων"
|
||
|
||
#: tfrmeditor.acteditselectall.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT"
|
||
msgid "Select All"
|
||
msgstr "Επιλογή Όλων"
|
||
|
||
#: tfrmeditor.acteditundo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Αναίρεση"
|
||
|
||
#: tfrmeditor.acteditundo.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Αναίρεση"
|
||
|
||
#: tfrmeditor.actfileclose.caption
|
||
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmeditor.actfileclose.hint
|
||
msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT"
|
||
msgid "Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmeditor.actfileexit.caption
|
||
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Έξοδος"
|
||
|
||
#: tfrmeditor.actfileexit.hint
|
||
msgctxt "tfrmeditor.actfileexit.hint"
|
||
msgid "Exit"
|
||
msgstr "Έξοδος"
|
||
|
||
#: tfrmeditor.actfilenew.caption
|
||
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
|
||
msgid "&New"
|
||
msgstr "Νέο"
|
||
|
||
#: tfrmeditor.actfilenew.hint
|
||
msgctxt "TFRMEDITOR.ACTFILENEW.HINT"
|
||
msgid "New"
|
||
msgstr "Νέο"
|
||
|
||
#: tfrmeditor.actfileopen.caption
|
||
msgid "&Open"
|
||
msgstr "Άνοιγμα"
|
||
|
||
#: tfrmeditor.actfileopen.hint
|
||
msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT"
|
||
msgid "Open"
|
||
msgstr "Άνοιγμα"
|
||
|
||
#: tfrmeditor.actfilesave.caption
|
||
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmeditor.actfilesave.hint
|
||
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmeditor.actfilesaveas.caption
|
||
msgid "Save &As..."
|
||
msgstr "Αποθήκευση Ως..."
|
||
|
||
#: tfrmeditor.actfilesaveas.hint
|
||
msgid "Save As"
|
||
msgstr "Αποθήκευση Ως"
|
||
|
||
#: tfrmeditor.actsaveall.caption
|
||
msgid "Sa&ve All"
|
||
msgstr "Αποθήκευση Όλων"
|
||
|
||
#: tfrmeditor.actsaveall.hint
|
||
msgid "Save All"
|
||
msgstr "Αποθήκευση Όλων"
|
||
|
||
#: tfrmeditor.caption
|
||
msgctxt "TFRMEDITOR.CAPTION"
|
||
msgid "Editor"
|
||
msgstr "Επεξεργαστής"
|
||
|
||
#: tfrmeditor.help1.caption
|
||
msgctxt "TFRMEDITOR.HELP1.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Βοήθεια"
|
||
|
||
#: tfrmeditor.menuitem1.caption
|
||
msgctxt "tfrmeditor.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.midiv.caption
|
||
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miedit.caption
|
||
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmeditor.miencoding.caption
|
||
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Κωδικοποίηση"
|
||
|
||
#: tfrmeditor.miencodingin.caption
|
||
msgid "Open as"
|
||
msgstr "Άνοιγμα ως"
|
||
|
||
#: tfrmeditor.miencodingout.caption
|
||
msgctxt "tfrmeditor.miencodingout.caption"
|
||
msgid "Save as"
|
||
msgstr "Αποθήκευση ως"
|
||
|
||
#: tfrmeditor.mifile.caption
|
||
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "Αρχείο"
|
||
|
||
#: tfrmeditor.mihighlight.caption
|
||
msgid "Syntax highlight"
|
||
msgstr "Υπογράμμιση Σύνταξης"
|
||
|
||
#: tfrmeditor.milineendtype.caption
|
||
msgid "End Of Line"
|
||
msgstr "Τέλος Γραμμής"
|
||
|
||
#: tfrmeditor.miseparator1.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miseparator2.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n1.caption
|
||
msgctxt "TFRMEDITOR.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n3.caption
|
||
msgctxt "TFRMEDITOR.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n4.caption
|
||
msgctxt "TFRMEDITOR.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n5.caption
|
||
msgctxt "TFRMEDITOR.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
||
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
|
||
msgid "C&ase sensitivity"
|
||
msgstr "Διάκριση Πεζών-Κεφαλαίων"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
|
||
msgid "S&earch from caret"
|
||
msgstr "Αναζήτηση από το σημείο εισαγωγής"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
|
||
msgid "&Regular expressions"
|
||
msgstr "Συνήθεις Φράσεις"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
|
||
msgid "Selected &text only"
|
||
msgstr "Το Επιλεγμένο κείμενο μόνο"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
|
||
msgid "&Whole words only"
|
||
msgstr "Ολόκληρες λέξεις μόνο"
|
||
|
||
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
|
||
msgid "Option"
|
||
msgstr "Ιδιότητα"
|
||
|
||
#: tfrmeditsearchreplace.lblreplacewith.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
|
||
msgid "&Replace with:"
|
||
msgstr "Αντικατάσταση με:"
|
||
|
||
#: tfrmeditsearchreplace.lblsearchfor.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
|
||
msgid "&Search for:"
|
||
msgstr "Αναζήτηση για:"
|
||
|
||
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
|
||
msgid "Direction"
|
||
msgstr "Κατεύθυνση"
|
||
|
||
#: tfrmextractdlg.caption
|
||
msgctxt "TFRMEXTRACTDLG.CAPTION"
|
||
msgid "Unpack files"
|
||
msgstr "Ξεπακετάρισμα αρχείων"
|
||
|
||
#: tfrmextractdlg.cbextractpath.caption
|
||
msgid "&Unpack path names if stored with files"
|
||
msgstr "Ξεπακετάρισμα ονομάτων διαδρομών αν είναι αποθηκευμένα με τα αρχεία"
|
||
|
||
#: tfrmextractdlg.cbfilemask.text
|
||
msgctxt "tfrmextractdlg.cbfilemask.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmextractdlg.cbinseparatefolder.caption
|
||
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
||
msgstr "Ξεπακετάρισμα κάθε αρχειοθήκης σε ένα ξεχωριστό υποκατάλογο (όνομα της αρχειοθήκης)"
|
||
|
||
#: tfrmextractdlg.cboverwrite.caption
|
||
msgid "O&verwrite existing files"
|
||
msgstr "Αντικατάσταση υπάρχοντων αρχείων"
|
||
|
||
#: tfrmextractdlg.lblextractto.caption
|
||
msgid "To the &directory:"
|
||
msgstr "Στον κατάλογο:"
|
||
|
||
#: tfrmextractdlg.lblfilemask.caption
|
||
msgid "&Extract files matching file mask:"
|
||
msgstr "Εξαγωγή αρχείων που ταιριάζουν στη μάσκα αρχείου:"
|
||
|
||
#: tfrmextractdlg.lblpassword.caption
|
||
msgid "&Password for encrypted files:"
|
||
msgstr "&Συνθηματικό για κρυπτογραφημένα αρχεία:"
|
||
|
||
#: tfrmfileexecuteyourself.btnclose.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmfileexecuteyourself.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
|
||
msgid "Wait..."
|
||
msgstr "Αναμονή..."
|
||
|
||
#: tfrmfileexecuteyourself.lblfilename.caption
|
||
msgid "File name:"
|
||
msgstr "Όνομα αρχείου:"
|
||
|
||
#: tfrmfileexecuteyourself.lblfrompath.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
|
||
msgid "From:"
|
||
msgstr "Από:"
|
||
|
||
#: tfrmfileexecuteyourself.lblprompt.caption
|
||
msgid "Click on Close when the temporary file can be deleted!"
|
||
msgstr "Κάντε κλικ στο Κλείσιμο όταν το προσωρινό αρχείο δε μπορεί να διαγραφεί!"
|
||
|
||
#: tfrmfileop.btncancel.caption
|
||
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmfileop.btnminimizetopanel.caption
|
||
msgid "&To panel"
|
||
msgstr "Στο πάνελ"
|
||
|
||
#: tfrmfileop.btnviewoperations.caption
|
||
msgid "&View all"
|
||
msgstr "Προβολή όλων"
|
||
|
||
#: tfrmfileop.lblcurrentoperation.caption
|
||
msgid "Current operation:"
|
||
msgstr "Τρέχουσα Ενέργεια"
|
||
|
||
#: tfrmfileop.lblfrom.caption
|
||
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
||
msgid "From:"
|
||
msgstr "Από:"
|
||
|
||
#: tfrmfileop.lblto.caption
|
||
msgid "To:"
|
||
msgstr "Σε:"
|
||
|
||
#: tfrmfileproperties.btnclose.caption
|
||
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmfileproperties.btnsetproperties.caption
|
||
msgid "&Set properties"
|
||
msgstr "Καθορισμός Ιδιοτήτων"
|
||
|
||
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
||
msgid "Set to &all selected files"
|
||
msgstr "Καθορισμός σε όλα τα επιλεγμένα αρχεία"
|
||
|
||
#: tfrmfileproperties.btnskipfile.caption
|
||
msgid "Ski&p this file"
|
||
msgstr "Παράβλεψη αυτού του αρχείου"
|
||
|
||
#: tfrmfileproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Ιδιότητες"
|
||
|
||
#: tfrmfileproperties.cbsgid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmfileproperties.cbsticky.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Κολημμένα"
|
||
|
||
#: tfrmfileproperties.cbsuid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmfileproperties.chkexecutable.caption
|
||
msgid "Allow &executing file as program"
|
||
msgstr "Αποδοχή εκτέλεσης αρχείου σαν πρόγραμμα"
|
||
|
||
#: tfrmfileproperties.gbowner.caption
|
||
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Ιδιοκτήτης"
|
||
|
||
#: tfrmfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Bits:"
|
||
|
||
#: tfrmfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Γκρουπ"
|
||
|
||
#: tfrmfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Άλλοι"
|
||
|
||
#: tfrmfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Ιδιοκτήτης"
|
||
|
||
#: tfrmfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Κείμενο:"
|
||
|
||
#: tfrmfileproperties.lblcontains.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lblcontainsstr.caption
|
||
msgid "Contains:"
|
||
msgstr "Περιεχόμενα:"
|
||
|
||
#: tfrmfileproperties.lblexec.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Εκτέλεση"
|
||
|
||
#: tfrmfileproperties.lblexecutable.caption
|
||
msgid "Execute:"
|
||
msgstr "Εκτέλεση:"
|
||
|
||
#: tfrmfileproperties.lblfile.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Όνομα Αρχείου"
|
||
|
||
#: tfrmfileproperties.lblfilename.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lblfilestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Όνομα Αρχείου"
|
||
|
||
#: tfrmfileproperties.lblfolder.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lblfolderstr.caption
|
||
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
||
msgid "Path:"
|
||
msgstr "Διαδρομή:"
|
||
|
||
#: tfrmfileproperties.lblgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
|
||
msgid "&Group"
|
||
msgstr "Γκρουπ"
|
||
|
||
#: tfrmfileproperties.lbllastaccess.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lbllastaccessstr.caption
|
||
msgid "Last access:"
|
||
msgstr "Τελευταία προσπέλαση:"
|
||
|
||
#: tfrmfileproperties.lbllastmodif.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lbllastmodifstr.caption
|
||
msgid "Last modification:"
|
||
msgstr "Τελευταία διαμόρφωση:"
|
||
|
||
#: tfrmfileproperties.lbllaststchange.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lbllaststchangestr.caption
|
||
msgid "Last status change:"
|
||
msgstr "Τελευταία αλλαγή κατάστασης:"
|
||
|
||
#: tfrmfileproperties.lbloctal.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Octal:"
|
||
|
||
#: tfrmfileproperties.lblownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
|
||
msgid "O&wner"
|
||
msgstr "Ιδιοκτήτης"
|
||
|
||
#: tfrmfileproperties.lblread.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Ανάγνωση"
|
||
|
||
#: tfrmfileproperties.lblsize.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lblsizestr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
|
||
msgid "Size:"
|
||
msgstr "Μέγεθος:"
|
||
|
||
#: tfrmfileproperties.lblsymlink.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lblsymlinkstr.caption
|
||
msgid "Symlink to:"
|
||
msgstr "Συμβολοδεσμός στο:"
|
||
|
||
#: tfrmfileproperties.lbltype.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
||
msgid "???"
|
||
msgstr ";;;"
|
||
|
||
#: tfrmfileproperties.lbltypestr.caption
|
||
msgid "Type:"
|
||
msgstr "Τύπος:"
|
||
|
||
#: tfrmfileproperties.lblwrite.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Εγγραφή"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
||
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Όνομα"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
||
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
||
msgid "Value"
|
||
msgstr "Τιμή"
|
||
|
||
#: tfrmfileproperties.tsattributes.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Ιδιότητες"
|
||
|
||
#: tfrmfileproperties.tsimage.caption
|
||
msgid "Image"
|
||
msgstr "Εικόνα"
|
||
|
||
#: tfrmfileproperties.tsproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Ιδιότητες"
|
||
|
||
#: tfrmfinddlg.actcancel.caption
|
||
msgctxt "tfrmfinddlg.actcancel.caption"
|
||
msgid "C&ancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmfinddlg.actcancelclose.caption
|
||
msgid "Cancel search and close window"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmfinddlg.actclose.caption
|
||
msgctxt "tfrmfinddlg.actclose.caption"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
||
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Διαμόρφωση των ειδικών πλήκτρων"
|
||
|
||
#: tfrmfinddlg.actedit.caption
|
||
msgctxt "tfrmfinddlg.actedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmfinddlg.actfeedtolistbox.caption
|
||
msgid "Feed to &listbox"
|
||
msgstr "Τροφοδοσία στο listbox"
|
||
|
||
#: tfrmfinddlg.actfreefrommem.caption
|
||
msgid "Cancel search, close and free from memory"
|
||
msgstr "Ακύρωση αναζήτησης, κλείσιμο και απελευθέρωση από τη μνήμη"
|
||
|
||
#: tfrmfinddlg.actfreefrommemallothers.caption
|
||
msgid "For all other \"Find files\", cancel, close and free from memory"
|
||
msgstr "Για όλα τα άλλα \"Αναζήτηση Αρχείων\", ακύρωση, κλείσιμο και απελευθέρωση από τη μνήμη"
|
||
|
||
#: tfrmfinddlg.actgotofile.caption
|
||
msgid "&Go to file"
|
||
msgstr "&Μετάβαση στο αρχείο"
|
||
|
||
#: tfrmfinddlg.actintellifocus.caption
|
||
msgctxt "tfrmfinddlg.actintellifocus.caption"
|
||
msgid "Find Data"
|
||
msgstr "Εύρεση Δεδομένων"
|
||
|
||
#: tfrmfinddlg.actlastsearch.caption
|
||
msgid "&Last search"
|
||
msgstr "Τελευταία Αναζήτηση"
|
||
|
||
#: tfrmfinddlg.actnewsearch.caption
|
||
msgid "&New search"
|
||
msgstr "Νέα Αναζήτηση"
|
||
|
||
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
||
msgid "New search (clear filters)"
|
||
msgstr "Νέα Αναζήτηση (καθαρισμός φίλτρων)"
|
||
|
||
#: tfrmfinddlg.actpageadvanced.caption
|
||
msgid "Go to page \"Advanced\""
|
||
msgstr "Μετάβαση στη σελίδα \"Για Προχωρημένους\""
|
||
|
||
#: tfrmfinddlg.actpageloadsave.caption
|
||
msgid "Go to page \"Load/Save\""
|
||
msgstr "Μετάβαση στη σελίδα \"Φόρτωμα/Αποθήκευση\""
|
||
|
||
#: tfrmfinddlg.actpagenext.caption
|
||
msgid "Switch to Nex&t Page"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageplugins.caption
|
||
msgid "Go to page \"Plugins\""
|
||
msgstr "Μετάβαση στη σελίδα \"Πρόσθετα\""
|
||
|
||
#: tfrmfinddlg.actpageprev.caption
|
||
msgid "Switch to &Previous Page"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageresults.caption
|
||
msgid "Go to page \"Results\""
|
||
msgstr "Μετάβαση στη σελίδα \"Αποτελέσματα\""
|
||
|
||
#: tfrmfinddlg.actpagestandard.caption
|
||
msgid "Go to page \"Standard\""
|
||
msgstr "Μετάβαση στη σελίδα \"Προκαθορισμένα\""
|
||
|
||
#: tfrmfinddlg.actstart.caption
|
||
msgctxt "tfrmfinddlg.actstart.caption"
|
||
msgid "&Start"
|
||
msgstr "Εκκίνηση"
|
||
|
||
#: tfrmfinddlg.actview.caption
|
||
msgctxt "tfrmfinddlg.actview.caption"
|
||
msgid "&View"
|
||
msgstr "Προβολή"
|
||
|
||
#: tfrmfinddlg.btnaddattribute.caption
|
||
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmfinddlg.btnattrshelp.caption
|
||
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Βοήθεια"
|
||
|
||
#: tfrmfinddlg.btnsavetemplate.caption
|
||
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmfinddlg.btnsearchdelete.caption
|
||
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmfinddlg.btnsearchload.caption
|
||
msgid "L&oad"
|
||
msgstr "Φόρτωση"
|
||
|
||
#: tfrmfinddlg.btnsearchsave.caption
|
||
msgid "S&ave"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
||
msgid "Sa&ve with \"Start in directory\""
|
||
msgstr "Αποθήκευση με \"Εκκίνηση στον κατάλογο\""
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
||
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
||
msgstr "Αν αποθηκεύτηκε τότε \"Εκκίνηση στον κατάλογο\" θα επανέλθει όταν φορτώνεται το πρότυπο. Χρησιμοποιείστε το αν επιθυμείτε να διορθώσετε την αναζήτηση σε ένα συγκεκριμένο κατάλογο"
|
||
|
||
#: tfrmfinddlg.btnusetemplate.caption
|
||
msgid "Use template"
|
||
msgstr "Χρήση Προτύπου"
|
||
|
||
#: tfrmfinddlg.caption
|
||
msgctxt "TFRMFINDDLG.CAPTION"
|
||
msgid "Find files"
|
||
msgstr "Εύρεση αρχείων"
|
||
|
||
#: tfrmfinddlg.cbcasesens.caption
|
||
msgid "Case sens&itive"
|
||
msgstr "Με Διάκριση Πεζών-Κεφαλαίων"
|
||
|
||
#: tfrmfinddlg.cbdatefrom.caption
|
||
msgid "&Date from:"
|
||
msgstr "Ημερομηνία από:"
|
||
|
||
#: tfrmfinddlg.cbdateto.caption
|
||
msgid "Dat&e to:"
|
||
msgstr "Ημερομηνία στο:"
|
||
|
||
#: tfrmfinddlg.cbfilesizefrom.caption
|
||
msgid "S&ize from:"
|
||
msgstr "Μέγεθος από:"
|
||
|
||
#: tfrmfinddlg.cbfilesizeto.caption
|
||
msgid "Si&ze to:"
|
||
msgstr "Μέγεθος σε:"
|
||
|
||
#: tfrmfinddlg.cbfindinarchive.caption
|
||
msgid "Search in &archives"
|
||
msgstr "Αναζήτηση στις αρχειοθήκες"
|
||
|
||
#: tfrmfinddlg.cbfindtext.caption
|
||
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
|
||
msgid "Find &text in file"
|
||
msgstr "Εύρεση κειμένου στο αρχείο"
|
||
|
||
#: tfrmfinddlg.cbfollowsymlinks.caption
|
||
msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION"
|
||
msgid "Follow s&ymlinks"
|
||
msgstr "Ακολουθείστε τους Συμβολοδεσμούς"
|
||
|
||
#: tfrmfinddlg.cbnotcontainingtext.caption
|
||
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
|
||
msgid "Find files N&OT containing the text"
|
||
msgstr "Εύρεση αρχείων που ΔΕΝ περιέχουν το κείμενο"
|
||
|
||
#: tfrmfinddlg.cbnotolderthan.caption
|
||
msgid "N&ot older than:"
|
||
msgstr "Όχι παλαιότερο από:"
|
||
|
||
#: tfrmfinddlg.cbopenedtabs.caption
|
||
msgid "Opened tabs"
|
||
msgstr "Ανοικτές Καρτέλες"
|
||
|
||
#: tfrmfinddlg.cbpartialnamesearch.caption
|
||
msgid "Searc&h for part of file name"
|
||
msgstr "Αναζήτηση τμήματος του ονόματος αρχείου"
|
||
|
||
#: tfrmfinddlg.cbregexp.caption
|
||
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
|
||
msgid "&Regular expression"
|
||
msgstr "Συνήθης Φράση"
|
||
|
||
#: tfrmfinddlg.cbreplacetext.caption
|
||
msgid "Re&place by"
|
||
msgstr "Αντικατάσταση από"
|
||
|
||
#: tfrmfinddlg.cbselectedfiles.caption
|
||
msgid "Selected directories and &files"
|
||
msgstr "Επιλεγμένοι κατάλογοι και αρχεία"
|
||
|
||
#: tfrmfinddlg.cbtextregexp.caption
|
||
msgid "Regular &expression"
|
||
msgstr "Συνήθης Φράση"
|
||
|
||
#: tfrmfinddlg.cbtimefrom.caption
|
||
msgid "&Time from:"
|
||
msgstr "Ώρα από:"
|
||
|
||
#: tfrmfinddlg.cbtimeto.caption
|
||
msgid "Ti&me to:"
|
||
msgstr "Ώρα στο:"
|
||
|
||
#: tfrmfinddlg.cbuseplugin.caption
|
||
msgid "&Use search plugin:"
|
||
msgstr "Χρήση προσθέτου αναζήτησης:"
|
||
|
||
#: tfrmfinddlg.cmbexcludedirectories.hint
|
||
msgid "Enter directories names that should be excluded from search separated with \";\""
|
||
msgstr "εισαγωγή ονομάτων καταλόγων που θα έπρεπε να αποκλειστούν από την αναζήτηση, διαχωρισμένων με \";\""
|
||
|
||
#: tfrmfinddlg.cmbexcludefiles.hint
|
||
msgid "Enter files names that should be excluded from search separated with \";\""
|
||
msgstr "Εισαγωγή ονομάτων αρχείων τα οποία θα έπρεπε να εξαιρεθούν από αναζήτηση διαχωρισμένη με \";\""
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.hint
|
||
msgid "Enter files names separated with \";\""
|
||
msgstr "Εισαγωγή ονομάτων αρχείων διαχωρισμένα με \";\""
|
||
|
||
#: tfrmfinddlg.gbdirectories.caption
|
||
msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION"
|
||
msgid "Directories"
|
||
msgstr "Κατάλογοι"
|
||
|
||
#: tfrmfinddlg.gbfiles.caption
|
||
msgctxt "TFRMFINDDLG.GBFILES.CAPTION"
|
||
msgid "Files"
|
||
msgstr "Αρχεία"
|
||
|
||
#: tfrmfinddlg.gbfinddata.caption
|
||
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
||
msgid "Find Data"
|
||
msgstr "Εύρεση Δεδομένων"
|
||
|
||
#: tfrmfinddlg.lblattributes.caption
|
||
msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION"
|
||
msgid "Attri&butes"
|
||
msgstr "Ιδιότητες"
|
||
|
||
#: tfrmfinddlg.lblencoding.caption
|
||
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
|
||
msgid "Encodin&g:"
|
||
msgstr "Κωδικοποίηση:"
|
||
|
||
#: tfrmfinddlg.lblexcludedirectories.caption
|
||
msgid "E&xclude subdirectories"
|
||
msgstr "Αποκλεισμός υποκαταλόγων"
|
||
|
||
#: tfrmfinddlg.lblexcludefiles.caption
|
||
msgid "&Exclude files"
|
||
msgstr "&Εξαίρεση αρχείων"
|
||
|
||
#: tfrmfinddlg.lblfindfilemask.caption
|
||
msgid "&File mask"
|
||
msgstr "Μάσκα Αρχείου"
|
||
|
||
#: tfrmfinddlg.lblfindpathstart.caption
|
||
msgid "Start in &directory"
|
||
msgstr "Εκκίνηση στον κατάλογο"
|
||
|
||
#: tfrmfinddlg.lblsearchdepth.caption
|
||
msgid "Search su&bdirectories:"
|
||
msgstr "Αναζήτηση υποκαταλόγων:"
|
||
|
||
#: tfrmfinddlg.lbltemplateheader.caption
|
||
msgid "&Previous searches:"
|
||
msgstr "Προηγούμενες αναζητήσεις:"
|
||
|
||
#: tfrmfinddlg.miaction.caption
|
||
msgid "&Action"
|
||
msgstr "Ενέργεια"
|
||
|
||
#: tfrmfinddlg.mifreefrommemallothers.caption
|
||
msgid "For all others, cancel, close and free from memory"
|
||
msgstr "Για όλα τα άλλα, ακύρωση, κλείσιμο και απελευθέρωση από τη μνήμη"
|
||
|
||
#: tfrmfinddlg.miopeninnewtab.caption
|
||
msgid "Open In New Tab(s)"
|
||
msgstr "Άνοιγμα σε Νέα Καρτέλα(ες)"
|
||
|
||
#: tfrmfinddlg.mioptions.caption
|
||
msgctxt "tfrmfinddlg.mioptions.caption"
|
||
msgid "Options"
|
||
msgstr "Επιλογές"
|
||
|
||
#: tfrmfinddlg.miremovefromllist.caption
|
||
msgid "Remove from list"
|
||
msgstr "Απομάκρυνση από τη λίστα"
|
||
|
||
#: tfrmfinddlg.miresult.caption
|
||
msgid "&Result"
|
||
msgstr "Αποτέλεσμα"
|
||
|
||
#: tfrmfinddlg.miseparator1.caption
|
||
msgctxt "tfrmfinddlg.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.miseparator2.caption
|
||
msgctxt "tfrmfinddlg.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.mishowallfound.caption
|
||
msgid "Show all found items"
|
||
msgstr "Εμφάνιση όλων των ευρεθέντων αντικειμένων"
|
||
|
||
#: tfrmfinddlg.mishowineditor.caption
|
||
msgid "Show In Editor"
|
||
msgstr "Εμφάνιση στον Επεξεργαστή"
|
||
|
||
#: tfrmfinddlg.mishowinviewer.caption
|
||
msgid "Show In Viewer"
|
||
msgstr "Εμφάνιση στον Προβολέα"
|
||
|
||
#: tfrmfinddlg.miviewtab.caption
|
||
msgctxt "tfrmfinddlg.miviewtab.caption"
|
||
msgid "&View"
|
||
msgstr "Προβολή"
|
||
|
||
#: tfrmfinddlg.tsadvanced.caption
|
||
msgid "Advanced"
|
||
msgstr "Για προχωρημένους"
|
||
|
||
#: tfrmfinddlg.tsloadsave.caption
|
||
msgid "Load/Save"
|
||
msgstr "Φόρτωση/Αποθήκευση"
|
||
|
||
#: tfrmfinddlg.tsplugins.caption
|
||
msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION"
|
||
msgid "Plugins"
|
||
msgstr "Πρόσθετα"
|
||
|
||
#: tfrmfinddlg.tsresults.caption
|
||
msgid "Results"
|
||
msgstr "Αποτελέσματα"
|
||
|
||
#: tfrmfinddlg.tsstandard.caption
|
||
msgid "Standard"
|
||
msgstr "Στάνταρ"
|
||
|
||
#: tfrmfindview.btnclose.caption
|
||
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmfindview.btnfind.caption
|
||
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
||
msgid "&Find"
|
||
msgstr "Εύρεση"
|
||
|
||
#: tfrmfindview.caption
|
||
msgctxt "TFRMFINDVIEW.CAPTION"
|
||
msgid "Find"
|
||
msgstr "Εύρεση"
|
||
|
||
#: tfrmfindview.cbcasesens.caption
|
||
msgid "C&ase sensitive"
|
||
msgstr "Με Διάκριση Πεζών-Κεφαλαίων"
|
||
|
||
#: tfrmhardlink.btncancel.caption
|
||
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmhardlink.btnok.caption
|
||
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmhardlink.caption
|
||
msgid "Create hard link"
|
||
msgstr "Δημιουργία δεσμού τύπου hard link"
|
||
|
||
#: tfrmhardlink.lblexistingfile.caption
|
||
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "Προορισμός τον οποίο θα υποδείξει ο δεσμός"
|
||
|
||
#: tfrmhardlink.lbllinktocreate.caption
|
||
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "Όνομα Δεσμού"
|
||
|
||
#: tfrmhotdirexportimport.btnselectall.caption
|
||
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTALL.CAPTION"
|
||
msgid "Import all!"
|
||
msgstr "Εισαγωγή όλων!"
|
||
|
||
#: tfrmhotdirexportimport.btnselectiondone.caption
|
||
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTIONDONE.CAPTION"
|
||
msgid "Import selected"
|
||
msgstr "Εισαγωγή επιλεγμένων"
|
||
|
||
#: tfrmhotdirexportimport.caption
|
||
msgid "Select the entries your want to import"
|
||
msgstr "Επιλέξτε τις καταχωρήσεις που επιθυμείτε να εισαγάγετε"
|
||
|
||
#: tfrmhotdirexportimport.lbhint.caption
|
||
msgid "When clicking a sub-menu, it will select the whole menu"
|
||
msgstr "Όταν γίνεται κλικ σε ένα υπομενού, επιλέγεται ολόκληρο το μενού"
|
||
|
||
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
||
msgid "Hold CTRL and click entries to select multiple ones"
|
||
msgstr "Κρατείστε πατημένο το CTRL και κάντε κλικ στις καταχωρήσεις για να επιλέξετε πολλές μαζί"
|
||
|
||
#: tfrmlinker.btnsave.caption
|
||
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmlinker.caption
|
||
msgctxt "TFRMLINKER.CAPTION"
|
||
msgid "Linker"
|
||
msgstr "Linker"
|
||
|
||
#: tfrmlinker.gbsaveto.caption
|
||
msgid "Save to..."
|
||
msgstr "Αποθήκευση σε..."
|
||
|
||
#: tfrmlinker.grbxcontrol.caption
|
||
msgid "Item"
|
||
msgstr "Αντικείμενο"
|
||
|
||
#: tfrmlinker.lblfilename.caption
|
||
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
|
||
msgid "&File name"
|
||
msgstr "Όνομα Αρχείου"
|
||
|
||
#: tfrmlinker.spbtndown.caption
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
|
||
msgid "Do&wn"
|
||
msgstr "Κάτω"
|
||
|
||
#: tfrmlinker.spbtndown.hint
|
||
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
|
||
msgid "Down"
|
||
msgstr "Κάτω"
|
||
|
||
#: tfrmlinker.spbtnrem.caption
|
||
msgctxt "TFRMLINKER.SPBTNREM.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Αφαίρεση"
|
||
|
||
#: tfrmlinker.spbtnrem.hint
|
||
msgctxt "TFRMLINKER.SPBTNREM.HINT"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmlinker.spbtnup.caption
|
||
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
|
||
msgid "&Up"
|
||
msgstr "Πάνω"
|
||
|
||
#: tfrmlinker.spbtnup.hint
|
||
msgctxt "TFRMLINKER.SPBTNUP.HINT"
|
||
msgid "Up"
|
||
msgstr "Πάνω"
|
||
|
||
#: tfrmmain.actabout.caption
|
||
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
|
||
msgid "&About"
|
||
msgstr "Σχετικά"
|
||
|
||
#: tfrmmain.actaddfilenametocmdline.caption
|
||
msgid "Add file name to command line"
|
||
msgstr "Προσθήκη ονόματος αρχείου στη γραμμή εντολών"
|
||
|
||
#: tfrmmain.actaddnewsearch.caption
|
||
msgid "New search instance..."
|
||
msgstr "Νέο περιστατικό αναζήτησης..."
|
||
|
||
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
||
msgid "Add path and file name to command line"
|
||
msgstr "Προσθήκη διαδρομής και ονόματος αρχείου στη γραμμή εντολών"
|
||
|
||
#: tfrmmain.actaddpathtocmdline.caption
|
||
msgid "Copy path to command line"
|
||
msgstr "Αντιγραφή διαδρομής στη γραμμή εντολών"
|
||
|
||
#: tfrmmain.actbriefview.caption
|
||
msgctxt "tfrmmain.actbriefview.caption"
|
||
msgid "Brief view"
|
||
msgstr "Σύντομη προβολή"
|
||
|
||
#: tfrmmain.actbriefview.hint
|
||
msgid "Brief View"
|
||
msgstr "Σύντομη Προβολή"
|
||
|
||
#: tfrmmain.actcalculatespace.caption
|
||
msgid "Calculate &Occupied Space"
|
||
msgstr "Υπολογισμός του Απασχολημένου Χώρου"
|
||
|
||
#: tfrmmain.actchangedir.caption
|
||
msgid "Change directory"
|
||
msgstr "Αλλαγή Καταλόγου"
|
||
|
||
#: tfrmmain.actchangedirtohome.caption
|
||
msgid "Change directory to home"
|
||
msgstr "Αλλαγή Καταλόγου σε αρχικό κατάλογο"
|
||
|
||
#: tfrmmain.actchangedirtoparent.caption
|
||
msgid "Change Directory To Parent"
|
||
msgstr "Αλλαγή Καταλόγου σε γονικό κατάλογο"
|
||
|
||
#: tfrmmain.actchangedirtoroot.caption
|
||
msgid "Change directory to root"
|
||
msgstr "Αλλαγή Καταλόγου στον κατάλογο του root"
|
||
|
||
#: tfrmmain.actchecksumcalc.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
|
||
msgid "Calculate Check&sum..."
|
||
msgstr "Υπολογισμός αθροίσματος ελέγχου..."
|
||
|
||
#: tfrmmain.actchecksumverify.caption
|
||
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
|
||
msgid "&Verify Checksum..."
|
||
msgstr "Επιβεβαίωση αθροίσματος ελέγχου..."
|
||
|
||
#: tfrmmain.actclearlogfile.caption
|
||
msgid "Clear log file"
|
||
msgstr "Καθαρισμός αρχείου καταγραφών"
|
||
|
||
#: tfrmmain.actclearlogwindow.caption
|
||
msgid "Clear log window"
|
||
msgstr "Καθαρισμός παραθύρου καταγραφής"
|
||
|
||
#: tfrmmain.actclosealltabs.caption
|
||
msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION"
|
||
msgid "Close &All Tabs"
|
||
msgstr "Κλείσιμο όλων των Καρτελών"
|
||
|
||
#: tfrmmain.actcloseduplicatetabs.caption
|
||
msgid "Close Duplicate Tabs"
|
||
msgstr "Κλείσιμο των διπλασιασμένων καταλόγων"
|
||
|
||
#: tfrmmain.actclosetab.caption
|
||
msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION"
|
||
msgid "&Close Tab"
|
||
msgstr "Κλείσιμο Καρτέλας"
|
||
|
||
#: tfrmmain.actcmdlinenext.caption
|
||
msgid "Next Command Line"
|
||
msgstr "Επόμενη Γραμμή Εντολών"
|
||
|
||
#: tfrmmain.actcmdlinenext.hint
|
||
msgid "Set command line to next command in history"
|
||
msgstr "Ορισμός της γραμμής εντολών στην επόμενη εντολή στο ιστορικό"
|
||
|
||
#: tfrmmain.actcmdlineprev.caption
|
||
msgid "Previous Command Line"
|
||
msgstr "Προηγούμενη Γραμμή Εντολών"
|
||
|
||
#: tfrmmain.actcmdlineprev.hint
|
||
msgid "Set command line to previous command in history"
|
||
msgstr "Ορισμός της γραμμής εντολών στην προηγούμενη εντολή στο ιστορικό"
|
||
|
||
#: tfrmmain.actcolumnsview.caption
|
||
msgid "Full"
|
||
msgstr "Πλήρες"
|
||
|
||
#: tfrmmain.actcolumnsview.hint
|
||
msgid "Columns View"
|
||
msgstr "Προβολή Στηλών"
|
||
|
||
#: tfrmmain.actcomparecontents.caption
|
||
msgid "Compare by &Contents"
|
||
msgstr "Σύγκριση κατά Περιεχόμενα"
|
||
|
||
#: tfrmmain.actcomparedirectories.caption
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
|
||
msgid "Compare Directories"
|
||
msgstr "Σύγκριση Καταλόγων"
|
||
|
||
#: tfrmmain.actcomparedirectories.hint
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
||
msgid "Compare Directories"
|
||
msgstr "Σύγκριση Καταλόγων"
|
||
|
||
#: tfrmmain.actconfigdirhotlist.caption
|
||
msgctxt "TFRMMAIN.ACTCONFIGDIRHOTLIST.CAPTION"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Διαμόρφωση του καταλόγου Hotlist"
|
||
|
||
#: tfrmmain.actconfigfavoritetabs.caption
|
||
msgid "Configuration of Favorite Tabs"
|
||
msgstr "Διαμόρφωση των Αγαπημένων Καρτελών"
|
||
|
||
#: tfrmmain.actconfigfoldertabs.caption
|
||
msgid "Configuration of folder tabs"
|
||
msgstr "Διαμόρφωση των Καρτελών Φακέλων"
|
||
|
||
#: tfrmmain.actconfighotkeys.caption
|
||
msgctxt "tfrmmain.actconfighotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Διαμόρφωση των ειδικών πλήκτρων"
|
||
|
||
#: tfrmmain.actconfigsavesettings.caption
|
||
msgid "Save Settings"
|
||
msgstr "Αποθήκευση Ρυθμίσεων"
|
||
|
||
#: tfrmmain.actconfigsearches.caption
|
||
msgid "Configuration of searches"
|
||
msgstr "Διαμόρφωση των αναζητήσεων"
|
||
|
||
#: tfrmmain.actconfigtoolbars.caption
|
||
msgid "Toolbar..."
|
||
msgstr "Γραμμή εργαλείων"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenus.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Ρύθμιση του Μενού Προβολής Δέντρου"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Ρύθμιση Χρωμάτων του Μενού Προβολής Δέντρου"
|
||
|
||
#: tfrmmain.actcontextmenu.caption
|
||
msgid "Show context menu"
|
||
msgstr "Εμφάνιση μενού περιεχομένων"
|
||
|
||
#: tfrmmain.actcopy.caption
|
||
msgctxt "tfrmmain.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmmain.actcopyalltabstoopposite.caption
|
||
msgid "Copy all tabs to opposite side"
|
||
msgstr "Αντιγραφή όλων των καρτελών στην απέναντι πλευρά"
|
||
|
||
#: tfrmmain.actcopyfiledetailstoclip.caption
|
||
msgid "Copy all shown &columns"
|
||
msgstr "Αντιγραφή όλων των εμφανισμένων στηλών"
|
||
|
||
#: tfrmmain.actcopyfullnamestoclip.caption
|
||
msgid "Copy Filename(s) with Full &Path"
|
||
msgstr "Αντιγραφή Ονόματος Αρχείου(ων) με την Πλήρη Διαδρομή"
|
||
|
||
#: tfrmmain.actcopynamestoclip.caption
|
||
msgid "Copy &Filename(s) to Clipboard"
|
||
msgstr "Αντιγραφή Ονόματος Αρχείου(ων) στο Πρόχειρο"
|
||
|
||
#: tfrmmain.actcopynoask.caption
|
||
msgid "Copy files without asking for confirmation"
|
||
msgstr "Αντιγραφή αρχείων χωρίς ερώτηση επιβεβαίωσης"
|
||
|
||
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
||
msgstr "Αντιγραφή πλήρους διαδρομής του επιλεγμένου αρχείου(ων) χωρίς τελικό διαχωριστικό καταλόγου"
|
||
|
||
#: tfrmmain.actcopypathoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s)"
|
||
msgstr "Αντιγραφή Πλήρους Διαδρομής του αρχείου(ων)"
|
||
|
||
#: tfrmmain.actcopysamepanel.caption
|
||
msgid "Copy to same panel"
|
||
msgstr "Αντιγραφή στο ίδιο πάνελ"
|
||
|
||
#: tfrmmain.actcopytoclipboard.caption
|
||
msgid "&Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmmain.actcountdircontent.caption
|
||
msgid "Sho&w Occupied Space"
|
||
msgstr "Εμφάνιση Κατειλημμένου Χώρου"
|
||
|
||
#: tfrmmain.actcuttoclipboard.caption
|
||
msgid "Cu&t"
|
||
msgstr "Αποκοπή"
|
||
|
||
#: tfrmmain.actdebugshowcommandparameters.caption
|
||
msgid "Show Command Parameters"
|
||
msgstr "Εμφάνιση Παραμέτρων Εντολών"
|
||
|
||
#: tfrmmain.actdelete.caption
|
||
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmmain.actdeletesearches.caption
|
||
msgid "For all searches, cancel, close and free memory"
|
||
msgstr "Για όλες τις αναζητήσεις, ακύρωση, κλείσιμο και απελευθέρωση μνήμης"
|
||
|
||
#: tfrmmain.actdirhistory.caption
|
||
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
|
||
msgid "Directory history"
|
||
msgstr "Κατάλογος Ιστορικού"
|
||
|
||
#: tfrmmain.actdirhotlist.caption
|
||
msgid "Directory &Hotlist"
|
||
msgstr "Καταλογος &Hotlist"
|
||
|
||
#: tfrmmain.actdoanycmcommand.caption
|
||
msgid "Select any command and execute it"
|
||
msgstr "Επιλογή κάποιας εντολής και εκτέλεσή της"
|
||
|
||
#: tfrmmain.actedit.caption
|
||
msgctxt "tfrmmain.actedit.caption"
|
||
msgid "Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmmain.acteditcomment.caption
|
||
msgid "Edit Co&mment..."
|
||
msgstr "Επεξεργασία Σχολίου..."
|
||
|
||
#: tfrmmain.acteditnew.caption
|
||
msgid "Edit new file"
|
||
msgstr "Επεξεργασία νέου αρχείου"
|
||
|
||
#: tfrmmain.acteditpath.caption
|
||
msgid "Edit path field above file list"
|
||
msgstr "Επεξεργασία πεδίου διαδρομής πάνω από τη λίστα αρχείων"
|
||
|
||
#: tfrmmain.actexchange.caption
|
||
msgid "Swap &Panels"
|
||
msgstr "Εναλλαγή Πάνελ"
|
||
|
||
#: tfrmmain.actexecutescript.caption
|
||
msgid "Execute Script"
|
||
msgstr "Εκτέλεση Σεναρίου εντολών"
|
||
|
||
#: tfrmmain.actexit.caption
|
||
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Έξοδος"
|
||
|
||
#: tfrmmain.actextractfiles.caption
|
||
msgid "&Extract Files..."
|
||
msgstr "Εξαγωγή Αρχείων..."
|
||
|
||
#: tfrmmain.actfileassoc.caption
|
||
msgid "Configuration of File &Associations"
|
||
msgstr "Διαμόρφωση Συσχετισμών Αρχείων..."
|
||
|
||
#: tfrmmain.actfilelinker.caption
|
||
msgid "Com&bine Files..."
|
||
msgstr "Συνδιασμός Αρχείων..."
|
||
|
||
#: tfrmmain.actfileproperties.caption
|
||
msgid "Show &File Properties"
|
||
msgstr "Εμφάνιση Ιδιοτήτων Αρχείων"
|
||
|
||
#: tfrmmain.actfilespliter.caption
|
||
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
|
||
msgid "Spl&it File..."
|
||
msgstr "Διαμερισμός Αρχείου..."
|
||
|
||
#: tfrmmain.actflatview.caption
|
||
msgid "&Flat view"
|
||
msgstr "Επίπεδη Προβολή"
|
||
|
||
#: tfrmmain.actfocuscmdline.caption
|
||
msgid "Focus command line"
|
||
msgstr "Συγκέντρωση της γραμμής εντολών"
|
||
|
||
#: tfrmmain.actfocusswap.caption
|
||
msgid "Swap focus"
|
||
msgstr "Εναλλαγή σημείου εστίασης"
|
||
|
||
#: tfrmmain.actfocusswap.hint
|
||
msgid "Switch between left and right file list"
|
||
msgstr "Αλλαγή μεταξύ αριστερής και δεξιάς λίστας αρχείων"
|
||
|
||
#: tfrmmain.actgotofirstfile.caption
|
||
msgid "Place cursor on first file in list"
|
||
msgstr "Τοποθέτηση του κέρσορα στο πρώτο αρχείο της λίστας"
|
||
|
||
#: tfrmmain.actgotolastfile.caption
|
||
msgid "Place cursor on last file in list"
|
||
msgstr "Τοποθέτηση του κέρσορα στο τελευταίο αρχείο της λίστας"
|
||
|
||
#: tfrmmain.acthardlink.caption
|
||
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
|
||
msgid "Create &Hard Link..."
|
||
msgstr "Δημιουργία δεσμού τύπου Hard Link..."
|
||
|
||
#: tfrmmain.acthelpindex.caption
|
||
msgid "&Contents"
|
||
msgstr "Περιεχόμενα"
|
||
|
||
#: tfrmmain.acthorizontalfilepanels.caption
|
||
msgid "&Horizontal Panels Mode"
|
||
msgstr "Λειτουργία οριζοντίων πάνελ"
|
||
|
||
#: tfrmmain.actkeyboard.caption
|
||
msgid "&Keyboard"
|
||
msgstr "Πληκτρολόγιο"
|
||
|
||
#: tfrmmain.actleftbriefview.caption
|
||
msgid "Brief view on left panel"
|
||
msgstr "Σύντομη προβολή στο αριστερό πάνελ"
|
||
|
||
#: tfrmmain.actleftcolumnsview.caption
|
||
msgid "Columns view on left panel"
|
||
msgstr "Προβολή στηλών στο αριστερό πάνελ"
|
||
|
||
#: tfrmmain.actleftequalright.caption
|
||
msgid "Left &= Right"
|
||
msgstr "Αριστερά = Δεξιά"
|
||
|
||
#: tfrmmain.actleftflatview.caption
|
||
msgid "&Flat view on left panel"
|
||
msgstr "Επίπεδη Προβολή στο Αριστερό Πάνελ"
|
||
|
||
#: tfrmmain.actleftopendrives.caption
|
||
msgid "Open left drive list"
|
||
msgstr "Άνοιγμα τη λίστα οδηγών στα αριστερά"
|
||
|
||
#: tfrmmain.actleftreverseorder.caption
|
||
msgid "Re&verse order on left panel"
|
||
msgstr "Ανάποδη σειρά στο αριστερό πάνελ"
|
||
|
||
#: tfrmmain.actleftsortbyattr.caption
|
||
msgid "Sort left panel by &Attributes"
|
||
msgstr "Ταξινόμηση αριστερού πάνελ κατά Ιδιότητες"
|
||
|
||
#: tfrmmain.actleftsortbydate.caption
|
||
msgid "Sort left panel by &Date"
|
||
msgstr "Ταξινόμηση αριστερού πάνελ κατά Ημερομηνία"
|
||
|
||
#: tfrmmain.actleftsortbyext.caption
|
||
msgid "Sort left panel by &Extension"
|
||
msgstr "Ταξινόμηση αριστερού πάνελ κατά Επέκταση"
|
||
|
||
#: tfrmmain.actleftsortbyname.caption
|
||
msgid "Sort left panel by &Name"
|
||
msgstr "Ταξινόμηση αριστερού πάνελ κατά Όνομα"
|
||
|
||
#: tfrmmain.actleftsortbysize.caption
|
||
msgid "Sort left panel by &Size"
|
||
msgstr "Ταξινόμηση αριστερού πάνελ κατά Μέγεθος"
|
||
|
||
#: tfrmmain.actleftthumbview.caption
|
||
msgid "Thumbnails view on left panel"
|
||
msgstr "Προβολή μικρογραφιών στο αριστερό πάνελ"
|
||
|
||
#: tfrmmain.actloadfavoritetabs.caption
|
||
msgid "Load tabs from Favorite Tabs"
|
||
msgstr "Φόρτωση καρτελών από Αγαπημένες Καρτέλες"
|
||
|
||
#: tfrmmain.actloadselectionfromclip.caption
|
||
msgid "Load Selection from Clip&board"
|
||
msgstr "Φόρτωση Επιλογής από το Πρόχειρο"
|
||
|
||
#: tfrmmain.actloadselectionfromfile.caption
|
||
msgid "&Load Selection from File..."
|
||
msgstr "Φόρτωση Επιλογής από το Αρχείο..."
|
||
|
||
#: tfrmmain.actloadtabs.caption
|
||
msgid "&Load Tabs from File"
|
||
msgstr "Φόρτωση Καρτελών από το Αρχείο"
|
||
|
||
#: tfrmmain.actmakedir.caption
|
||
msgid "Create &Directory"
|
||
msgstr "Δημιουργία Καταλόγου"
|
||
|
||
#: tfrmmain.actmarkcurrentextension.caption
|
||
msgid "Select All with the Same E&xtension"
|
||
msgstr "Επιλογή όλων με την Ίδια Επέκταση"
|
||
|
||
#: tfrmmain.actmarkcurrentname.caption
|
||
msgid "Select all files with same name"
|
||
msgstr "Επιλογή όλων των αρχείων με την ίδια ονομασία"
|
||
|
||
#: tfrmmain.actmarkcurrentnameext.caption
|
||
msgid "Select all files with same name and extension"
|
||
msgstr "Επιλογή όλων των αρχείων με την ίδια ονομασία και επέκταση"
|
||
|
||
#: tfrmmain.actmarkcurrentpath.caption
|
||
msgid "Select all in same path"
|
||
msgstr "Επιλογή όλων με την ίδια διαδρομή"
|
||
|
||
#: tfrmmain.actmarkinvert.caption
|
||
msgid "&Invert Selection"
|
||
msgstr "Αντιστροφή Επιλογής"
|
||
|
||
#: tfrmmain.actmarkmarkall.caption
|
||
msgid "&Select All"
|
||
msgstr "Επιλογή Όλων"
|
||
|
||
#: tfrmmain.actmarkminus.caption
|
||
msgid "Unselect a Gro&up..."
|
||
msgstr "Αποεπιλογή ενός Γκρουπ..."
|
||
|
||
#: tfrmmain.actmarkplus.caption
|
||
msgid "Select a &Group..."
|
||
msgstr "Επιλογή Γκρουπ..."
|
||
|
||
#: tfrmmain.actmarkunmarkall.caption
|
||
msgid "&Unselect All"
|
||
msgstr "Αποεπιλογή Όλων"
|
||
|
||
#: tfrmmain.actminimize.caption
|
||
msgid "Minimize window"
|
||
msgstr "Ελαχιστοποίηση παραθύρου"
|
||
|
||
#: tfrmmain.actmultirename.caption
|
||
msgid "Multi &Rename Tool"
|
||
msgstr "Εργαλείο Μετονομασίας Πολλών"
|
||
|
||
#: tfrmmain.actnetworkconnect.caption
|
||
msgid "Network &Connect..."
|
||
msgstr "Σύνδεση στο Δίκτυο..."
|
||
|
||
#: tfrmmain.actnetworkdisconnect.caption
|
||
msgid "Network &Disconnect"
|
||
msgstr "Αποσύνδεση από το Δίκτυο"
|
||
|
||
#: tfrmmain.actnetworkquickconnect.caption
|
||
msgid "Network &Quick Connect..."
|
||
msgstr "Δίκτυο Ταχεία Σύνδεση..."
|
||
|
||
#: tfrmmain.actnewtab.caption
|
||
msgid "&New Tab"
|
||
msgstr "Νέα Καρτέλα"
|
||
|
||
#: tfrmmain.actnextfavoritetabs.caption
|
||
msgid "Load the Next Favorite Tabs in the list"
|
||
msgstr "Φόρτωση της Επόμενης Αγαπημένης Καρτέλας στη λίστα"
|
||
|
||
#: tfrmmain.actnexttab.caption
|
||
msgid "Switch to Nex&t Tab"
|
||
msgstr "Μετάβαση στην Επόμενη Καρτέλα"
|
||
|
||
#: tfrmmain.actopen.caption
|
||
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Άνοιγμα"
|
||
|
||
#: tfrmmain.actopenarchive.caption
|
||
msgid "Try open archive"
|
||
msgstr "Δοκιμή ανοίγματος αρχειοθήκης"
|
||
|
||
#: tfrmmain.actopenbar.caption
|
||
msgid "Open bar file"
|
||
msgstr "Άνοιγμα του αρχείου της γραμμής εργαλείων"
|
||
|
||
#: tfrmmain.actopendirinnewtab.caption
|
||
msgid "Open &Folder in a New Tab"
|
||
msgstr "Άνοιγμα Φακέλου σε Νέα Καρτέλα"
|
||
|
||
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
||
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
|
||
msgid "Open &VFS List"
|
||
msgstr "Άνοιγμα Λίστας VFS"
|
||
|
||
#: tfrmmain.actoperationsviewer.caption
|
||
msgid "Operations &Viewer"
|
||
msgstr "Προβολέας Λειτουργιών"
|
||
|
||
#: tfrmmain.actoptions.caption
|
||
msgid "&Options..."
|
||
msgstr "Επιλογές..."
|
||
|
||
#: tfrmmain.actpackfiles.caption
|
||
msgid "&Pack Files..."
|
||
msgstr "Πακετάρισμα Αρχείων..."
|
||
|
||
#: tfrmmain.actpanelssplitterperpos.caption
|
||
msgid "Set splitter position"
|
||
msgstr "Καθορισμός θέσης Διαμεριστή"
|
||
|
||
#: tfrmmain.actpastefromclipboard.caption
|
||
msgid "&Paste"
|
||
msgstr "Επικόλληση"
|
||
|
||
#: tfrmmain.actpreviousfavoritetabs.caption
|
||
msgid "Load the Previous Favorite Tabs in the list"
|
||
msgstr "Φόρτωση της Προηγούμενης Αγαπημένης Καρτέλας στη λίστα"
|
||
|
||
#: tfrmmain.actprevtab.caption
|
||
msgid "Switch to &Previous Tab"
|
||
msgstr "Αλλαγή στην προηγούμενη Καρτέλα"
|
||
|
||
#: tfrmmain.actquickfilter.caption
|
||
msgid "Quick filter"
|
||
msgstr "Γρήγορο Φίλτρο"
|
||
|
||
#: tfrmmain.actquicksearch.caption
|
||
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
|
||
msgid "Quick search"
|
||
msgstr "Ταχεία Αναζήτηση"
|
||
|
||
#: tfrmmain.actquickview.caption
|
||
msgid "&Quick View Panel"
|
||
msgstr "Πάνελ Ταχείας Προβολής"
|
||
|
||
#: tfrmmain.actrefresh.caption
|
||
msgid "&Refresh"
|
||
msgstr "Ανανέωση"
|
||
|
||
#: tfrmmain.actreloadfavoritetabs.caption
|
||
msgid "Reload the last Favorite Tabs loaded"
|
||
msgstr "Επαναφόρτωση της τελευταίας φορτωμένης Αγαπημένης Καρτέλας "
|
||
|
||
#: tfrmmain.actrename.caption
|
||
msgctxt "tfrmmain.actrename.caption"
|
||
msgid "Move"
|
||
msgstr "Μετακίνηση"
|
||
|
||
#: tfrmmain.actrenamenoask.caption
|
||
msgid "Move/Rename files without asking for confirmation"
|
||
msgstr "Μετακίνηση/μετονομασία αρχείων χωρίς ερώτηση επιβεβαίωσης"
|
||
|
||
#: tfrmmain.actrenameonly.caption
|
||
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: tfrmmain.actrenametab.caption
|
||
msgid "&Rename Tab"
|
||
msgstr "Μετονομασία Καρτέλας"
|
||
|
||
#: tfrmmain.actresavefavoritetabs.caption
|
||
msgid "Resave on the last Favorite Tabs loaded"
|
||
msgstr "Επαναποθήκευση στη τελευταία φορτωμένη Αγαπημένη Καρτέλα"
|
||
|
||
#: tfrmmain.actrestoreselection.caption
|
||
msgid "&Restore Selection"
|
||
msgstr "Επαναφορά Επιλογής"
|
||
|
||
#: tfrmmain.actreverseorder.caption
|
||
msgid "Re&verse Order"
|
||
msgstr "Ανάποδη Σειρά"
|
||
|
||
#: tfrmmain.actrightbriefview.caption
|
||
msgid "Brief view on right panel"
|
||
msgstr "Σύντομη προβολή στο δεξιό πάνελ"
|
||
|
||
#: tfrmmain.actrightcolumnsview.caption
|
||
msgid "Columns view on right panel"
|
||
msgstr "Προβολή στηλών στο δεξιό πάνελ"
|
||
|
||
#: tfrmmain.actrightequalleft.caption
|
||
msgid "Right &= Left"
|
||
msgstr "Αριστερά = Δεξιά"
|
||
|
||
#: tfrmmain.actrightflatview.caption
|
||
msgid "&Flat view on right panel"
|
||
msgstr "Επίπεδη Προβολή στο Δεξιό Πάνελ"
|
||
|
||
#: tfrmmain.actrightopendrives.caption
|
||
msgid "Open right drive list"
|
||
msgstr "Άνοιγμα της Λίστας Οδηγών στα δεξιά"
|
||
|
||
#: tfrmmain.actrightreverseorder.caption
|
||
msgid "Re&verse order on right panel"
|
||
msgstr "Επαναφορά σειράς στο δεξιό πάνελ"
|
||
|
||
#: tfrmmain.actrightsortbyattr.caption
|
||
msgid "Sort right panel by &Attributes"
|
||
msgstr "Ταξινόμηση δεξιού πάνελ κατά Ιδιότητες"
|
||
|
||
#: tfrmmain.actrightsortbydate.caption
|
||
msgid "Sort right panel by &Date"
|
||
msgstr "Ταξινόμηση δεξιού πάνελ κατά Ημερομηνία"
|
||
|
||
#: tfrmmain.actrightsortbyext.caption
|
||
msgid "Sort right panel by &Extension"
|
||
msgstr "Ταξινόμηση δεξιού πάνελ κατά Επέκταση"
|
||
|
||
#: tfrmmain.actrightsortbyname.caption
|
||
msgid "Sort right panel by &Name"
|
||
msgstr "Ταξινόμηση δεξιού πάνελ κατά Όνομα"
|
||
|
||
#: tfrmmain.actrightsortbysize.caption
|
||
msgid "Sort right panel by &Size"
|
||
msgstr "Ταξινόμηση δεξιού πάνελ κατά Μέγεθος"
|
||
|
||
#: tfrmmain.actrightthumbview.caption
|
||
msgid "Thumbnails view on right panel"
|
||
msgstr "Προβολή μικρογραφιών στο δεξιό πάνελ"
|
||
|
||
#: tfrmmain.actrunterm.caption
|
||
msgid "Run &Terminal"
|
||
msgstr "Εκτέλεση Τερματικού"
|
||
|
||
#: tfrmmain.actsavefavoritetabs.caption
|
||
msgid "Save current tabs to a New Favorite Tabs"
|
||
msgstr "Αποθήκευση τρέχουσας καρτέλας σε μία Νέα Αγαπημένη Καρτέλα"
|
||
|
||
#: tfrmmain.actsaveselection.caption
|
||
msgid "Sa&ve Selection"
|
||
msgstr "Αποθήκευση Επιλογής"
|
||
|
||
#: tfrmmain.actsaveselectiontofile.caption
|
||
msgid "Save S&election to File..."
|
||
msgstr "Αποθήκευση επιλογής στο αρχείο..."
|
||
|
||
#: tfrmmain.actsavetabs.caption
|
||
msgid "&Save Tabs to File"
|
||
msgstr "Αποθήκευση Καρτελών στο Αρχείο"
|
||
|
||
#: tfrmmain.actsearch.caption
|
||
msgid "&Search..."
|
||
msgstr "Αναζήτηση..."
|
||
|
||
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
||
msgid "All tabs Locked with Dir Opened in New Tabs"
|
||
msgstr "Όλες οι καρτέλες κλειδωμένες με Κατάλογο ανοικτό σε Νέες Καρτέλες"
|
||
|
||
#: tfrmmain.actsetalltabsoptionnormal.caption
|
||
msgid "Set all tabs to Normal"
|
||
msgstr "Ορισμός όλων των καρτελών σε Κανονικές"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
||
msgid "Set all tabs to Locked"
|
||
msgstr "Ορισμός όλων των καρτελών σε Κλειδωμένες"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
||
msgid "All tabs Locked with Dir Changes Allowed"
|
||
msgstr "Όλες οι καρτέλες Κλειδωμένες με ελέυθερες τις Αλλαγές Καταλόγου"
|
||
|
||
#: tfrmmain.actsetfileproperties.caption
|
||
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change &Attributes..."
|
||
msgstr "Αλλαγή Ιδιοτήτων..."
|
||
|
||
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
||
msgid "Locked with Directories Opened in New &Tabs"
|
||
msgstr "Κλειδωμένο με Καταλόγους Ανοικτούς σε νέες Καρτέλες"
|
||
|
||
#: tfrmmain.actsettaboptionnormal.caption
|
||
msgid "&Normal"
|
||
msgstr "Normal"
|
||
|
||
#: tfrmmain.actsettaboptionpathlocked.caption
|
||
msgid "&Locked"
|
||
msgstr "Κλειδωμένο"
|
||
|
||
#: tfrmmain.actsettaboptionpathresets.caption
|
||
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
|
||
msgid "Locked with &Directory Changes Allowed"
|
||
msgstr "Κλειδωμένο με Επιτρεπόμενες Αλλαγές Καταλόγων "
|
||
|
||
#: tfrmmain.actshellexecute.caption
|
||
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Άνοιγμα"
|
||
|
||
#: tfrmmain.actshellexecute.hint
|
||
msgid "Open using system associations"
|
||
msgstr "Άνοιγμα με χρήση των συσχετισμών του συστήματος"
|
||
|
||
#: tfrmmain.actshowbuttonmenu.caption
|
||
msgid "Show button menu"
|
||
msgstr "Εμφάνιση μενού κουμπιών"
|
||
|
||
#: tfrmmain.actshowcmdlinehistory.caption
|
||
msgid "Show command line history"
|
||
msgstr "Εμφάνιση ιστορικού γραμμής εντολών"
|
||
|
||
#: tfrmmain.actshowmainmenu.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
|
||
msgid "Menu"
|
||
msgstr "Μενού"
|
||
|
||
#: tfrmmain.actshowsysfiles.caption
|
||
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
|
||
msgid "Show &Hidden/System Files"
|
||
msgstr "Εμφάνιση Κρυφών Αρχείων/Αρχείων Συστήματος "
|
||
|
||
#: tfrmmain.actsortbyattr.caption
|
||
msgid "Sort by &Attributes"
|
||
msgstr "Κατάταξη κατά Ιδιότητες"
|
||
|
||
#: tfrmmain.actsortbydate.caption
|
||
msgid "Sort by &Date"
|
||
msgstr "Ταξινόμηση κατά Ημερομηνία"
|
||
|
||
#: tfrmmain.actsortbyext.caption
|
||
msgid "Sort by &Extension"
|
||
msgstr "Ταξινόμηση κατά Επέκταση"
|
||
|
||
#: tfrmmain.actsortbyname.caption
|
||
msgid "Sort by &Name"
|
||
msgstr "Ταξινόμηση κατά Όνομα"
|
||
|
||
#: tfrmmain.actsortbysize.caption
|
||
msgid "Sort by &Size"
|
||
msgstr "Ταξινόμηση κατά Μέγεθος"
|
||
|
||
#: tfrmmain.actsrcopendrives.caption
|
||
msgid "Open drive list"
|
||
msgstr "Άνοιγμα της Λίστας Οδηγών"
|
||
|
||
#: tfrmmain.actswitchignorelist.caption
|
||
msgid "Enable/disable ignore list file to not show file names"
|
||
msgstr "Ενεργοποίηση/Απενεργοποίηση αρχείου λίστας αγνόησης για να μην φαίνονται ονόματα αρχείου"
|
||
|
||
#: tfrmmain.actsymlink.caption
|
||
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
|
||
msgid "Create Symbolic &Link..."
|
||
msgstr "Δημιουργία Συμβολοδεσμού..."
|
||
|
||
#: tfrmmain.actsyncdirs.caption
|
||
msgid "Synchronize dirs..."
|
||
msgstr "Συγχρονισμός καταλόγων..."
|
||
|
||
#: tfrmmain.acttargetequalsource.caption
|
||
msgid "Target &= Source"
|
||
msgstr "Στόχος = Πηγή"
|
||
|
||
#: tfrmmain.acttestarchive.caption
|
||
msgid "&Test Archive(s)"
|
||
msgstr "Δοκιμή Αρχείου(ων)"
|
||
|
||
#: tfrmmain.actthumbnailsview.caption
|
||
msgctxt "tfrmmain.actthumbnailsview.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Μικρογραφίες"
|
||
|
||
#: tfrmmain.actthumbnailsview.hint
|
||
msgid "Thumbnails View"
|
||
msgstr "Προβολή Μικρογραφιών"
|
||
|
||
#: tfrmmain.acttogglefullscreenconsole.caption
|
||
msgid "Toggle fullscreen mode console"
|
||
msgstr "εναλλαγή σε τερματικό πλήρους οθόνης"
|
||
|
||
#: tfrmmain.acttransferleft.caption
|
||
msgid "Transfer dir under cursor to left window"
|
||
msgstr "Μεταφορά του καταλόγου κάτω από τον κέρσορα στο αριστερό παράθυρο"
|
||
|
||
#: tfrmmain.acttransferright.caption
|
||
msgid "Transfer dir under cursor to right window"
|
||
msgstr "Μεταφορά του καταλόγου κάτω από τον κέρσορα στο δεξιό παράθυρο"
|
||
|
||
#: tfrmmain.acttreeview.caption
|
||
msgid "&Tree View Panel"
|
||
msgstr "Πάνελ Προβολής Δέντρου"
|
||
|
||
#: tfrmmain.actuniversalsingledirectsort.caption
|
||
msgid "Sort according to parameters"
|
||
msgstr "Ταξινόμηση βάσει παραμέτρων"
|
||
|
||
#: tfrmmain.actunmarkcurrentextension.caption
|
||
msgid "Unselect All with the Same Ex&tension"
|
||
msgstr "Αποεπιλογή Όλων με τη ίδια Επέκταση"
|
||
|
||
#: tfrmmain.actunmarkcurrentname.caption
|
||
msgid "Unselect all files with same name"
|
||
msgstr "Αποεπιλογή όλων των αρχείων με την ίδια ονομασία"
|
||
|
||
#: tfrmmain.actunmarkcurrentnameext.caption
|
||
msgid "Unselect all files with same name and extension"
|
||
msgstr "Αποεπιλογή όλων των αρχείων με την ίδια ονομασία και επέκταση"
|
||
|
||
#: tfrmmain.actunmarkcurrentpath.caption
|
||
msgid "Unselect all in same path"
|
||
msgstr "Αποεπιλογή όλων με την ίδια διαδρομή"
|
||
|
||
#: tfrmmain.actview.caption
|
||
msgctxt "tfrmmain.actview.caption"
|
||
msgid "View"
|
||
msgstr "Προβολή"
|
||
|
||
#: tfrmmain.actviewhistory.caption
|
||
msgid "Show history of visited paths for active view"
|
||
msgstr "Εμφάνιση ιστορικού εμφανισμένων διαδρομών για ενεργή προβολή"
|
||
|
||
#: tfrmmain.actviewhistorynext.caption
|
||
msgid "Go to next entry in history"
|
||
msgstr "Μετάβαση στην επόμενη καταχώρηση στο ιστορικό"
|
||
|
||
#: tfrmmain.actviewhistoryprev.caption
|
||
msgid "Go to previous entry in history"
|
||
msgstr "Μετάβαση στην προηγούμενη καταχώρηση στο ιστορικό"
|
||
|
||
#: tfrmmain.actviewlogfile.caption
|
||
msgid "View log file"
|
||
msgstr "Προβολή αρχείου καταγραφών"
|
||
|
||
#: tfrmmain.actviewsearches.caption
|
||
msgid "View current search instances"
|
||
msgstr "Προβολή τρεχόντων περιστατικών αναζήτησης"
|
||
|
||
#: tfrmmain.actvisithomepage.caption
|
||
msgid "&Visit Double Commander Website"
|
||
msgstr "Επισκεφθείτε την Ιστοσελίδα του Double Commander"
|
||
|
||
#: tfrmmain.actwipe.caption
|
||
msgid "Wipe"
|
||
msgstr "Ασφαλής Διαγραφή"
|
||
|
||
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
||
msgid "Work with Directory Hotlist and parameters"
|
||
msgstr "Εργασία με Κατάλογο Hotlist και παραμέτρους"
|
||
|
||
#: tfrmmain.btnf10.caption
|
||
msgctxt "tfrmmain.btnf10.caption"
|
||
msgid "Exit"
|
||
msgstr "Έξοδος"
|
||
|
||
#: tfrmmain.btnf7.caption
|
||
msgctxt "TFRMMAIN.BTNF7.CAPTION"
|
||
msgid "Directory"
|
||
msgstr "Κατάλογος"
|
||
|
||
#: tfrmmain.btnf8.caption
|
||
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmmain.btnf9.caption
|
||
msgctxt "tfrmmain.btnf9.caption"
|
||
msgid "Terminal"
|
||
msgstr "Τερματικό"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Κατάλογος Hotlist"
|
||
|
||
#: tfrmmain.btnleftequalright.caption
|
||
msgctxt "tfrmmain.btnleftequalright.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmmain.btnleftequalright.hint
|
||
msgid "Show current directory of the right panel in the left panel"
|
||
msgstr "Εμφάνιση τρέχοντος καταλόγου του δεξιού πάνελ στο αριστερό πάνελ"
|
||
|
||
#: tfrmmain.btnlefthome.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnlefthome.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
|
||
msgid "Go to home directory"
|
||
msgstr "Μετάβαση στον αρχικό κατάλογο"
|
||
|
||
#: tfrmmain.btnleftroot.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnleftroot.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
|
||
msgid "Go to root directory"
|
||
msgstr "Μετάβαση στον κατάλογο root"
|
||
|
||
#: tfrmmain.btnleftup.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.btnleftup.hint
|
||
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
|
||
msgid "Go to parent directory"
|
||
msgstr "Μετάβαση στον γονικό κατάλογο"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.hint
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Κατάλογος Hotlist"
|
||
|
||
#: tfrmmain.btnrightequalleft.caption
|
||
msgctxt "tfrmmain.btnrightequalleft.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmmain.btnrightequalleft.hint
|
||
msgid "Show current directory of the left panel in the right panel"
|
||
msgstr "Εμφάνιση τρέχοντος καταλόγου του αριστερού πάνελ στο δεξιό πάνελ"
|
||
|
||
#: tfrmmain.btnrighthome.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnrightroot.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnrightup.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.caption
|
||
msgctxt "TFRMMAIN.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmain.lblcommandpath.caption
|
||
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
|
||
msgid "Path"
|
||
msgstr "Διαδρομή"
|
||
|
||
#: tfrmmain.menuitem2.caption
|
||
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mi2080.caption
|
||
msgid "&20/80"
|
||
msgstr "&20/80"
|
||
|
||
#: tfrmmain.mi3070.caption
|
||
msgid "&30/70"
|
||
msgstr "&30/70"
|
||
|
||
#: tfrmmain.mi4060.caption
|
||
msgid "&40/60"
|
||
msgstr "&40/60"
|
||
|
||
#: tfrmmain.mi5050.caption
|
||
msgid "&50/50"
|
||
msgstr "&50/50"
|
||
|
||
#: tfrmmain.mi6040.caption
|
||
msgid "&60/40"
|
||
msgstr "&60/40"
|
||
|
||
#: tfrmmain.mi7030.caption
|
||
msgid "&70/30"
|
||
msgstr "&70/30"
|
||
|
||
#: tfrmmain.mi8020.caption
|
||
msgid "&80/20"
|
||
msgstr "&80/20"
|
||
|
||
#: tfrmmain.micancel.caption
|
||
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmmain.micopy.caption
|
||
msgid "Copy..."
|
||
msgstr "Αντιγραφή..."
|
||
|
||
#: tfrmmain.mihardlink.caption
|
||
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
|
||
msgid "Create link..."
|
||
msgstr "Δημιουργία δεσμού..."
|
||
|
||
#: tfrmmain.miline1.caption
|
||
msgctxt "TFRMMAIN.MILINE1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline10.caption
|
||
msgctxt "tfrmmain.miline10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline11.caption
|
||
msgctxt "tfrmmain.miline11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline12.caption
|
||
msgctxt "TFRMMAIN.MILINE12.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline13.caption
|
||
msgctxt "TFRMMAIN.MILINE13.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline14.caption
|
||
msgctxt "TFRMMAIN.MILINE14.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline15.caption
|
||
msgctxt "TFRMMAIN.MILINE15.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline16.caption
|
||
msgctxt "TFRMMAIN.MILINE16.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline17.caption
|
||
msgctxt "TFRMMAIN.MILINE17.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline18.caption
|
||
msgctxt "TFRMMAIN.MILINE18.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline19.caption
|
||
msgctxt "TFRMMAIN.MILINE19.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline2.caption
|
||
msgctxt "TFRMMAIN.MILINE2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline20.caption
|
||
msgctxt "TFRMMAIN.MILINE20.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline21.caption
|
||
msgctxt "tfrmmain.miline21.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline22.caption
|
||
msgctxt "TFRMMAIN.MILINE22.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline23.caption
|
||
msgctxt "tfrmmain.miline23.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline24.caption
|
||
msgctxt "TFRMMAIN.MILINE24.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline25.caption
|
||
msgctxt "TFRMMAIN.MILINE25.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline26.caption
|
||
msgctxt "tfrmmain.miline26.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline3.caption
|
||
msgctxt "TFRMMAIN.MILINE3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline32.caption
|
||
msgctxt "TFRMMAIN.MILINE32.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline33.caption
|
||
msgctxt "TFRMMAIN.MILINE33.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline37.caption
|
||
msgctxt "TFRMMAIN.MILINE37.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline38.caption
|
||
msgctxt "TFRMMAIN.MILINE38.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline39.caption
|
||
msgctxt "tfrmmain.miline39.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline4.caption
|
||
msgctxt "TFRMMAIN.MILINE4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline40.caption
|
||
msgctxt "tfrmmain.miline40.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline47.caption
|
||
msgctxt "TFRMMAIN.MILINE47.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline5.caption
|
||
msgctxt "TFRMMAIN.MILINE5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline50.caption
|
||
msgctxt "TFRMMAIN.MILINE50.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline55.caption
|
||
msgctxt "tfrmmain.miline55.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline6.caption
|
||
msgctxt "TFRMMAIN.MILINE6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline7.caption
|
||
msgctxt "TFRMMAIN.MILINE7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline8.caption
|
||
msgctxt "TFRMMAIN.MILINE8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline9.caption
|
||
msgctxt "TFRMMAIN.MILINE9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.milogclear.caption
|
||
msgid "Clear"
|
||
msgstr "Καθαρισμός"
|
||
|
||
#: tfrmmain.milogcopy.caption
|
||
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmmain.miloghide.caption
|
||
msgid "Hide"
|
||
msgstr "Κρύψιμο"
|
||
|
||
#: tfrmmain.milogselectall.caption
|
||
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Επιλογή όλων"
|
||
|
||
#: tfrmmain.mimove.caption
|
||
msgid "Move..."
|
||
msgstr "Μετακίνηση..."
|
||
|
||
#: tfrmmain.misymlink.caption
|
||
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
|
||
msgid "Create symlink..."
|
||
msgstr "Δημιουργία Συμβολοδεσμού..."
|
||
|
||
#: tfrmmain.mitaboptions.caption
|
||
msgid "Tab options"
|
||
msgstr "Επιλογές Καρτελών"
|
||
|
||
#: tfrmmain.mitrayiconexit.caption
|
||
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "Έξοδος"
|
||
|
||
#: tfrmmain.mitrayiconrestore.caption
|
||
msgid "Restore"
|
||
msgstr "Επαναφορά"
|
||
|
||
#: tfrmmain.mnualloperpause.caption
|
||
msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmmain.mnualloperstart.caption
|
||
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
|
||
msgid "Start"
|
||
msgstr "Εκκίνηση"
|
||
|
||
#: tfrmmain.mnualloperstop.caption
|
||
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmmain.mnucmd.caption
|
||
msgid "&Commands"
|
||
msgstr "Εντολές"
|
||
|
||
#: tfrmmain.mnuconfig.caption
|
||
msgid "C&onfiguration"
|
||
msgstr "Διαμόρφωση"
|
||
|
||
#: tfrmmain.mnucontextline1.caption
|
||
msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnucontextline2.caption
|
||
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnufavoritetabs.caption
|
||
msgid "Favorites"
|
||
msgstr "Αγαπημένα"
|
||
|
||
#: tfrmmain.mnufiles.caption
|
||
msgid "&Files"
|
||
msgstr "Αρχεία"
|
||
|
||
#: tfrmmain.mnuhelp.caption
|
||
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "&Βοήθεια"
|
||
|
||
#: tfrmmain.mnumark.caption
|
||
msgid "&Mark"
|
||
msgstr "Επιλογή"
|
||
|
||
#: tfrmmain.mnunetwork.caption
|
||
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
|
||
msgid "Network"
|
||
msgstr "Δίκτυο"
|
||
|
||
#: tfrmmain.mnushow.caption
|
||
msgid "&Show"
|
||
msgstr "Εμφάνιση "
|
||
|
||
#: tfrmmain.mnutaboptions.caption
|
||
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
|
||
msgid "Tab &Options"
|
||
msgstr "Επιλογές Καρτελών"
|
||
|
||
#: tfrmmain.mnutabs.caption
|
||
msgid "&Tabs"
|
||
msgstr "Καρτέλες"
|
||
|
||
#: tfrmmain.tbchangedir.caption
|
||
msgid "CD"
|
||
msgstr "CD"
|
||
|
||
#: tfrmmain.tbcopy.caption
|
||
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmmain.tbcut.caption
|
||
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Αποκοπή"
|
||
|
||
#: tfrmmain.tbdelete.caption
|
||
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmmain.tbedit.caption
|
||
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmmain.tbpaste.caption
|
||
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Επικόλληση"
|
||
|
||
#: tfrmmain.tbseparator.caption
|
||
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmaincommandsdlg.btncancel.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmmaincommandsdlg.btnok.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmmaincommandsdlg.caption
|
||
msgid "Select your internal command"
|
||
msgstr "Επιλέξτε την εσωτερική σας εντολή"
|
||
|
||
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr "Legacy ταξινόμηση"
|
||
|
||
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
||
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
|
||
msgid "Legacy sorted"
|
||
msgstr "Legacy ταξινόμηση"
|
||
|
||
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
||
msgid "Select all categories by default"
|
||
msgstr "Επιλογή όλων των κατηγοριών εξ' ορισμού"
|
||
|
||
#: tfrmmaincommandsdlg.gbselection.caption
|
||
msgid "Selection:"
|
||
msgstr "Επιλογή:"
|
||
|
||
#: tfrmmaincommandsdlg.lblcategory.caption
|
||
msgid "&Categories:"
|
||
msgstr "Κατηγορίες:"
|
||
|
||
#: tfrmmaincommandsdlg.lblcommandname.caption
|
||
msgid "Command &name:"
|
||
msgstr "Όνομα εντολής:"
|
||
|
||
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
||
msgid "&Filter:"
|
||
msgstr "Φίλτρο:"
|
||
|
||
#: tfrmmaincommandsdlg.lblhint.caption
|
||
msgid "Hint:"
|
||
msgstr "Συμβουλή:"
|
||
|
||
#: tfrmmaincommandsdlg.lblhotkey.caption
|
||
msgid "Hotkey:"
|
||
msgstr "Ειδικό Πλήκτρο:"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
||
msgid "cm_name"
|
||
msgstr "cm_name"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDCATEGORY.CAPTION"
|
||
msgid "Category"
|
||
msgstr "Κατηγορία"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDHELP.CAPTION"
|
||
msgid "Help"
|
||
msgstr "Βοήθεια"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
||
msgid "Hint"
|
||
msgstr "Συμβουλή"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDHOTKEY.CAPTION"
|
||
msgid "Hotkey"
|
||
msgstr "Ειδικό Πλήκτρο"
|
||
|
||
#: tfrmmaskinputdlg.btnaddattribute.caption
|
||
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmmaskinputdlg.btnattrshelp.caption
|
||
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Βοήθεια"
|
||
|
||
#: tfrmmaskinputdlg.btncancel.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
||
msgid "&Define..."
|
||
msgstr "Προσδιορισμός..."
|
||
|
||
#: tfrmmaskinputdlg.btnok.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
||
msgid "Case sensitive"
|
||
msgstr "Με διάκριση πεζών -κεφαλαίων"
|
||
|
||
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
||
msgid "Ignore accents and ligatures"
|
||
msgstr "Αγνόηση χρήσης τονισμού και διφθόγγων"
|
||
|
||
#: tfrmmaskinputdlg.lblattributes.caption
|
||
msgid "Attri&butes:"
|
||
msgstr "Ιδιότητες:"
|
||
|
||
#: tfrmmaskinputdlg.lblprompt.caption
|
||
msgid "Input Mask:"
|
||
msgstr "Μάσκα Εισαγωγής:"
|
||
|
||
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
||
msgid "O&r select predefined selection type:"
|
||
msgstr "Ή επιλέξτε τον προκαθορισμένο τύπο επιλογής:"
|
||
|
||
#: tfrmmkdir.btncancel.caption
|
||
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmmkdir.btnok.caption
|
||
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmmkdir.caption
|
||
msgid "Create new directory"
|
||
msgstr "Δημιουργία νέου καταλόγου"
|
||
|
||
#: tfrmmkdir.lblmakedir.caption
|
||
msgid "&Input new directory name:"
|
||
msgstr "Εισάγετε νέο όνομα καταλόγου:"
|
||
|
||
#: tfrmmodview.btnpath1.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath2.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath3.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath4.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath5.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.caption
|
||
msgctxt "TFRMMODVIEW.CAPTION"
|
||
msgid "New Size"
|
||
msgstr "Νέο Μέγεθος"
|
||
|
||
#: tfrmmodview.lblheight.caption
|
||
msgid "Height :"
|
||
msgstr "Ύψος:"
|
||
|
||
#: tfrmmodview.lblpath1.caption
|
||
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmodview.lblpath2.caption
|
||
msgctxt "tfrmmodview.lblpath2.caption"
|
||
msgid "2"
|
||
msgstr "2"
|
||
|
||
#: tfrmmodview.lblpath3.caption
|
||
msgctxt "tfrmmodview.lblpath3.caption"
|
||
msgid "3"
|
||
msgstr "3"
|
||
|
||
#: tfrmmodview.lblpath4.caption
|
||
msgid "4"
|
||
msgstr "4"
|
||
|
||
#: tfrmmodview.lblpath5.caption
|
||
msgid "5"
|
||
msgstr "5"
|
||
|
||
#: tfrmmodview.lblquality.caption
|
||
msgid "Quality of compress to Jpg"
|
||
msgstr "Ποιότητα συμπίεσης του Jpg"
|
||
|
||
#: tfrmmodview.lblwidth.caption
|
||
msgid "Width :"
|
||
msgstr "Πλάτος :"
|
||
|
||
#: tfrmmodview.rbbmp.caption
|
||
msgid "BMP"
|
||
msgstr "BMP"
|
||
|
||
#: tfrmmodview.rbico.caption
|
||
msgid "ICO"
|
||
msgstr "ICO"
|
||
|
||
#: tfrmmodview.rbjpg.caption
|
||
msgid "JPG"
|
||
msgstr "JPG"
|
||
|
||
#: tfrmmodview.rbpng.caption
|
||
msgid "PNG"
|
||
msgstr "PNG"
|
||
|
||
#: tfrmmodview.rbpnm.caption
|
||
msgid "PNM"
|
||
msgstr "PNM"
|
||
|
||
#: tfrmmodview.teheight.text
|
||
msgctxt "tfrmmodview.teheight.text"
|
||
msgid "Height"
|
||
msgstr "Ύψος"
|
||
|
||
#: tfrmmodview.tequality.text
|
||
msgid "80"
|
||
msgstr "80"
|
||
|
||
#: tfrmmodview.tewidth.text
|
||
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
|
||
msgid "Width"
|
||
msgstr "Πλάτος"
|
||
|
||
#: tfrmmsg.lblmsg.caption
|
||
msgid "456456465465465"
|
||
msgstr "456456465465465"
|
||
|
||
#: tfrmmultirename.btnclose.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmmultirename.btndeletepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmmultirename.btnedit.caption
|
||
msgctxt "tfrmmultirename.btnedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmmultirename.btnextmenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnloadpreset.caption
|
||
msgid "&Load"
|
||
msgstr "Φόρτωση"
|
||
|
||
#: tfrmmultirename.btnnamemenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnrename.caption
|
||
msgctxt "tfrmmultirename.btnrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: tfrmmultirename.btnrestore.caption
|
||
msgid "Reset &all"
|
||
msgstr "Επαναφορά όλων"
|
||
|
||
#: tfrmmultirename.btnsavepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmmultirename.caption
|
||
msgctxt "TFRMMULTIRENAME.CAPTION"
|
||
msgid "MultiRename"
|
||
msgstr "Μετονομασία Πολλών"
|
||
|
||
#: tfrmmultirename.cblog.caption
|
||
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
|
||
msgid "Ena&ble"
|
||
msgstr "Ενεργοποίηση"
|
||
|
||
#: tfrmmultirename.cbregexp.caption
|
||
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
|
||
msgid "Regular e&xpressions"
|
||
msgstr "Συνήθεις φράσεις"
|
||
|
||
#: tfrmmultirename.cbusesubs.caption
|
||
msgid "&Use substitution"
|
||
msgstr "Χρήση αντικατάστασης"
|
||
|
||
#: tfrmmultirename.cmbxwidth.text
|
||
msgid "01"
|
||
msgstr "01"
|
||
|
||
#: tfrmmultirename.edinterval.text
|
||
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.edpoc.text
|
||
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.extension.caption
|
||
msgid "[E] Extension"
|
||
msgstr "[E] Επέκταση"
|
||
|
||
#: tfrmmultirename.gbcounter.caption
|
||
msgid "Counter"
|
||
msgstr "Μετρητής"
|
||
|
||
#: tfrmmultirename.gbfindreplace.caption
|
||
msgid "Find && Replace"
|
||
msgstr "Αναζήτηση && Αντικατάσταση"
|
||
|
||
#: tfrmmultirename.gblog.caption
|
||
msgid "Log Result"
|
||
msgstr "Αποτέλεσμα Καταγραφής"
|
||
|
||
#: tfrmmultirename.gbmaska.caption
|
||
msgid "Mask"
|
||
msgstr "Μάσκα"
|
||
|
||
#: tfrmmultirename.gbpresets.caption
|
||
msgid "Presets"
|
||
msgstr "Προρύθμιση"
|
||
|
||
#: tfrmmultirename.lbext.caption
|
||
msgid "&Extension"
|
||
msgstr "Επέκταση"
|
||
|
||
#: tfrmmultirename.lbfind.caption
|
||
msgid "&Find..."
|
||
msgstr "Έυρεση..."
|
||
|
||
#: tfrmmultirename.lbinterval.caption
|
||
msgid "&Interval"
|
||
msgstr "Διάστημα"
|
||
|
||
#: tfrmmultirename.lbname.caption
|
||
msgid "File &Name"
|
||
msgstr "Όνομα Αρχείου"
|
||
|
||
#: tfrmmultirename.lbreplace.caption
|
||
msgid "Re&place..."
|
||
msgstr "Αντικατάσταση..."
|
||
|
||
#: tfrmmultirename.lbstnb.caption
|
||
msgid "S&tart Number"
|
||
msgstr "Αριθμός Εκκίνησης"
|
||
|
||
#: tfrmmultirename.lbwidth.caption
|
||
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
|
||
msgid "&Width"
|
||
msgstr "Πλάτος"
|
||
|
||
#: tfrmmultirename.micounter.caption
|
||
msgid "[C] Counter"
|
||
msgstr "[C] Μετρητής"
|
||
|
||
#: tfrmmultirename.miday.caption
|
||
msgid "[D] Day"
|
||
msgstr "[D] Ημερομηνία"
|
||
|
||
#: tfrmmultirename.miday1.caption
|
||
msgid "[DD] Day (2 digits)"
|
||
msgstr "[ΗΗ] Ημέρα (2 ψηφία )"
|
||
|
||
#: tfrmmultirename.miday2.caption
|
||
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
||
msgstr "[ΗΗΗ] Ημέρα της εβδομάδας (σύντομο, π.χ., \"δευτ\")"
|
||
|
||
#: tfrmmultirename.miday3.caption
|
||
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
||
msgstr "[ΗΗΗΗ] Ημέρα της εβδομάδας (μακρύ, π.χ., \"δευτέρα\")"
|
||
|
||
#: tfrmmultirename.miextensionx.caption
|
||
msgid "[Ex] Character at position x"
|
||
msgstr "[Ex] Χαρακτήρας στη θέση x"
|
||
|
||
#: tfrmmultirename.miextensionxx.caption
|
||
msgid "[Ex:y] Characters from position x to y"
|
||
msgstr "[Ex:y] Χαρακτήρες από την θέση x στη y"
|
||
|
||
#: tfrmmultirename.mihour.caption
|
||
msgid "[h] Hour"
|
||
msgstr "[h] Ώρα"
|
||
|
||
#: tfrmmultirename.mihour1.caption
|
||
msgid "[hh] Hour (2 digits)"
|
||
msgstr "[hh] Ώρα (2 ψηφία)"
|
||
|
||
#: tfrmmultirename.miminute.caption
|
||
msgid "[n] Minute"
|
||
msgstr "[n] Λεπτό"
|
||
|
||
#: tfrmmultirename.miminute1.caption
|
||
msgid "[nn] Minute (2 digits)"
|
||
msgstr "[nn] Λεπτό (2 ψηφία)"
|
||
|
||
#: tfrmmultirename.mimonth.caption
|
||
msgid "[M] Month"
|
||
msgstr "[M] Μήνας"
|
||
|
||
#: tfrmmultirename.mimonth1.caption
|
||
msgid "[MM] Month (2 digits)"
|
||
msgstr "[MM] Μήνας (2 ψηφία)"
|
||
|
||
#: tfrmmultirename.mimonth2.caption
|
||
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
||
msgstr "[ΜΜΜΜ] Όνομα Μηνός (σύντομο, π.χ., \"ιαν\")"
|
||
|
||
#: tfrmmultirename.mimonth3.caption
|
||
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
||
msgstr "[ΜΜΜΜ] Όνομα Μηνός (μακρύ, π.χ., \"ιανουάριος\")"
|
||
|
||
#: tfrmmultirename.miname.caption
|
||
msgid "[N] Name"
|
||
msgstr "[N] Όνομα"
|
||
|
||
#: tfrmmultirename.minamex.caption
|
||
msgid "[Nx] Character at position x"
|
||
msgstr "[Nx] Χαρακτήρας στη θέση x"
|
||
|
||
#: tfrmmultirename.minamexx.caption
|
||
msgid "[Nx:y] Characters from position x to y"
|
||
msgstr "[Nx:y] Χαρακτήρες από τη θέση x στη y"
|
||
|
||
#: tfrmmultirename.minext.caption
|
||
msgid "Time..."
|
||
msgstr "Χρόνος..."
|
||
|
||
#: tfrmmultirename.minextextension.caption
|
||
msgid "Extension..."
|
||
msgstr "Επέκταση..."
|
||
|
||
#: tfrmmultirename.minextname.caption
|
||
msgid "Name..."
|
||
msgstr "Όνομα..."
|
||
|
||
#: tfrmmultirename.miplugin.caption
|
||
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "Πρόσθετο"
|
||
|
||
#: tfrmmultirename.misecond.caption
|
||
msgid "[s] Second"
|
||
msgstr "[s] Δευτερόλεπτο"
|
||
|
||
#: tfrmmultirename.misecond1.caption
|
||
msgid "[ss] Second (2 digits)"
|
||
msgstr "[ss] Δευτερόλεπτο (2 ψηφία)"
|
||
|
||
#: tfrmmultirename.miyear.caption
|
||
msgid "[Y] Year (2 digits)"
|
||
msgstr "[Y] Χρονιά (2 ψηφεία)"
|
||
|
||
#: tfrmmultirename.miyear1.caption
|
||
msgid "[YYYY] Year (4 digits)"
|
||
msgstr "[YYYY] Χρονιά (4 ψηφεία)"
|
||
|
||
#: tfrmmultirename.mnueditnames.caption
|
||
msgid "Edit names..."
|
||
msgstr "Επεξεργασία ονομάτων..."
|
||
|
||
#: tfrmmultirename.mnuloadfromfile.caption
|
||
msgid "Load names from file..."
|
||
msgstr "Φόρτωμα ονομάτων από το αρχείο..."
|
||
|
||
#: tfrmmultirename.n1.caption
|
||
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n2.caption
|
||
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n3.caption
|
||
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n4.caption
|
||
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n5.caption
|
||
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
||
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION"
|
||
msgid "Old File Name"
|
||
msgstr "Παλιό Όνομα Αρχείου"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
||
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION"
|
||
msgid "New File Name"
|
||
msgstr "Νέο Όνομα Αρχείου"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
||
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION"
|
||
msgid "File Path"
|
||
msgstr "Διαδρομή Αρχείου"
|
||
|
||
#: tfrmmultirenamewait.caption
|
||
msgctxt "tfrmmultirenamewait.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmultirenamewait.lblmessage.caption
|
||
msgid "Click OK when you have closed the editor to load the changed names!"
|
||
msgstr "Κάντε κλικ στο ΟΚ όταν έχετε κλείσει τον επεξεργαστή για να φορτώσετε τα αλλαγμένα ονόματα!"
|
||
|
||
#: tfrmopenwith.caption
|
||
msgid "Choose an application"
|
||
msgstr "Επιλέξτε μία εφαρμογή"
|
||
|
||
#: tfrmopenwith.chkcustomcommand.caption
|
||
msgid "Custom command"
|
||
msgstr "Προσαρμοσμένη εντολή"
|
||
|
||
#: tfrmopenwith.chksaveassociation.caption
|
||
msgid "Save association"
|
||
msgstr "Αποθήκευση συσχετισμού"
|
||
|
||
#: tfrmopenwith.chkuseasdefault.caption
|
||
msgid "Set selected application as default action"
|
||
msgstr "Αποθήκευση της επιλεγμένης εφαρμογής ως εξ' ορισμού ενέργια"
|
||
|
||
#: tfrmopenwith.lblmimetype.caption
|
||
msgid "File type to be opened: %s"
|
||
msgstr "Τύπος αρχείου προς άνοιγμα: %s"
|
||
|
||
#: tfrmopenwith.milistoffiles.caption
|
||
msgid "Multiple file names"
|
||
msgstr "Πολλαπλά ονόματα αρχείων"
|
||
|
||
#: tfrmopenwith.milistoffiles.hint
|
||
msgid "%F"
|
||
msgstr "%F"
|
||
|
||
#: tfrmopenwith.milistofurls.caption
|
||
msgid "Multiple URIs"
|
||
msgstr "Πολλαπλά URIs"
|
||
|
||
#: tfrmopenwith.milistofurls.hint
|
||
msgid "%U"
|
||
msgstr "%U"
|
||
|
||
#: tfrmopenwith.misinglefilename.caption
|
||
msgid "Single file name"
|
||
msgstr "Μονό όνομα αρχείου"
|
||
|
||
#: tfrmopenwith.misinglefilename.hint
|
||
msgid "%f"
|
||
msgstr "%f"
|
||
|
||
#: tfrmopenwith.misingleurl.caption
|
||
msgid "Single URI"
|
||
msgstr "Μονό URI"
|
||
|
||
#: tfrmopenwith.misingleurl.hint
|
||
msgid "%u"
|
||
msgstr "%u"
|
||
|
||
#: tfrmoptions.btnapply.caption
|
||
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
|
||
msgid "&Apply"
|
||
msgstr "Εφαρμογή"
|
||
|
||
#: tfrmoptions.btncancel.caption
|
||
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmoptions.btnok.caption
|
||
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmoptions.caption
|
||
msgctxt "TFRMOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Επιλογές"
|
||
|
||
#: tfrmoptions.lblemptyeditor.caption
|
||
msgid "Please select one of the subpages, this page does not contain any settings."
|
||
msgstr "Παρακαλώ επιλέξτε μία από τις υποσελίδες, αυτή η σελίδα δεν περιέχει κάποιες ρυθμίσεις"
|
||
|
||
#: tfrmoptionsarchivers.btnautoconfig.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNAUTOCONFIG.CAPTION"
|
||
msgid "A&uto Configure"
|
||
msgstr "Αυτόματη Διαμόρφωση"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcadd.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcapply.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Εφαρμογή"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCDELETE.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcrename.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
|
||
msgid "&Rename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: tfrmoptionsarchivers.btnrelativearchiver.hint
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNRELATIVEARCHIVER.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCDEBUG.CAPTION"
|
||
msgid "De&bug mode"
|
||
msgstr "Λειτουργία Αποσφαλμάτωσης"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCENABLED.CAPTION"
|
||
msgid "E&nabled"
|
||
msgstr "Ενεργοποιημένο"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCOUTPUT.CAPTION"
|
||
msgid "S&how console output"
|
||
msgstr "Εμφάνιση αποτελέσματος στο τερματικό"
|
||
|
||
#: tfrmoptionsarchivers.gbarchiveroptions.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Επιλογές"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveadd.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEADD.CAPTION"
|
||
msgid "Add&ing:"
|
||
msgstr "Προσθήκη:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextension.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTENSION.CAPTION"
|
||
msgid "E&xtension:"
|
||
msgstr "Επέκταση:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextract.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTRACT.CAPTION"
|
||
msgid "Ex&tract:"
|
||
msgstr "Εξαγωγή:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelist.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELIST.CAPTION"
|
||
msgid "&List:"
|
||
msgstr "Λίστα:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistend.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTEND.CAPTION"
|
||
msgid "Listing &finish (optional):"
|
||
msgstr "Λίστα και τέλος (προαιρετικά):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistformat.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTFORMAT.CAPTION"
|
||
msgid "Listing for&mat:"
|
||
msgstr "Μορφή Λίστας:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveliststart.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTSTART.CAPTION"
|
||
msgid "Listin&g start (optional):"
|
||
msgstr "Λίστα και εκκίνηση (προαιρετικά):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiver.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVER.CAPTION"
|
||
msgid "Arc&hiver:"
|
||
msgstr "Πρόγραμμα Συμπίεσης:"
|
||
|
||
#: tfrmoptionsarchivers.lbldescription.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.LBLDESCRIPTION.CAPTION"
|
||
msgid "De&scription:"
|
||
msgstr "Περιγραφή:"
|
||
|
||
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
|
||
msgid "Additional"
|
||
msgstr "Επιπλέον:"
|
||
|
||
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
|
||
msgid "General"
|
||
msgstr "Γενικά"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
|
||
msgid "When &size, date or attributes change"
|
||
msgstr "Όταν μέγεθος, ημερομηνία ή ιδιότητες αλλάζουν"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Για τις ακόλουθες διαδρομές και τους υποκαταλόγους τους:"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
|
||
msgid "When &files are created, deleted or renamed"
|
||
msgstr "Όταν αρχεία δημιουργούνται, διαγράφονται ή μετονομάζονται"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
|
||
msgid "When application is in the &background"
|
||
msgstr "Όταν η εφαρμογή είναι στο &παρασκήνιο"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
|
||
msgid "Disable auto-refresh"
|
||
msgstr "Απενεργοποίηση αυτόματης ανανέωσης"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
||
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
|
||
msgid "Refresh file list"
|
||
msgstr "Ανανέωση λίστας αρχείων"
|
||
|
||
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
|
||
msgid "Al&ways show tray icon"
|
||
msgstr "Εμφάνιση πάντα εικονιδίου στο πλαίσιο συστήματος"
|
||
|
||
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
||
msgid "Automatically &hide unmounted devices"
|
||
msgstr "Αυτόματη απόκρυψη μη προσαρτημένων οδηγών"
|
||
|
||
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
|
||
msgid "Mo&ve icon to system tray when minimized"
|
||
msgstr "Μετακίνηση εικονιδίου στο πλαίσιο συστήματος όταν γίνεται ελαχιστοποίηση"
|
||
|
||
#: tfrmoptionsbehavior.cbonlyonce.caption
|
||
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
|
||
msgid "A&llow only one copy of DC at a time"
|
||
msgstr "Επιτρέψτε μόνο ένα αντίγραφο του DC κάθε φορά"
|
||
|
||
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
||
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
||
msgstr "Εδώ μπορείτε να εισάγετε έναν ή περισσότερους οδηγούς ή σημεία προσάρτησης, διαχωρισμένα με \";\"."
|
||
|
||
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
||
msgid "Drives &blacklist"
|
||
msgstr "Μαύρη Λίστα Οδηγών"
|
||
|
||
#: tfrmoptionsbriefview.gbcolumns.caption
|
||
msgid "Columns size"
|
||
msgstr "Μέγεθος Στηλών"
|
||
|
||
#: tfrmoptionsbriefview.gbshowfileext.caption
|
||
msgid "Show file extensions"
|
||
msgstr "Εμφάνιση επεκτάσεων αρχείου"
|
||
|
||
#: tfrmoptionsbriefview.rbaligned.caption
|
||
msgid "ali&gned (with Tab)"
|
||
msgstr "Ευθυγραμμισμένο (με Καρτέλα)"
|
||
|
||
#: tfrmoptionsbriefview.rbdirectly.caption
|
||
msgid "di&rectly after filename"
|
||
msgstr "Αμέσως μετά το όνομα αρχείου"
|
||
|
||
#: tfrmoptionsbriefview.rbuseautosize.caption
|
||
msgid "Auto"
|
||
msgstr "Αυτόματα"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
||
msgid "Fixed columns count"
|
||
msgstr "Σταθερή Άθροιση Στηλών"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
||
msgid "Fixed columns width"
|
||
msgstr "Σταθερό Πλάτος Στηλών"
|
||
|
||
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
||
msgid "Cut &text to column width"
|
||
msgstr "Αποκοπή κειμένου στο πλάτος της στήλης"
|
||
|
||
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
|
||
msgid "&Extend cell width if text is not fitting into column"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
||
msgid "&Horizontal lines"
|
||
msgstr "Οριζόντιες γραμμές"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
||
msgid "&Vertical lines"
|
||
msgstr "Κάθετες γραμμές"
|
||
|
||
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
||
msgid "A&uto fill columns"
|
||
msgstr "Αυτόματη συμπλήρωση στηλών"
|
||
|
||
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
||
msgid "Show grid"
|
||
msgstr "Εμφάνιση πλέγματος"
|
||
|
||
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
||
msgid "Auto-size columns"
|
||
msgstr "Αυτόματη Ρύθμιση Μεγέθους Στηλών"
|
||
|
||
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
||
msgid "Auto si&ze column:"
|
||
msgstr "Αυτόματη προσαρμογή μεγέθους στήλης:"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Εφαρμογή"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
||
msgid "Co&mmand line history"
|
||
msgstr "Ιστορικό Γραμμής Εντολών"
|
||
|
||
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
|
||
msgid "&Directory history"
|
||
msgstr "Ιστορικό Καταλόγου"
|
||
|
||
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
||
msgid "&File mask history"
|
||
msgstr "Ιστορικό μάσκας αρχείου"
|
||
|
||
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
||
msgid "Sa&ve configuration"
|
||
msgstr "Αποθήκευση Ρυθμίσεων"
|
||
|
||
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
||
msgid "Searc&h/Replace history"
|
||
msgstr "Αναζήτηση/Αντικατάσταση Ιστορικό"
|
||
|
||
#: tfrmoptionsconfiguration.gbdirectories.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Κατάλογοι"
|
||
|
||
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
||
msgid "Location of configuration files"
|
||
msgstr "Τοποθεσία των αρχείων επεξεργασίας"
|
||
|
||
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
||
msgid "Save on exit"
|
||
msgstr "Αποθήκευση κατά την έξοδο"
|
||
|
||
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
||
msgid "Sort order of configuration order in left tree"
|
||
msgstr "Καθορισμός σειράς της σειράς ρύθμισης στο αριστερό δέντρο"
|
||
|
||
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
||
msgid "Set on command line"
|
||
msgstr "Καθορισμός στη γραμμή εντολών"
|
||
|
||
#: tfrmoptionsconfiguration.lbliconthemes.caption
|
||
msgid "Icon themes:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.lblthumbcache.caption
|
||
msgid "Thumbnails cache:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
||
msgid "P&rogram directory (portable version)"
|
||
msgstr "Κατάλογος Προγράμματος (φορητή έκδοση)"
|
||
|
||
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
||
msgid "&User home directory"
|
||
msgstr "Αρχικός Κατάλογος Χρήστη"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFONT.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Εφαρμογή των αλλαγών σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORBORDERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnfont.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
||
msgid "Go to set default"
|
||
msgstr "Μετάβαση στον ορισμό προκαθορισμένου"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
|
||
msgid "New"
|
||
msgstr "Νέο"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnext.caption
|
||
msgid "Next"
|
||
msgstr "Επόμενο"
|
||
|
||
#: tfrmoptionscustomcolumns.btnprev.caption
|
||
msgid "Previous"
|
||
msgstr "Προηγούμενο"
|
||
|
||
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORBORDER.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Επαναφορά στη προεπιλογή"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
|
||
msgid "Save as"
|
||
msgstr "Αποθήκευση ως"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBALLOWOVERCOLOR.CAPTION"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Επιτρέψτε Επιχρωμάτωση"
|
||
|
||
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
||
msgid "When clicking to change something, change for all columns"
|
||
msgstr "Όταν γίνεται κλικ για κάποια αλλαγή, εφαρμογή της αλλαγής σε όλες τις στήλες"
|
||
|
||
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
|
||
msgid "General"
|
||
msgstr "Γενικά"
|
||
|
||
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCURSORBORDER.CAPTION"
|
||
msgid "Cursor border"
|
||
msgstr "Όρια κέρσορα"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
||
msgid "Use Frame Cursor"
|
||
msgstr "Χρήση Κέρσορα Πλαισίου"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Selection Color"
|
||
msgstr "Χρήση Ανενεργού Χρώματος Επιλογής"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
||
msgid "Use Inverted Selection"
|
||
msgstr "Χρήση Ανάστροφης Επιλογής"
|
||
|
||
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
||
msgid "Use custom font and color for this view"
|
||
msgstr "Χρήση προσαρμοσμένης γραμματοσειράς και χρώματος για αυτή την προβολή"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLBACKCOLOR.CAPTION"
|
||
msgid "BackGround:"
|
||
msgstr "Παρασκήνιο:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLBACKCOLOR2.CAPTION"
|
||
msgid "Background 2:"
|
||
msgstr "Παρασκήνιο 2:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
||
msgid "Con&figure columns view:"
|
||
msgstr "Ρυθμίστε την προβολή στηλών:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
||
msgid "[Current Column Name]"
|
||
msgstr "[Όνομα Τρέχουσας Στήλης]"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCURSORCOLOR.CAPTION"
|
||
msgid "Cursor Color:"
|
||
msgstr "Χρώμα Κέρσορα"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLCURSORTEXT.CAPTION"
|
||
msgid "Cursor Text:"
|
||
msgstr "Κείμενο Κέρσορα"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontname.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTNAME.CAPTION"
|
||
msgid "Font:"
|
||
msgstr "Γραμματοσειρά:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
|
||
msgid "Size:"
|
||
msgstr "Μέγεθος:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFORECOLOR.CAPTION"
|
||
msgid "Text Color:"
|
||
msgstr "Χρώμα Κειμένου:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Ανενεργό Χρώμα Κέρσορα:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Χρώμα Ανενεργού Επιλογέα:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLMARKCOLOR.CAPTION"
|
||
msgid "Mark Color:"
|
||
msgstr "Χρώμα Επιλογέα:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLPREVIEWTOP.CAPTION"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Παρακάτω είναι μία προεπισκόπηση. Μπορείται να μετακινήσετε τον κέρσορα και να επιλέξετε αρχεία ώστε να έχετε άμεσα μία πραγματική εικόνα και αίσθηση των διαφόρων ρυθμίσεων."
|
||
|
||
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
||
msgid "Settings for column:"
|
||
msgstr "Ρυθμίσεις για στήλη:"
|
||
|
||
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.MIADDCOLUMN.CAPTION"
|
||
msgid "Add column"
|
||
msgstr "Προσθήκη στήλης"
|
||
|
||
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
||
msgid "Position of frame panel after the comparison:"
|
||
msgstr "Θέση του πάνελ πλαισίου μετά την σύγκριση:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
|
||
msgid "Add directory of the &active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
|
||
msgid "Add &directories of the active && inactive frames"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
|
||
msgid "Add directory I will bro&wse to"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
|
||
msgid "Add a copy of the selected entry"
|
||
msgstr "Προσθήκη ενός αντιγράφου της επιλεγμένης καταχώρισης"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
|
||
msgid "Add current &selected or active directories of active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
|
||
msgid "Add a separator"
|
||
msgstr "Προσθήκη ενός διαχωριστικού"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
|
||
msgid "Add a sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
|
||
msgid "Add directory I will type"
|
||
msgstr "Προσθήκη καταλόγου που θα πληκτρολογήσω"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Σύμπτυξη όλων"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
|
||
msgid "Collapse item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcut.caption
|
||
msgid "Cut selection of entries"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
|
||
msgid "Delete all!"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Διαγραφή επιλεγμένου αντικειμένου"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
|
||
msgid "Delete sub-menu and all its elements"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
|
||
msgid "Delete just sub-menu but keep elements"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
|
||
msgid "Expand item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
|
||
msgid "Focus tree window"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
|
||
msgid "Goto first item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
|
||
msgid "Goto last item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
|
||
msgid "Go to next item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
|
||
msgid "Go to previous item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
|
||
msgid "Insert directory of the &active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
|
||
msgid "Insert &directories of the active && inactive frames"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
|
||
msgid "Insert directory I will bro&wse to"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
|
||
msgid "Insert a copy of the selected entry"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
|
||
msgid "Insert current &selected or active directories of active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
|
||
msgid "Insert a separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
|
||
msgid "Insert sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
|
||
msgid "Insert directory I will type"
|
||
msgstr "Εισαγωγή καταλόγου που θα πληκτρολογήσω"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
|
||
msgid "Move to next"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
|
||
msgid "Move to previous"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Άνοιγμα όλων των κλάδων"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actpaste.caption
|
||
msgid "Paste what was cut"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
|
||
msgid "Search && replace in &path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
|
||
msgid "Search && replace in both path and target"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
|
||
msgid "Search && replace in &target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
|
||
msgid "Tweak path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
|
||
msgid "Tweak target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
||
msgid "A&dd..."
|
||
msgstr "Προσθήκη..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
||
msgid "Bac&kup..."
|
||
msgstr "Αντίγραφο Ασφαλείας..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
||
msgid "De&lete..."
|
||
msgstr "Διαγραφή..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
||
msgid "E&xport..."
|
||
msgstr "Εξαγωγή..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Βοήθεια"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
||
msgid "Impo&rt..."
|
||
msgstr "Εισαγωγή..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
||
msgid "&Insert..."
|
||
msgstr "Εισάγετε..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
||
msgid "&Miscellaneous..."
|
||
msgstr "Διάφορα..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVETARGET.HINT"
|
||
msgid "Some functions to select appropriate target"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλου στόχου"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
||
msgid "&Sort..."
|
||
msgstr "Ταξινόμηση..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
||
msgid "&When adding directory, add also target"
|
||
msgstr "Κατά την προσθήκη καταλόγου, προσθήκη επίσης στόχου"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
||
msgid "Alwa&ys expand tree"
|
||
msgstr "Ανάπτυξη Δέντρου Πάντα"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
||
msgid "Show only &valid environment variables"
|
||
msgstr "Εμφάνιση μόνο έγκυρων μεταβλητών περιβάλλοντος"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
||
msgid "In pop&up, show [path also]"
|
||
msgstr "Στο αναδυόμενο παράθυρο, εμφάνιση [διαδρομής επίσης]"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRPATH.TEXT"
|
||
msgid "Name, a-z"
|
||
msgstr "Όνομα, α-ω"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
|
||
msgid "Name, a-z"
|
||
msgstr "Όνομα, α-ω"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
||
msgid "Directory Hotlist (reorder by drag && drop)"
|
||
msgstr "Κατάλογος Hotlist (αναδιάταξη με μεταφορά && απόθεση)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Άλλες Επιλογές"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
|
||
msgid "Name:"
|
||
msgstr "Όνομα:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
|
||
msgid "Path:"
|
||
msgstr "Διαδρομή:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRTARGET.EDITLABEL.CAPTION"
|
||
msgid "&Target:"
|
||
msgstr "Στόχος:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
||
msgid "...current le&vel of item(s) selected only"
|
||
msgstr "...τρέχον επίπεδο του επιλεγμένου αρχείου(ων) μόνο"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHEXIST.CAPTION"
|
||
msgid "Scan all &hotdir's path to validate the ones that actually exist"
|
||
msgstr "Σάρωση όλων των διαδρομών των hotdir για επικύρωση αυτών που πραγματικά υπάρχουν"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHTARGETEXIST.CAPTION"
|
||
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
|
||
msgstr "Σάρωση όλων των διαδρομών των hotdir και στόχων για επικύρωση αυτών που πραγματικά υπάρχουν"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
||
msgid "to a Directory &Hotlist file (.hotlist)"
|
||
msgstr "σε ένα αρχείου καταλόγου Hotlist (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
|
||
msgstr "σε ένα \"wincmd.ini\" του TC (διατήρηση υπάρχοντος)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
|
||
msgstr "σε ένα \"wincmd.ini\" του TC (διαγραφή υπάρχοντος)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
||
msgid "Go to &configure TC related info"
|
||
msgstr "Μετάβαση σε διαμόρφωση πληροφοριών σχετικές με TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
|
||
msgid "Go to &configure TC related info"
|
||
msgstr "Μετάβαση σε διαμόρφωση πληροφοριών σχετικές με TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
||
msgid "HotDirTestMenu"
|
||
msgstr "HotDirΜενούΔοκιμών"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
||
msgid "from a Directory &Hotlist file (.hotlist)"
|
||
msgstr "Από ένα αρχείο καταλόγου Hotlist (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
||
msgid "from \"&wincmd.ini\" of TC"
|
||
msgstr "Από \"wincmd.ini\" του TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.minavigate.caption
|
||
msgid "&Navigate..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
||
msgid "&Restore a backup of Directory Hotlist"
|
||
msgstr "Επαναφορά ενός αντιγράφου ασφαλείας της Hotlist Καταλόγων"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
||
msgid "&Save a backup of current Directory Hotlist"
|
||
msgstr "Αποθήκευση ενός αντιγράφου ασφαλείας της τρέχουσας Hotlist Καταλόγων"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
||
msgid "Search and &replace..."
|
||
msgstr "Αναζήτηση και αντικατάσταση..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
||
msgid "...everything, from A to &Z!"
|
||
msgstr "...όλα, από το Α ως το Ω!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
||
msgid "...single &group of item(s) only"
|
||
msgstr "...μονό γκρουπ από αντικείμενο(α) μόνο"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
||
msgid "...&content of submenu(s) selected, no sublevel"
|
||
msgstr "...περιεχόμενα ενός ( ή πολλών) υπομενού επιλεγμένα, όχι δευτερεύοντα επίπεδα"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and &all sublevels"
|
||
msgstr "...περιεχόμενα του(των) υπομενού επιλεγμένα και όλων των δευτερευόντων επιπέδων"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MITESTRESULTINGHOTLISTMENU.CAPTION"
|
||
msgid "Test resultin&g menu"
|
||
msgstr "Μενού αποτελεσμάτων Δοκιμών"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
|
||
msgid "Tweak &path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
|
||
msgid "Tweak &target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
||
msgid "Addition from main panel"
|
||
msgstr "Προσθήκη από το κύριο πάνελ:"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
||
msgid "From all the supported formats, ask which one to use every time"
|
||
msgstr "Από όλες τις υποστηριζόμενες μορφές, ερώτηση για ποια θα χρησιμοποιηθεί κάθε φορά"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
||
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
||
msgstr "Κατά την αποθήκευση κειμένου Unicode, αποθήκευση σε μορφή UTF8 (αλλιώς θα είναι σε μορφή UTF16)"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
||
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
||
msgstr "Όταν γίνεται εναπόθεση κειμένου, δημιουργία ονόματος κειμένου αυτόματα (αλλιώς θα ερωτηθεί ο χρήστης)"
|
||
|
||
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
||
msgid "&Show confirmation dialog after drop"
|
||
msgstr "Εμφάνιση διαλόγου επιβεβαίωσης μετά την απόθεση"
|
||
|
||
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
||
msgid "When drag && dropping text into panels:"
|
||
msgstr "Όταν μεταφέρεται και αποτίθεται κείμενο στα πάνελ:"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
||
msgid "Place the most desired format on top of list (use dag && drop):"
|
||
msgstr "Τοποθετείστε την πιο επιθυμητή μορφή στην κορυφή της λίστας (χρήση μεταφοράς και απόθεσης)"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
||
msgid "(if the most desired is not present, we'll take second one and so on)"
|
||
msgstr "(αν η πιο επιθυμητή δεν είναι παρούσα, θα χρησιμοποιηθεί η δεύτερη και ούτω καθεξής)"
|
||
|
||
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
||
msgid "(will not work with some source application, so try to uncheck if problem)"
|
||
msgstr "(δεν θα λειτουργήσει με μερικές εφαρμογές, οπότε δοκιμάστε να το αποεπιλέξετε αν υπάρχει πρόβλημα)"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
||
msgid "Show &file system"
|
||
msgstr "Εμφάνιση συστήματος αρχείων"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
||
msgid "Show fr&ee space"
|
||
msgstr "Εμφάνιση Ελεύθερου διαστήματος"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
||
msgid "Show &label"
|
||
msgstr "Εμφάνιση ετικέτας"
|
||
|
||
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
||
msgid "Drives list"
|
||
msgstr "Λίστα Οδηγών"
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.caption
|
||
msgid "Caret past end of line"
|
||
msgstr "Κέρσορας μετά το τέλος γραμμής"
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.caption
|
||
msgid "Show special characters"
|
||
msgstr "Εμφάνιση ειδικών χαρακτήρων"
|
||
|
||
#: tfrmoptionseditor.gbinternaleditor.caption
|
||
msgid "Internal editor options"
|
||
msgstr "Ιδιότητες Εσωτερικού επεξεργαστή"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "Παρασκήνιο"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
||
msgid "Bac&kground"
|
||
msgstr "Παρασκήνιο"
|
||
|
||
#: tfrmoptionseditorcolors.btnresetmask.hint
|
||
msgid "Reset"
|
||
msgstr "Επαναφορά"
|
||
|
||
#: tfrmoptionseditorcolors.btnsavemask.hint
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
|
||
msgid "Save"
|
||
msgstr "Αποθήκευση"
|
||
|
||
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
||
msgid "Element Attributes"
|
||
msgstr "Ιδιότητες Στοιχείων"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
||
msgid "Fo®round"
|
||
msgstr "Προσκήνιο"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
||
msgid "Fo®round"
|
||
msgstr "Προσκήνιο"
|
||
|
||
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
||
msgid "&Text-mark"
|
||
msgstr "Επιλογέας κειμένου"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
||
msgid "Use (and edit) &global scheme settings"
|
||
msgstr "Χρήση (και διαμόρφωση) ρυθμίσεων του ολικού σχήματος"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
||
msgid "Use &local scheme settings"
|
||
msgstr "Χρήση τοπικών ρυθμίσεων σχήματος"
|
||
|
||
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
||
msgid "&Bold"
|
||
msgstr "Έντονη Γραφή"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "Αναστροφή"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "Κλειστό"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "Ανοικτό"
|
||
|
||
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
||
msgid "&Italic"
|
||
msgstr "Πλάγια"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "Αναστροφή"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "Κλειστό"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "Ανοικτό"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
||
msgid "&Strike Out"
|
||
msgstr "Μεσογράμμιση"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "Αναστροφή"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "Κλειστό"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "Ανοικτό"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
||
msgid "&Underline"
|
||
msgstr "Υπογράμμιση"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "Αναστροφή"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "Κλειστό"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "Ανοικτό"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnadd.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
|
||
msgid "Add..."
|
||
msgstr "Προσθήκη..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btndelete.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
|
||
msgid "Delete..."
|
||
msgstr "Διαγραφή..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
||
msgid "Import/Export"
|
||
msgstr "Εισαγωγή/Εξαγωγή"
|
||
|
||
#: tfrmoptionsfavoritetabs.btninsert.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
|
||
msgid "Insert..."
|
||
msgstr "Εισάγετε..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnrename.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnsort.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
|
||
msgid "Sort..."
|
||
msgstr "Ταξινόμηση..."
|
||
|
||
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "Κανένα"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
|
||
msgid "Always expand tree"
|
||
msgstr "Ανάπτυξη Δέντρου Πάντα"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Όχι"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
||
msgid "Left"
|
||
msgstr "Αριστερά"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
||
msgid "Right"
|
||
msgstr "Δεξιά"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
||
msgid "Favorite Tabs list (reorder by drag && drop)"
|
||
msgstr "Λίστα Αγαπημένων Καρτελών (αναδιάταξη με μεταφορά && απόθεση)"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Άλλες Επιλογές"
|
||
|
||
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
||
msgid "What to restore where for the selected entry:"
|
||
msgstr "Τι να αποκατασταθεί που για την επιλεγμένη καταχώρηση:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
||
msgid "Existing tabs to keep:"
|
||
msgstr "Υπάρχουσες καρτέλες προς φύλαξη:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
||
msgid "Save dir history:"
|
||
msgstr "Αποθήκευση ιστορικού καταλόγου:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
||
msgid "Tabs saved on left to be restored to:"
|
||
msgstr "Καρτέλες αποθηκευμένες αριστερά να αποκατασταθούν σε :"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
||
msgid "Tabs saved on right to be restored to:"
|
||
msgstr "Καρτέλες αποθηκευμένες δεξιά να αποκατασταθούν σε :"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
|
||
msgid "a separator"
|
||
msgstr "ένα διαχωριστικό"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
||
msgid "Add separator"
|
||
msgstr "Προσθήκη διαχωριστικού"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
|
||
msgid "sub-menu"
|
||
msgstr "υπομενού"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
|
||
msgid "Add sub-menu"
|
||
msgstr "Προσθήκη υπο-μενού"
|
||
|
||
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Σύμπτυξη όλων"
|
||
|
||
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr "...τρέχον επίπεδο του επιλεγμένου αρχείου(ων) μόνο"
|
||
|
||
#: tfrmoptionsfavoritetabs.micutselection.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
|
||
msgid "Cut"
|
||
msgstr "Αποκοπή"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
|
||
msgid "delete all!"
|
||
msgstr "Διαγραφή Όλων!"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "Υπομενού με όλα του τα στοιχεία"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "μόνο υπομενού αλλά διατήρηση των στοιχείων"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
|
||
msgid "selected item"
|
||
msgstr "επιλεγμένο αντικείμενο"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Διαγραφή επιλεγμένου αντικειμένου"
|
||
|
||
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
||
msgid "Export selection to legacy .tab file(s)"
|
||
msgstr "Εξαγωγή επιλογής στο legacy .tab αρχείο(α)"
|
||
|
||
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
||
msgid "FavoriteTabsTestMenu"
|
||
msgstr "ΑγαπημένεςΚαρτέλεςΤεστΜενού"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
||
msgid "Import legacy .tab file(s) according to default setting"
|
||
msgstr "Εισαγωγή legacy .tab αρχείου(ων) βάσει της προκαθορισμένης ρύθμισης"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr "Εισαγωγή legacy .tab αρχείου(ων) στην επιλεγμένη θέση"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr "Εισαγωγή legacy .tab αρχείου(ων) στην επιλεγμένη θέση"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
||
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
||
msgstr "Εισαγωγή legacy .tab αρχείου(ων) στην επιλεγμένη θέση σε ένα υπομενού"
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
||
msgid "Insert separator"
|
||
msgstr "Εισαγωγή διαχωριστικού"
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
||
msgid "Insert sub-menu"
|
||
msgstr "Εισαγωγή υπο-μενού"
|
||
|
||
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Άνοιγμα όλων των κλάδων"
|
||
|
||
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
|
||
msgid "Paste"
|
||
msgstr "Επικόλληση"
|
||
|
||
#: tfrmoptionsfavoritetabs.mirename.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
|
||
msgid "Rename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "...όλα, από το Α ως το Ω!"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
||
msgid "...single group of item(s) only"
|
||
msgstr "...μονό γκρουπ από αντικείμενο(α) μόνο"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr "Ταξινόμηση μονού γκρουπ από αντικείμενο(α) μόνο"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr "...περιεχόμενα ενός ( ή πολλών) υπομενού επιλεγμένα, όχι δευτερεύοντα επίπεδα"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr "...περιεχόμενα του(των) υπομενού επιλεγμένα και όλων των δευτερευόντων επιπέδων"
|
||
|
||
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
||
msgid "Test resulting menu"
|
||
msgstr "Μενού αποτελεσμάτων Δοκιμών"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddact.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDACT.CAPTION"
|
||
msgid "Add"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddext.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
|
||
msgid "&Add"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmoptionsfileassoc.btncloneact.caption
|
||
msgid "Clone"
|
||
msgstr "Κλωνοποίηση"
|
||
|
||
#: tfrmoptionsfileassoc.btndownact.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNDOWNACT.CAPTION"
|
||
msgid "&Down"
|
||
msgstr "Κάτω"
|
||
|
||
#: tfrmoptionsfileassoc.btneditext.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
||
msgid "Insert"
|
||
msgstr "Εισάγετε"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertext.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION"
|
||
msgid "Insert"
|
||
msgstr "Εισάγετε"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveact.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVEACT.CAPTION"
|
||
msgid "Remo&ve"
|
||
msgstr "Αφαίρεση"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveext.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVEEXT.CAPTION"
|
||
msgid "Re&move"
|
||
msgstr "Αφαίρεση"
|
||
|
||
#: tfrmoptionsfileassoc.btnremovetype.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Αφαίρεση"
|
||
|
||
#: tfrmoptionsfileassoc.btnrenametype.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNRENAMETYPE.CAPTION"
|
||
msgid "R&ename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: tfrmoptionsfileassoc.btnupact.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
|
||
msgid "&Up"
|
||
msgstr "Πάνω"
|
||
|
||
#: tfrmoptionsfileassoc.destartpath.hint
|
||
msgid "Starting path of the command. Never quote this string."
|
||
msgstr "Αρχική διαδρομή αυτής εντολής. Ποτέ μην βάζετε αυτή τη γραμμή σε εισαγωγικά."
|
||
|
||
#: tfrmoptionsfileassoc.edbactionname.hint
|
||
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
||
msgstr "Όνομα αυτής της ενέργειας. Ποτέ δεν μεταφέρεται στο σύστημα, είναι μόνο ένα όνομα απομνημόνευσης επιλεγμένο από εσάς, για σας"
|
||
|
||
#: tfrmoptionsfileassoc.edtparams.hint
|
||
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
|
||
msgstr "Παράμετρος που θα μεταφερθεί στην εντολή. Μακρύ όνομα αρχείου με κενά θα μπει σε εισαγωγικά."
|
||
|
||
#: tfrmoptionsfileassoc.fnecommand.hint
|
||
msgid "Command to execute. Long filename with space should be quoted."
|
||
msgstr "Εντολή προς εκτέλεση. Μακρύ όνομα αρχείου με κενά θα μπουν σε εισαγωγικά."
|
||
|
||
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
||
msgid "Action description:"
|
||
msgstr "Περιγραφή Ενέργειας:"
|
||
|
||
#: tfrmoptionsfileassoc.gbactions.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.GBACTIONS.CAPTION"
|
||
msgid "Actions"
|
||
msgstr "Ενέργειες"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.GBEXTS.CAPTION"
|
||
msgid "Extensions"
|
||
msgstr "Επεκτάσεις"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.hint
|
||
msgid "Can be sorted by drag & drop"
|
||
msgstr "Μπορεί να ταξινομηθεί με μεταφορά & απόθεση"
|
||
|
||
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.GBFILETYPES.CAPTION"
|
||
msgid "File types"
|
||
msgstr "Τύποι Αρχείων"
|
||
|
||
#: tfrmoptionsfileassoc.gbicon.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.GBICON.CAPTION"
|
||
msgid "Icon"
|
||
msgstr "Εικονίδιο"
|
||
|
||
#: tfrmoptionsfileassoc.lbactions.hint
|
||
msgid "Actions may be sorted by drag & drop"
|
||
msgstr "Οι Ενέργειες μπορούν να ταξινομηθούν με μεταφορά & απόθεση"
|
||
|
||
#: tfrmoptionsfileassoc.lbexts.hint
|
||
msgid "Extensions may be sorted by drag & drop"
|
||
msgstr "Οι Επεκτάσεις μπορούν να ταξινομηθούν με μεταφορά & απόθεση"
|
||
|
||
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
||
msgid "File types may be sorted by drag & drop"
|
||
msgstr "Ο τύποι αρχείων μπορούν να ταξινομηθούν με μεταφορά & απόθεση"
|
||
|
||
#: tfrmoptionsfileassoc.lblaction.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.LBLACTION.CAPTION"
|
||
msgid "Action name:"
|
||
msgstr "Όνομα Ενέργειας:"
|
||
|
||
#: tfrmoptionsfileassoc.lblcommand.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.LBLCOMMAND.CAPTION"
|
||
msgid "&Command:"
|
||
msgstr "Εντολή:"
|
||
|
||
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.LBLEXTERNALPARAMETERS.CAPTION"
|
||
msgid "Parameter&s:"
|
||
msgstr "Παράμετροι:"
|
||
|
||
#: tfrmoptionsfileassoc.lblstartpath.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.LBLSTARTPATH.CAPTION"
|
||
msgid "Start pat&h:"
|
||
msgstr "Αρχική Διαδρομή:"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem1.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem3.caption
|
||
msgid "Custom with..."
|
||
msgstr "Προσαρμογή με..."
|
||
|
||
#: tfrmoptionsfileassoc.micustom.caption
|
||
msgid "Custom"
|
||
msgstr "Προσαρμογή"
|
||
|
||
#: tfrmoptionsfileassoc.miedit.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmoptionsfileassoc.mieditor.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIEDITOR.CAPTION"
|
||
msgid "Open in Editor"
|
||
msgstr "Άνοιγμα στον Επεξεργαστή"
|
||
|
||
#: tfrmoptionsfileassoc.mieditwith.caption
|
||
msgid "Edit with..."
|
||
msgstr "Επεξεργασία με..."
|
||
|
||
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIGETOUTPUTFROMCOMMAND.CAPTION"
|
||
msgid "Get output from command"
|
||
msgstr "Εξαγωγή αποτελέσματος από την εντολή"
|
||
|
||
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
||
msgid "Open in Internal Editor"
|
||
msgstr "Άνοιγμα σε Εσωτερικό Επεξεργαστή"
|
||
|
||
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
||
msgid "Open in Internal Viewer"
|
||
msgstr "Άνοιγμα με Εσωτερικό Προβολέα"
|
||
|
||
#: tfrmoptionsfileassoc.miopen.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Άνοιγμα"
|
||
|
||
#: tfrmoptionsfileassoc.miopenwith.caption
|
||
msgid "Open with..."
|
||
msgstr "Άνοιγμα με..."
|
||
|
||
#: tfrmoptionsfileassoc.miseparator.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.mishell.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MISHELL.CAPTION"
|
||
msgid "Run in terminal"
|
||
msgstr "Εκτέλεση σε Τερματικό"
|
||
|
||
#: tfrmoptionsfileassoc.miview.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Προβολή"
|
||
|
||
#: tfrmoptionsfileassoc.miviewer.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEWER.CAPTION"
|
||
msgid "Open in Viewer"
|
||
msgstr " Άνοιγμα με Προβολέα"
|
||
|
||
#: tfrmoptionsfileassoc.miviewwith.caption
|
||
msgid "View with..."
|
||
msgstr "Προβολή με..."
|
||
|
||
#: tfrmoptionsfileassoc.sbtnicon.hint
|
||
msgid "Click me to change icon!"
|
||
msgstr "Επιλέξτε με για αλλαγή εικόνας!"
|
||
|
||
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXECUTEVIASHELL.CAPTION"
|
||
msgid "Execute via shell"
|
||
msgstr "Εκτέλεση μέσω κελύφους"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
||
msgid "Extended context menu"
|
||
msgstr "Μενού εκτεταμένων περιεχομένων"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
|
||
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXTENDEDCONTEXTMENU.HINT"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr "Όταν γίνεται πρόσβαση του συσχετισμού αρχείου, πρόταση για προσθήκη του τρέχοντος επιλεγμένου αρχείου αν δεν έχει ήδη συμπεριληφθεί σε ένα ρυθμισμένο τύπο αρχείου"
|
||
|
||
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
||
msgid "File association configuration"
|
||
msgstr "Ρυθμίσεις Συσχετισμού Αρχείων"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
||
msgid "Offer to add selection to file association when not included already"
|
||
msgstr "Πρόταση προσθήκης επιλογής στο συσχετισμό αρχείου όταν δεν συμπεριλαμβάνεται ήδη"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr "Όταν γίνεται πρόσβαση του συσχετισμού αρχείου, πρόταση για προσθήκη του τρέχοντος επιλεγμένου αρχείου αν δεν έχει ήδη συμπεριληφθεί σε ένα ρυθμισμένο τύπο αρχείου"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBOPENSYSTEMWITHTERMINALCLOSE.CAPTION"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Εκτέλεση με τερματικό και κλείσιμο"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBOPENSYSTEMWITHTERMINALSTAYOPEN.CAPTION"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Εκτέλεση με τερματικό και παραμονή ανοικτό"
|
||
|
||
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
||
msgid "Extended options items:"
|
||
msgstr "Αντικείμενα Εκτεταμένων Ρυθμίσεων:"
|
||
|
||
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.BVLCONFIRMATIONS.CAPTION"
|
||
msgid "Show confirmation window for:"
|
||
msgstr "Εμφάνιση παραθύρου επιβεβαίωσης για:"
|
||
|
||
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
||
msgid "Cop&y operation"
|
||
msgstr "Εργασία Αντιγραφής"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
||
msgid "&Delete operation"
|
||
msgstr "Λειτουργία διαγραφής"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
||
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
||
msgstr "Διαγραφή στον κάδο ανακύκλωσης (Το Shift πλήκτρο αναιρεί αυτή τη ρύθμιση)"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
||
msgid "D&elete to trash operation"
|
||
msgstr "Λειτουργία Διαγραφής στον κάδο"
|
||
|
||
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
|
||
msgid "D&rop readonly flag"
|
||
msgstr "Κατέβασμα σημαίας μόνο για ανάγνωση"
|
||
|
||
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
||
msgid "&Move operation"
|
||
msgstr "Λειτουργία Μετακίνησης"
|
||
|
||
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
||
msgid "&Process comments with files/folders"
|
||
msgstr "Επεξεργασία σχολίων για αρχεία/φακέλους"
|
||
|
||
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
||
msgid "Select &file name without extension when renaming"
|
||
msgstr "Επιλογή ονόματος αρχείου χωρίς επέκταση κατά την μετονομασία"
|
||
|
||
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
||
msgid "Sho&w tab select panel in copy/move dialog"
|
||
msgstr "Εμφάνιση καρτέλας επιλογής πάνελ στο διάλογο αντιγραφής/μετακίνησης"
|
||
|
||
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
||
msgid "S&kip file operations errors and write them to log window"
|
||
msgstr "Παράβλεψη των λαθών εργασιών αρχείων και καταγραφή τους στο παράθυρο καταγραφής"
|
||
|
||
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
||
msgid "Executing operations"
|
||
msgstr "Εκτέλεση λειτουργιών"
|
||
|
||
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
||
msgid "User interface"
|
||
msgstr "Περιβάλλον Χρήστη"
|
||
|
||
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
||
msgid "&Buffer size for file operations (in KB):"
|
||
msgstr "Μέγεθος ενδιάμεσης μνήμης για εργασίες αρχείων (σε KB):"
|
||
|
||
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
||
msgid "Buffer size for &hash calculation (in KB):"
|
||
msgstr "Μέγεθος ενδιάμεσης μνήμης για υπολογισμούς αθροιστικών ιχνών (σε KB):"
|
||
|
||
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
||
msgid "Show operations progress &initially in"
|
||
msgstr "Εμφάνιση προόδου εργασιών αρχικά σε"
|
||
|
||
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
||
msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLTYPEOFDUPLICATEDRENAME.CAPTION"
|
||
msgid "Duplicated name auto-rename style:"
|
||
msgstr "Στυλ αυτόματης μετονομασίας διπλότυπων:"
|
||
|
||
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
||
msgid "&Number of wipe passes:"
|
||
msgstr "Αριθμός περασμάτων ασφαλούς διαγραφής:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
||
msgid "Reset to DC default"
|
||
msgstr "Επαναφορά στα προκαθορισμένα του DC"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Επιτρέψτε Επιχρωμάτωση"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
||
msgid "Use &Frame Cursor"
|
||
msgstr "Χρήση Πλαισιακού Κέρσορα"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
||
msgid "Use &Gradient Indicator"
|
||
msgstr "Χρήση Διαβαθμισμένου Σημαντή"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Sel Color"
|
||
msgstr "Χρήση Χρώματος Ανενεργούς Επιλογής"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
||
msgid "U&se Inverted Selection"
|
||
msgstr "Χρήση Ανάποδης Επιλογής"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION"
|
||
msgid "Cursor border"
|
||
msgstr "Όρια Κέρσορα"
|
||
|
||
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
|
||
msgid "Drive Free Space Indicator"
|
||
msgstr "Σημαντής Ελεύθερου Χώρου Οδηγών"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
||
msgid "Bac&kground:"
|
||
msgstr "Παρασκήνιο:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
|
||
msgid "Backg&round 2:"
|
||
msgstr "Παρασκήνιο 2:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
|
||
msgid "C&ursor Color:"
|
||
msgstr "Χρώμα Κέρσορα:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
|
||
msgid "Cursor Te&xt:"
|
||
msgstr "Κείμενο Κέρσορα:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Ανενεργό Χρώμα Κέρσορα:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Χρώμα Ανενεργού Επιλογέα:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
||
msgid "&Brightness level of inactive panel"
|
||
msgstr "Επίπεδο Φωτεινότητας του ανενεργού πάνελ"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
||
msgid "In&dicator Back Color:"
|
||
msgstr "Πισινό Χρώμα Σημαντή:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
||
msgid "&Indicator Fore Color:"
|
||
msgstr "Μπροστινό Χρώμα Σημαντή:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
|
||
msgid "&Mark Color:"
|
||
msgstr "Χρώμα Επιλογέα:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
||
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
||
msgstr "Παρακάτω είναι μία προεπισκόπηση. Μπορείται να μετακινήσετε τον κέρσορα και να επιλέξετε αρχεία ώστε να έχετε άμεσα μία πραγματική εικόνα και αίσθηση των διαφόρων ρυθμίσεων."
|
||
|
||
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
|
||
msgid "T&ext Color:"
|
||
msgstr "Χρώμα Κειμένου:"
|
||
|
||
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
||
msgid "When launching file search, clear file mask filter"
|
||
msgstr "Όταν φορτώνεται η αναζήτηση αρχείων, καθαρισμός του φίλτρου μάσκας αρχείου"
|
||
|
||
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
||
msgid "&Search for part of file name"
|
||
msgstr "Αναζήτηση για τμήμα ονόματος αρχείου"
|
||
|
||
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
||
msgid "Show menu bar in \"Find files\""
|
||
msgstr "Εμφάνιση μπάρας μενού στην \"Αναζήτηση Αρχείων\""
|
||
|
||
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
||
msgid "Text search in files"
|
||
msgstr "Αναζήτηση Κειμένου στα αρχεία"
|
||
|
||
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
||
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
|
||
msgid "File search"
|
||
msgstr "Αναζήτηση Αρχείου"
|
||
|
||
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
||
msgid "Current filters with \"New search\" button:"
|
||
msgstr "Τρέχοντα φίλτρα με \"Νέα Αναζήτηση\" κουμπί:"
|
||
|
||
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
||
msgid "Default search template:"
|
||
msgstr "Εξ'ορισμού πρότυπο αναζήτησης:"
|
||
|
||
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
||
msgid "Use memory mapping for search te&xt in files"
|
||
msgstr "Χρήση απεικόνισης στη μνήμη για αναζήτηση κειμένου στα αρχεία"
|
||
|
||
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
||
msgid "&Use stream for search text in files"
|
||
msgstr "Χρήση stream για αναζήτηση κειμένου στα αρχεία"
|
||
|
||
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
||
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
||
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
|
||
msgid "&Help"
|
||
msgstr "Βοήθεια"
|
||
|
||
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
||
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
||
msgstr "Ενεργοποίηση αλλαγής στο &γονικό φάκελο όταν γίνεται διπλό κλικ πάνω σε ένα κενό τμήμα της προβολής αρχείου"
|
||
|
||
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
||
msgid "Do&n't load file list until a tab is activated"
|
||
msgstr "Να μην γίνει φόρτωση αρχείου μέχρι να ενεργοποιηθεί η καρτέλα"
|
||
|
||
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
||
msgid "S&how square brackets around directories"
|
||
msgstr "Εμφάνιση τετράγωνων αγκυλών([ ]) γύρω από τους καταλόγους"
|
||
|
||
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
||
msgid "Hi&ghlight new and updated files"
|
||
msgstr "Υπογράμμιση νέων και ενημερωμένων αρχείων"
|
||
|
||
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
||
msgid "Enable inplace &renaming when clicking twice on a name"
|
||
msgstr "Ενεργοποίηση εδώ και μετονομασία όταν γίνεται κλικ δύο φορές σε ένα όνομα"
|
||
|
||
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
|
||
msgid "Load &file list in separate thread"
|
||
msgstr "Φόρτωση λίστας αρχείων σε ξεχωριστή γραμμή"
|
||
|
||
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
|
||
msgid "Load icons af&ter file list"
|
||
msgstr "Φόρτωση εικονιδίων μετά τη λίστα αρχείων"
|
||
|
||
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
|
||
msgid "Show s&ystem and hidden files"
|
||
msgstr "Εμφάνιση αρχείων συστήματος και κρυφών"
|
||
|
||
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
||
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
||
msgstr "Όταν επιλέγονται αρχεία με το <SPACEBAR>, μετακίνηση κάτω στο επόμενο αρχείο (όπως με το <INSERT>)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
|
||
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
||
msgstr "Φίλτρο σε στυλ Windows όταν σημειώνονται αρχεία (\"*.*\" επίσης επιλέγει αρχεία χωρίς επέκταση, κ.λ.π.)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
||
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
|
||
msgid "Use an independant attribute filter in mask input dialog each time"
|
||
msgstr "Χρήση ενός ανεξάρτητου φίλτρου ιδιοτήτων, στο διάλογο εισαγωγής μάσκας, κάθε φορά"
|
||
|
||
#: tfrmoptionsfilesviews.gbformatting.caption
|
||
msgid "Formatting"
|
||
msgstr "Μορφοποίηση"
|
||
|
||
#: tfrmoptionsfilesviews.gbmarking.caption
|
||
msgid "Marking/Unmarking entries"
|
||
msgstr "Σήμανση/ Κατάργηση σήμανσης εγγραφών"
|
||
|
||
#: tfrmoptionsfilesviews.gbsorting.caption
|
||
msgid "Sorting"
|
||
msgstr "Ταξινόμηση"
|
||
|
||
#: tfrmoptionsfilesviews.lbattributemask.caption
|
||
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
|
||
msgid "Default attribute mask value to use:"
|
||
msgstr "Προκαθορισμένη τιμή ιδιότητας μάσκας προς χρήση:"
|
||
|
||
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
||
msgid "Case s&ensitivity:"
|
||
msgstr "Διάκριση πεζών-κεφαλαίων:"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
||
msgid "Incorrect format"
|
||
msgstr "Μη Έγκυρος Τύπος"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
||
msgid "&Date and time format:"
|
||
msgstr "Μορφοποίηση Ημερομηνίας και Χρονιάς:"
|
||
|
||
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
||
msgid "File si&ze format:"
|
||
msgstr "Μορφή μεγέθους Αρχείου:"
|
||
|
||
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
||
msgid "&Insert new files:"
|
||
msgstr "Εισαγωγή νέων αρχείων:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
||
msgid "So&rting directories:"
|
||
msgstr "Ταξινόμηση καταλόγων:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
||
msgid "&Sort method:"
|
||
msgstr "Μέθοδος Ταξινόμησης:"
|
||
|
||
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
||
msgid "&Move updated files:"
|
||
msgstr "Μετακίνηση ενημερωμένων αρχείων:"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Εφαρμογή"
|
||
|
||
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Πρότυπο..."
|
||
|
||
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
||
msgid "File types colors (sort by drag&&drop)"
|
||
msgstr "Χρώματα Τύπων Αρχείων (ταξινόμηση κατά μεταφορά&&απόθεση)"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
||
msgid "Category a&ttributes:"
|
||
msgstr "Ιδιότητες Κατηγοριών:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
||
msgid "Category co&lor:"
|
||
msgstr "Κατηγορία χρώματος:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "Μάσκα Κατηγορίας:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "Όνομα Κατηγορίας:"
|
||
|
||
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
||
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnseleditfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsellogfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselmainfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.lblconsolefont.caption
|
||
msgid "&Console font"
|
||
msgstr "Γραμματοσειρά Τερματικού"
|
||
|
||
#: tfrmoptionsfonts.lbleditorfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
|
||
msgid "&Editor font"
|
||
msgstr "Γραμματοσειρά Επεξεργαστή"
|
||
|
||
#: tfrmoptionsfonts.lbllogfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
|
||
msgid "&Log font"
|
||
msgstr "Γραμματοσειρά Καταγραφών"
|
||
|
||
#: tfrmoptionsfonts.lblmainfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
|
||
msgid "Main &font"
|
||
msgstr "Κύρια Γραμματοσειρά"
|
||
|
||
#: tfrmoptionsfonts.lblpatheditfont.caption
|
||
msgid "Path font"
|
||
msgstr "Γραμματοσειρά Διαδρομής"
|
||
|
||
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
||
msgid "Search results font"
|
||
msgstr "Γραμματοσειρά Αποτελεσμάτων Αναζήτησης"
|
||
|
||
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
|
||
msgid "Viewer&Book Font"
|
||
msgstr "Γραμματοσειρά Προβολέα Βιβλίων"
|
||
|
||
#: tfrmoptionsfonts.lblviewerfont.caption
|
||
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
|
||
msgid "&Viewer font"
|
||
msgstr "Γραμματοσειρά Προβολέα"
|
||
|
||
#: tfrmoptionshotkeys.actaddhotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
|
||
msgid "Add &hotkey"
|
||
msgstr "Προσθήκη ειδικού πλήκτρου"
|
||
|
||
#: tfrmoptionshotkeys.actcopy.caption
|
||
msgctxt "tfrmoptionshotkeys.actcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmoptionshotkeys.actdelete.caption
|
||
msgctxt "tfrmoptionshotkeys.actdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
|
||
msgid "&Delete hotkey"
|
||
msgstr "Διαγραφή ειδικού πλήκτρου"
|
||
|
||
#: tfrmoptionshotkeys.actedithotkey.caption
|
||
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
|
||
msgid "&Edit hotkey"
|
||
msgstr "Ρύθμιση ειδικού πλήκτρου"
|
||
|
||
#: tfrmoptionshotkeys.actnextcategory.caption
|
||
msgid "Next category"
|
||
msgstr "Επόμενη Κατηγορία"
|
||
|
||
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
||
msgid "Make popup the file related menu"
|
||
msgstr "Δημιουργία αναδυόμενου μενού για το σχετικό αρχείο"
|
||
|
||
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
||
msgid "Previous category"
|
||
msgstr "Προηγούμενη Κατηγορία"
|
||
|
||
#: tfrmoptionshotkeys.actrename.caption
|
||
msgctxt "tfrmoptionshotkeys.actrename.caption"
|
||
msgid "Rename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: tfrmoptionshotkeys.actrestoredefault.caption
|
||
msgid "Restore DC default"
|
||
msgstr "Αποκατάσταση των προκαθορισμένων ρυθμίσεων του DC"
|
||
|
||
#: tfrmoptionshotkeys.actsavenow.caption
|
||
msgid "Save now"
|
||
msgstr "Αποθήκευση τώρα"
|
||
|
||
#: tfrmoptionshotkeys.actsortbycommand.caption
|
||
msgid "Sort by command name"
|
||
msgstr "Ταξινόμηση κατά Όνομα Εντολής"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
||
msgid "Sort by hotkeys (grouped)"
|
||
msgstr "Ταξινόμηση κατά ειδικά πλήκτρα (ομαδοποιημένα)"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
||
msgid "Sort by hotkeys (one per row)"
|
||
msgstr "Ταξινόμηση κατά ειδικά πλήκτρα (ένα σε κάθε σειρά)"
|
||
|
||
#: tfrmoptionshotkeys.lbfilter.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
|
||
msgid "&Filter"
|
||
msgstr "Φίλτρο"
|
||
|
||
#: tfrmoptionshotkeys.lblcategories.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION"
|
||
msgid "C&ategories:"
|
||
msgstr "Κατηγορίες:"
|
||
|
||
#: tfrmoptionshotkeys.lblcommands.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION"
|
||
msgid "Co&mmands:"
|
||
msgstr "Εντολες:"
|
||
|
||
#: tfrmoptionshotkeys.lblscfiles.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
|
||
msgid "&Shortcut files:"
|
||
msgstr "Αρχεία συντομεύσεων:"
|
||
|
||
#: tfrmoptionshotkeys.lblsortorder.caption
|
||
msgid "So&rt order:"
|
||
msgstr "Σειρά κατάταξης:"
|
||
|
||
#: tfrmoptionshotkeys.micategories.caption
|
||
msgid "Categories"
|
||
msgstr "Κατηγορίες:"
|
||
|
||
#: tfrmoptionshotkeys.micommands.caption
|
||
msgctxt "tfrmoptionshotkeys.micommands.caption"
|
||
msgid "Command"
|
||
msgstr "Εντολή"
|
||
|
||
#: tfrmoptionshotkeys.miseparator1.caption
|
||
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionshotkeys.misortorder.caption
|
||
msgid "Sort order"
|
||
msgstr "Σειρά κατάταξης"
|
||
|
||
#: tfrmoptionsicons.cbiconsexclude.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Για τις ακόλουθες διαδρομές και τους υποκαταλόγους τους:"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenus.caption
|
||
msgid "Show icons for actions in &menus"
|
||
msgstr "Εμφάνιση εικονιδίων για ενέργειες στα μενού"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenussize.text
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
||
msgid "Show icons on buttons"
|
||
msgstr "Εμφάνιση εικονιδίων στα κουμπιά"
|
||
|
||
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
|
||
msgid "Show o&verlay icons, e.g. for links"
|
||
msgstr "Εμφάνιση εικονιδίων επίστρωσης, π.χ. για δεσμούς"
|
||
|
||
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
||
msgid "Disable special icons"
|
||
msgstr "Απενεργοποίηση ειδικών εικονιδίων"
|
||
|
||
#: tfrmoptionsicons.gbiconssize.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
|
||
msgid " Icon size "
|
||
msgstr "Μέγεθος Εικονοδίου"
|
||
|
||
#: tfrmoptionsicons.gbicontheme.caption
|
||
msgid "Icon theme"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.gbshowicons.caption
|
||
msgid "Show icons"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.gbshowiconsmode.caption
|
||
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
|
||
msgid " Show icons to the left of the filename "
|
||
msgstr "Εμφάνιση εικονιδίων αριστερά από το όνομα αρχείου"
|
||
|
||
#: tfrmoptionsicons.lbldiskpanel.caption
|
||
msgid "Disk panel:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.lblfilepanel.caption
|
||
msgid "File panel:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.rbiconsshowall.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
||
msgid "A&ll"
|
||
msgstr "Όλα"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
|
||
msgid "All associated + &EXE/LNK (slow)"
|
||
msgstr "Όλα τα σχετιζόμενα + &EXE/LNK (αργό)"
|
||
|
||
#: tfrmoptionsicons.rbiconsshownone.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
|
||
msgid "&No icons"
|
||
msgstr "Χωρίς Εικονίδια"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
||
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
|
||
msgid "Only &standard icons"
|
||
msgstr "Μόνο προκαθορισμένα εικονίδια"
|
||
|
||
#: tfrmoptionsignorelist.btnaddsel.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
|
||
msgid "A&dd selected names"
|
||
msgstr "Προσθήκη επιλεγμένων ονομάτων"
|
||
|
||
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
|
||
msgid "Add selected names with &full path"
|
||
msgstr "Προσθήκη επιλεγμένων ονομάτων με τη πλήρη διαδρομή"
|
||
|
||
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmoptionsignorelist.chkignoreenable.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
|
||
msgid "&Ignore (don't show) the following files and folders:"
|
||
msgstr "Αγνόηση (να μην γίνει εμφάνιση) των ακόλουθων αρχείων και φακέλων:"
|
||
|
||
#: tfrmoptionsignorelist.lblsavein.caption
|
||
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
|
||
msgid "&Save in:"
|
||
msgstr "Αποθήκευση στο:"
|
||
|
||
#: tfrmoptionskeyboard.cblynxlike.caption
|
||
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
||
msgstr "Αριστερά, Δεξιά βέλη αλλάζουν κατάλογο (κίνηση όπως στο Lynx)"
|
||
|
||
#: tfrmoptionskeyboard.gbtyping.caption
|
||
msgid "Typing"
|
||
msgstr "Πληκτρολόγηση"
|
||
|
||
#: tfrmoptionskeyboard.lblalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
|
||
msgid "Alt+L&etters:"
|
||
msgstr "Alt+Γράμματα:"
|
||
|
||
#: tfrmoptionskeyboard.lblctrlalt.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
|
||
msgid "Ctrl+Alt+Le&tters:"
|
||
msgstr "Ctrl+Alt+Γράμματα:"
|
||
|
||
#: tfrmoptionskeyboard.lblnomodifier.caption
|
||
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
|
||
msgid "&Letters:"
|
||
msgstr "Γράμματα:"
|
||
|
||
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
|
||
msgid "&Flat buttons"
|
||
msgstr "Επίπεδα Κουμπιά"
|
||
|
||
#: tfrmoptionslayout.cbflatinterface.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
|
||
msgid "Flat i&nterface"
|
||
msgstr "Επίπεδο Περιβάλλον"
|
||
|
||
#: tfrmoptionslayout.cbflattoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
|
||
msgid "Flat b&uttons"
|
||
msgstr "Επίπεδα Κουμπιά"
|
||
|
||
#: tfrmoptionslayout.cbfreespaceind.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
|
||
msgid "Show fr&ee space indicator on drive label"
|
||
msgstr "Εμφάνιση ένδειξης ελεύθερου χώρου στην ετικέτα τόμου"
|
||
|
||
#: tfrmoptionslayout.cblogwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
|
||
msgid "Show lo&g window"
|
||
msgstr "Εμφάνιση παραθύρου καταγραφών"
|
||
|
||
#: tfrmoptionslayout.cbpanelofoperations.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
|
||
msgid "Show panel of operation in background"
|
||
msgstr "Εμφάνιση πάνελ που πραγματοποιείται η εργασία στο παρασκήνιο"
|
||
|
||
#: tfrmoptionslayout.cbproginmenubar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
|
||
msgid "Show common progress in menu bar"
|
||
msgstr "Εμφάνιση απλής προόδου στη μπάρα μενού"
|
||
|
||
#: tfrmoptionslayout.cbshowcmdline.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
|
||
msgid "Show command l&ine"
|
||
msgstr "Εμφάνιση γραμμής εντολών"
|
||
|
||
#: tfrmoptionslayout.cbshowcurdir.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
|
||
msgid "Show current director&y"
|
||
msgstr "Εμφάνιση τρέχοντος καταλόγου"
|
||
|
||
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
|
||
msgid "Show &drive buttons"
|
||
msgstr "Εμφάνιση κουμπιών οδηγών"
|
||
|
||
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
|
||
msgid "Show free s&pace label"
|
||
msgstr "Εμφάνιση ετικέτας ελεύθερου χώρου"
|
||
|
||
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
||
msgid "Show drives list bu&tton"
|
||
msgstr "Εμφάνιση κουμπιού λίστας οδηγών"
|
||
|
||
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
|
||
msgid "Show function &key buttons"
|
||
msgstr "Εμφάνιση κουμπιών πλήκτρων λειτουργίας"
|
||
|
||
#: tfrmoptionslayout.cbshowmainmenu.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
|
||
msgid "Show &main menu"
|
||
msgstr "Εμφάνιση κυρίως μενού"
|
||
|
||
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
|
||
msgid "Show tool&bar"
|
||
msgstr "Εμφάνιση σειράς εργαλείων"
|
||
|
||
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
||
msgid "Show short free space &label"
|
||
msgstr "Εμφάνιση ταξινόμησης ετικέτας ελεύθερου χώρου"
|
||
|
||
#: tfrmoptionslayout.cbshowstatusbar.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
|
||
msgid "Show &status bar"
|
||
msgstr "Εμφάνιση μπάρας κατάστασης"
|
||
|
||
#: tfrmoptionslayout.cbshowtabheader.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
|
||
msgid "S&how tabstop header"
|
||
msgstr "Εμφάνιση επικεφαλίδας του tabstop"
|
||
|
||
#: tfrmoptionslayout.cbshowtabs.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
|
||
msgid "Sho&w folder tabs"
|
||
msgstr "Εμφάνιση καρτελών φακέλων"
|
||
|
||
#: tfrmoptionslayout.cbtermwindow.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
|
||
msgid "Show te&rminal window"
|
||
msgstr "Εμφάνιση παραθύρου τερματικού"
|
||
|
||
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
|
||
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
||
msgstr "Εμφάνιση δύο σειρών κουμπιών οδηγών (σταθερό πλάτος, πάνω από το παράθυρο αρχείων)"
|
||
|
||
#: tfrmoptionslayout.gbscreenlayout.caption
|
||
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
|
||
msgid " Screen layout "
|
||
msgstr "Διάταξη Οθόνης"
|
||
|
||
#: tfrmoptionslog.btnrelativelogfile.hint
|
||
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmoptionslog.btnviewlogfile.hint
|
||
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Προβολή περιεχομένων αρχείου καταγραφής"
|
||
|
||
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
||
msgid "Include date in log filename"
|
||
msgstr "Να συμπεριληφθεί ημερομηνία στο αρχείο καταγραφής του ονόματος αρχείου"
|
||
|
||
#: tfrmoptionslog.cblogarcop.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
|
||
msgid "&Pack/Unpack"
|
||
msgstr "Πακετάρισμα/Ξεπακετάρισμα"
|
||
|
||
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
||
msgid "External command line execution"
|
||
msgstr "Εκτέλεση εξωτερικής γραμμής εντολών"
|
||
|
||
#: tfrmoptionslog.cblogcpmvln.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
|
||
msgid "Cop&y/Move/Create link/symlink"
|
||
msgstr "Αντιγραφή/Μετακίνηση/Δημιουργία δεσμού/συμβολοδεσμού"
|
||
|
||
#: tfrmoptionslog.cblogdelete.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmoptionslog.cblogdirop.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
|
||
msgid "Crea&te/Delete directories"
|
||
msgstr "Δημιουργία/Διαγραφή καταλόγων"
|
||
|
||
#: tfrmoptionslog.cblogerrors.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
|
||
msgid "Log &errors"
|
||
msgstr "Καταγραφή λαθών"
|
||
|
||
#: tfrmoptionslog.cblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
|
||
msgid "C&reate a log file:"
|
||
msgstr "Δημιουργία ενός αρχείου καταγραφής:"
|
||
|
||
#: tfrmoptionslog.cbloginfo.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
|
||
msgid "Log &information messages"
|
||
msgstr "Καταγραφή των μηνυμάτων πληροφοριών"
|
||
|
||
#: tfrmoptionslog.cblogstartshutdown.caption
|
||
msgid "Start/shutdown"
|
||
msgstr "Εκκίνηση/τερματισμός"
|
||
|
||
#: tfrmoptionslog.cblogsuccess.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
|
||
msgid "Log &successful operations"
|
||
msgstr "Καταγραφή των επιτυχημένων εργασιών"
|
||
|
||
#: tfrmoptionslog.cblogvfs.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
|
||
msgid "&File system plugins"
|
||
msgstr "Πρόσθετα Αρχείων Συστήματος"
|
||
|
||
#: tfrmoptionslog.gblogfile.caption
|
||
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
|
||
msgid "File operation log file"
|
||
msgstr "Αρχείο καταγραφής εργασίας αρχείου"
|
||
|
||
#: tfrmoptionslog.gblogfileop.caption
|
||
msgid "Log operations"
|
||
msgstr "Εργασίες Καταγραφής"
|
||
|
||
#: tfrmoptionslog.gblogfilestatus.caption
|
||
msgid "Operation status"
|
||
msgstr "Κατάσταση Λειτουργίας"
|
||
|
||
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
||
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
||
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
||
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
||
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
||
msgid "&Remove thumbnails for no longer existing files"
|
||
msgstr "Αφαίρεση μικρογραφιών για τα αρχεία που δεν υπάρχουν πλέον"
|
||
|
||
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
||
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
|
||
msgid "View log file content"
|
||
msgstr "Προβολή περιεχομένων αρχείου καταγραφής"
|
||
|
||
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
||
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
|
||
msgid "Create new with the encoding:"
|
||
msgstr "Δημιουργία νέου με κωδικοποίηση:"
|
||
|
||
#: tfrmoptionsmisc.chkgotoroot.caption
|
||
msgid "Always &go to the root of a drive when changing drives"
|
||
msgstr "Πάντα μετάβαση στη ρίζα ενός οδηγού όταν γίνεται αλλαγή οδηγών"
|
||
|
||
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
||
msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION"
|
||
msgid "Show &warning messages (\"OK\" button only)"
|
||
msgstr "Εμφάνιση προειδοποιητικών μηνυμάτων (\"OK\" κουμπί μόνο)"
|
||
|
||
#: tfrmoptionsmisc.chkthumbsave.caption
|
||
msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION"
|
||
msgid "&Save thumbnails in cache"
|
||
msgstr "Αποθήκευση μικρογραφιών στο κασέ"
|
||
|
||
#: tfrmoptionsmisc.dblthumbnails.caption
|
||
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
|
||
msgid "Thumbnails"
|
||
msgstr "Μικρογραφίες"
|
||
|
||
#: tfrmoptionsmisc.gbfilecomments.caption
|
||
msgid "File comments (descript.ion)"
|
||
msgstr "Περιγραφή Αρχείου (descript.ion)"
|
||
|
||
#: tfrmoptionsmisc.gbtcexportimport.caption
|
||
msgid "Regarding TC export/import:"
|
||
msgstr "Όπως στον TC εισαγωγή/εξαγωγή:"
|
||
|
||
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
||
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
|
||
msgid "Default encoding:"
|
||
msgstr "Προκαθορισμένη Κωδικοποίηση:"
|
||
|
||
#: tfrmoptionsmisc.lbltcconfig.caption
|
||
msgid "Configuration file:"
|
||
msgstr "Αρχείο Διαμόρφωσης:"
|
||
|
||
#: tfrmoptionsmisc.lbltcexecutable.caption
|
||
msgid "TC executable:"
|
||
msgstr "Εκτελέσιμο του TC:"
|
||
|
||
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
||
msgid "Toolbar output path:"
|
||
msgstr "Διαδρομή εξόδου γραμμής εργαλείων:"
|
||
|
||
#: tfrmoptionsmisc.lblthumbpixels.caption
|
||
msgid "pixels"
|
||
msgstr "πίξελ"
|
||
|
||
#: tfrmoptionsmisc.lblthumbseparator.caption
|
||
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmoptionsmisc.lblthumbsize.caption
|
||
msgid "&Thumbnail size:"
|
||
msgstr "Μέγεθος Μικρογραφίας:"
|
||
|
||
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
||
msgid "&Selection by mouse"
|
||
msgstr "Επιλογή με ποντίκι"
|
||
|
||
#: tfrmoptionsmouse.gbscrolling.caption
|
||
msgid "Scrolling"
|
||
msgstr "Κύλιση"
|
||
|
||
#: tfrmoptionsmouse.gbselection.caption
|
||
msgid "Selection"
|
||
msgstr "Επιλογή"
|
||
|
||
#: tfrmoptionsmouse.lblmousemode.caption
|
||
msgid "&Mode:"
|
||
msgstr "Λειτουργία:"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
||
msgid "&Line by line"
|
||
msgstr "Γραμμή προς Γραμμή"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
||
msgid "Line by line &with cursor movement"
|
||
msgstr "Γραμμή προς Γραμμή με την κίνηση του κέρσορα"
|
||
|
||
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
||
msgid "&Page by page"
|
||
msgstr "Σελίδα προς Σελίδα"
|
||
|
||
#: tfrmoptionsplugins.btnaddplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmoptionsplugins.btnconfigplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "Διαμορφώστε"
|
||
|
||
#: tfrmoptionsplugins.btnenableplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
|
||
msgid "E&nable"
|
||
msgstr "Ενεργοποίηση"
|
||
|
||
#: tfrmoptionsplugins.btnremoveplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Αφαίρεση"
|
||
|
||
#: tfrmoptionsplugins.btntweakplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
|
||
msgid "&Tweak"
|
||
msgstr "Τροποποίηση"
|
||
|
||
#: tfrmoptionsplugins.lbldsxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
|
||
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
||
msgstr "Τα πρόσθετα αναζήτησης επιτρέπουν τη χρήση εναλλακτικών αλγορίθμων αναζήτησης ή εξωτερικά εργαλεία (όπως \"locate\", κ.λ.π.)"
|
||
|
||
#: tfrmoptionsplugins.lblwcxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
|
||
msgid "Pack&er plugins are used to work with archives"
|
||
msgstr "Πρόσθετα πακεταρίσματος χρησιμοποιούνται για εργασίες με τις αρχειοθήκες"
|
||
|
||
#: tfrmoptionsplugins.lblwdxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
|
||
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
||
msgstr "Τα πρόσθετα περιεχομένου επιτρέπουν την εμφάνιση επιπλέον λεπτομερειών του αρχείου όπως mp3 tags ή ιδιότητες εικόνας στις λίστες αρχείων, ή χρήση τους στην αναζήτηση και στο εργαλείο μετονομασίας πολλών"
|
||
|
||
#: tfrmoptionsplugins.lblwfxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
|
||
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
||
msgstr "Τα πρόσθετα αρχείων συστήματος επιτρέπουν την πρόσβαση σε δίσκους μη προσβάσιμους από το λειτουργικό σύστημα ή σε εξωτερικές συσκευές όπως το Palm/PocketPC."
|
||
|
||
#: tfrmoptionsplugins.lblwlxdescription.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
|
||
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
||
msgstr "Τα πρόσθετα προβολέα επιτρέπουν την εμφάνιση τύπων αρχείων όπως εικόνες, υπολογιστικά φύλλα, βάσεις δεδομένων κ.λ.π στον Προβολέα (F3, Ctrl+Q)"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
|
||
msgid "Active"
|
||
msgstr "Ενεργό"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "Πρόσθετο"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
|
||
msgid "Registered for"
|
||
msgstr "Έχει καταχωρηθεί στους"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ονομασία αρχείου"
|
||
|
||
#: tfrmoptionsplugins.tsdsx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
|
||
msgid "&Search plugins (.DSX)"
|
||
msgstr "Αναζήτηση προσθέτων (.DSX)"
|
||
|
||
#: tfrmoptionsplugins.tswcx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
|
||
msgid "Pac&ker plugins (.WCX)"
|
||
msgstr "Πρόσθετα Πακεταρίσματος (.WCX)"
|
||
|
||
#: tfrmoptionsplugins.tswdx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
|
||
msgid "Content pl&ugins (.WDX)"
|
||
msgstr "Πρόσθετα περιεχομένου (.WDX)"
|
||
|
||
#: tfrmoptionsplugins.tswfx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
|
||
msgid "F&ile system plugins (.WFX)"
|
||
msgstr "Πρόσθετα συστήματος Αρχείων (.WFX)"
|
||
|
||
#: tfrmoptionsplugins.tswlx.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
|
||
msgid "&Viewer plugins (.WLX)"
|
||
msgstr "Πρόσθετα Προβολέα (.WLX)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
|
||
msgid "&Beginning (name must start with first typed character)"
|
||
msgstr "Αρχή (το όνομα πρέπει να αρχίζει με τον πρώτο πληκτρολογημένο χαρακτήρα)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
|
||
msgid "En&ding (last character before a typed dot . must match)"
|
||
msgstr "Κατάληξη (ο τελευταίος χαρακτήρας πριν από πληκτρολογημένη τελεία . πρέπει να ταιριάζει)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Επιλογές"
|
||
|
||
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
||
msgid "Exact name match"
|
||
msgstr "Ακριβής Ταύτιση Ονόματος"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
||
msgid "Search case"
|
||
msgstr "Αναζήτηση Κεφαλαίων"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
||
msgid "Search for these items"
|
||
msgstr "Αναζήτηση για αυτά τα αντικείμενα"
|
||
|
||
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
||
msgid "Keep renamed name when unlocking a tab"
|
||
msgstr "Διατήρηση μετονομασμένου ονόματος όταν ξεκλειδώνεται μια καρτέλα"
|
||
|
||
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
|
||
msgid "Activate target &panel when clicking on one of its Tabs"
|
||
msgstr "ενεργοποίηση πάνελ στόχου όταν γίνεται κλικ σε μία από τις Καρτέλες του"
|
||
|
||
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
|
||
msgid "&Show tab header also when there is only one tab"
|
||
msgstr "Εμφάνιση επικεφαλίδας καρτέλας ακόμη και όταν υπάρχει μόνο μία καρτέλα"
|
||
|
||
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
||
msgid "Close duplicate tabs when closing application"
|
||
msgstr "Κλείσιμο διπλασιασμένων καρτελών όταν κλείσει η εφαρμογή"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
|
||
msgid "Con&firm close all tabs"
|
||
msgstr "Επιβεβαίωση κλεισίματος όλων των καρτελών"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
||
msgid "Confirm close locked tabs"
|
||
msgstr "Επιβεβαίωση κλεισίματος κλειδωμένων καρτελών"
|
||
|
||
#: tfrmoptionstabs.cbtabslimitoption.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
|
||
msgid "&Limit tab title length to"
|
||
msgstr "Ορισμός μήκους τίτλου καρτέλας σε"
|
||
|
||
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
|
||
msgid "Show locked tabs &with an asterisk *"
|
||
msgstr "Εμφάνιση κλειδωμένων καρτελών με έναν αστερίσκο *"
|
||
|
||
#: tfrmoptionstabs.cbtabsmultilines.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
|
||
msgid "&Tabs on multiple lines"
|
||
msgstr "Καρτέλες σε πολλαπλές γραμμές"
|
||
|
||
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
|
||
msgid "Ctrl+&Up opens new tab in foreground"
|
||
msgstr "Ctrl+&Up ανοίγουν νέα καρτέλα στο προσκήνιο"
|
||
|
||
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
|
||
msgid "Open &new tabs near current tab"
|
||
msgstr "Άνοιγμα νέων καρτελών δίπλα στην τρέχουσα καρτέλα"
|
||
|
||
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
||
msgid "Reuse existing tab when possible"
|
||
msgstr "Επαναχρησιμοποίηση υπάρχουσας καρτέλας όταν αυτό είναι δυνατό"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
||
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
|
||
msgid "Show ta&b close button"
|
||
msgstr "Εμφάνιση κουμπιού κλεισίματος καρτελών"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
||
msgid "Always show drive letter in tab title"
|
||
msgstr "Εμφάνιση πάντοτε γράμματος οδηγού στον τίτλο καρτέλας"
|
||
|
||
#: tfrmoptionstabs.gbtabs.caption
|
||
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
|
||
msgid "Folder tabs headers"
|
||
msgstr "Επικεφαλίδες Καρτελών Φακέλων"
|
||
|
||
#: tfrmoptionstabs.lblchar.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
|
||
msgid "characters"
|
||
msgstr "χαρακτήρες"
|
||
|
||
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
||
msgid "Action to do when double click on a tab:"
|
||
msgstr "Ενέργεια που θα εκτελεστεί όταν γίνει διπλό κλικ σε μια καρτέλα:"
|
||
|
||
#: tfrmoptionstabs.lbltabsposition.caption
|
||
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
|
||
msgid "Ta&bs position"
|
||
msgstr "Θέση Καρτελών"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "Κανένα"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Όχι"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
||
msgid "Left"
|
||
msgstr "Αριστερά"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
||
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
||
msgid "Right"
|
||
msgstr "Δεξιά"
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after resaving"
|
||
msgstr "Μετάβαση στη Διαμόρφωση Αγαπημένων Καρτελών μετά την επαναποθήκευση"
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
||
msgstr "Μετάβαση στη Διαμόρφωση Αγαπημένων Καρτελών μετά την αποθήκευση μίας νέας"
|
||
|
||
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
||
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
||
msgstr "Ενεργοποίηση επιπλέον ιδιοτήτων Αγαπημένων Καρτελών (επιλογή πλευρά στόχου όταν γίνεται αποκατάσταση, κ.λ.π.)"
|
||
|
||
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
||
msgid "Default extra settings when saving new Favorite Tabs:"
|
||
msgstr "Προκαθορισμένες επιπλέον ιδιότητες όταν αποθηκεύεται νέα Αγαπημένη Καρτέλα:"
|
||
|
||
#: tfrmoptionstabsextra.gbtabs.caption
|
||
msgid "Folder tabs headers extra"
|
||
msgstr "Έξτρα Επικεφαλίδων Καρτελών Φακέλων"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
||
msgid "When restoring tab, existing tabs to keep:"
|
||
msgstr "όταν αποκαθίσταται καρτέλα, υπάρχουσες καρτέλες προς φύλαξη:"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
||
msgid "Tabs saved on left will be restored to:"
|
||
msgstr "Καρτέλες αποθηκευμένες αριστερά να αποκατασταθούν σε :"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
||
msgid "Tabs saved on right will be restored to:"
|
||
msgstr "Καρτέλες αποθηκευμένες δεξιά να αποκατασταθούν σε :"
|
||
|
||
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
||
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "Διατήρηση αποθήκευσης ιστορικού καταλόγου με Αγαπημένες Καρτέλες:"
|
||
|
||
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
||
msgid "Default position in menu when saving a new Favorite Tabs:"
|
||
msgstr "Προκαθορισμένη θέση στο μενού όταν αποθηκεύεται μια νέα Αγαπημένη Καρτέλα:"
|
||
|
||
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "{command} θα έπρεπε να είναι παρούσα εδώ για να προσδιορίσει την εντολή που θα εκτελεστεί στο τερματικό"
|
||
|
||
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
||
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "{command} θα έπρεπε να είναι παρούσα εδώ για να προσδιορίσει την εντολή που θα εκτελεστεί στο τερματικό"
|
||
|
||
#: tfrmoptionsterminal.edruntermparams.hint
|
||
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "{command} θα έπρεπε να είναι παρούσα εδώ για να προσδιορίσει την εντολή που θα εκτελεστεί στο τερματικό"
|
||
|
||
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
||
msgid "Command for just running terminal:"
|
||
msgstr "Εντολή για εκτέλεση μόνο του τερματικού:"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
||
msgid "Command for running a command in terminal and close after:"
|
||
msgstr "Εντολή για εκτέλεση μιας εντολής στο τερματικό και κλείσιμό του μετά απ'αυτό:"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
||
msgid "Command for running a command in terminal and stay open:"
|
||
msgstr "Εντολή για εκτέλεση μιας εντολής στο τερματικό και παραμονή του ανοικτό :"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Εντολή:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Παράμετροι:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Εντολή:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Παράμετροι:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermcmd.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
|
||
msgid "Command:"
|
||
msgstr "Εντολή:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermparams.caption
|
||
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
|
||
msgid "Parameters:"
|
||
msgstr "Παράμετροι:"
|
||
|
||
#: tfrmoptionstoolbar.btnclonebutton.caption
|
||
msgid "C&lone button"
|
||
msgstr "Κουμπί κλωνοποίησης"
|
||
|
||
#: tfrmoptionstoolbar.btndeletebutton.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmoptionstoolbar.btnedithotkey.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION"
|
||
msgid "Edit hot&key"
|
||
msgstr "Ρύθμιση ειδικού πλήκτρου"
|
||
|
||
#: tfrmoptionstoolbar.btninsertbutton.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION"
|
||
msgid "&Insert new button"
|
||
msgstr "Εισαγωγή νέου κουμπιού"
|
||
|
||
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
||
msgid "Select"
|
||
msgstr "Επιλέξτε"
|
||
|
||
#: tfrmoptionstoolbar.btnopenfile.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnother.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNOTHER.CAPTION"
|
||
msgid "Other..."
|
||
msgstr "Άλλα..."
|
||
|
||
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION"
|
||
msgid "Remove hotke&y"
|
||
msgstr "Αφαίρεση ειδικού πλήκτρου"
|
||
|
||
#: tfrmoptionstoolbar.btnstartpath.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
||
msgid "Suggest"
|
||
msgstr "Πρόταση"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
||
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
||
msgstr "Πρόταση από τον DC υπόδειξης βασισμένης στον τύπο κουμπιού, εντολής και παραμέτρων"
|
||
|
||
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
||
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
||
msgid "&Flat buttons"
|
||
msgstr "Επίπεδα Κουμπιά"
|
||
|
||
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
||
msgid "Report errors with commands"
|
||
msgstr "Αναφορά λαθών με εντολές"
|
||
|
||
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
||
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
||
msgstr "Εισαγωγή παραμέτρων εντολής, καθεμία σε ξεχωριστή γραμμή. Πιέστε F1 για βοήθεια στις παραμέτρους."
|
||
|
||
#: tfrmoptionstoolbar.gbgroupbox.caption
|
||
msgid "Appearance"
|
||
msgstr "Εμφάνιση"
|
||
|
||
#: tfrmoptionstoolbar.lblbarsize.caption
|
||
msgid "&Bar size:"
|
||
msgstr "Μέγεθος Μπάρας:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION"
|
||
msgid "Comman&d:"
|
||
msgstr "Εντολή:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
|
||
msgid "Parameter&s:"
|
||
msgstr "Παράμετροι:"
|
||
|
||
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION"
|
||
msgid "Help"
|
||
msgstr "Βοήθεια"
|
||
|
||
#: tfrmoptionstoolbar.lblhotkey.caption
|
||
msgid "Hot key:"
|
||
msgstr "Ειδικό Πλήκτρο:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconfile.caption
|
||
msgid "Ico&n:"
|
||
msgstr "Εικονίδιο:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconsize.caption
|
||
msgid "Icon si&ze:"
|
||
msgstr "Μέγεθος εικόνας:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
|
||
msgid "Co&mmand:"
|
||
msgstr "Εντολή:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
||
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
|
||
msgid "&Parameters:"
|
||
msgstr "Παράμετροι:"
|
||
|
||
#: tfrmoptionstoolbar.lblstartpath.caption
|
||
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "Διαδρομή Εκκίνησης:"
|
||
|
||
#: tfrmoptionstoolbar.lbltooltip.caption
|
||
msgid "&Tooltip:"
|
||
msgstr "Υπόδειξη:"
|
||
|
||
#: tfrmoptionstoolbar.miaddallcmds.caption
|
||
msgid "Add toolbar with ALL DC commands"
|
||
msgstr "Προσθήκη γραμμής εργαλείων με ΟΛΕΣ τις DC εντολές"
|
||
|
||
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
||
msgid "for an external command"
|
||
msgstr "για μία εξωτερική εντολή"
|
||
|
||
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
||
msgid "for an internal command"
|
||
msgstr "για μία εσωτερική εντολή"
|
||
|
||
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
||
msgid "for a separator"
|
||
msgstr "για ένα διαχωριστικό"
|
||
|
||
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
||
msgid "for a sub-tool bar"
|
||
msgstr "για μια υπο-σειρά εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.mibackup.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION"
|
||
msgid "Backup..."
|
||
msgstr "Αντίγραφο Ασφαλείας..."
|
||
|
||
#: tfrmoptionstoolbar.miexport.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION"
|
||
msgid "Export..."
|
||
msgstr "Εξαγωγή..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrent.caption
|
||
msgid "Current toolbar..."
|
||
msgstr "Τρέχουσα γραμμή εργαλείων..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "σε ένα αρχείο Γραμμής Εργαλείων (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "σε ένα TC .BAR αρχείο (διατήρηση υπάρχοντος)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "σε ένα TC .BAR αρχείο (διαγραφή υπάρχοντος)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "σε ένα \"wincmd.ini\" του TC (διατήρηση υπάρχοντος)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "σε ένα \"wincmd.ini\" του TC (διαγραφή υπάρχοντος)"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator1.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator2.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator3.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator4.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexporttop.caption
|
||
msgid "Top toolbar..."
|
||
msgstr "Γραμμή Εργαλείων κορυφής..."
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
||
msgid "Save a backup of Toolbar"
|
||
msgstr "Αποθήκευση ενός αντιγράφου ασφαλείας της Γραμμής Εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "σε ένα αρχείο Γραμμής Εργαλείων (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "σε ένα TC .BAR αρχείο (διατήρηση υπάρχοντος)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "σε ένα TC .BAR αρχείο (διαγραφή υπάρχοντος)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "σε ένα \"wincmd.ini\" του TC (διατήρηση υπάρχοντος)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "σε ένα \"wincmd.ini\" του TC (διαγραφή υπάρχοντος)"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
|
||
msgid "just after current selection"
|
||
msgstr "Αμέσως μετά την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
|
||
msgid "as first element"
|
||
msgstr "ως πρώτο στοιχείο"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
|
||
msgid "as last element"
|
||
msgstr "ως τελευταίο στοιχείο"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
|
||
msgid "just prior current selection"
|
||
msgstr "Αμέσως πριν την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstoolbar.miimport.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION"
|
||
msgid "Import..."
|
||
msgstr "Εισάγετε..."
|
||
|
||
#: tfrmoptionstoolbar.miimportbackup.caption
|
||
msgid "Restore a backup of Toolbar"
|
||
msgstr "Επαναφορά ενός αντιγράφου ασφαλείας της Σειράς Εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
|
||
msgid "to add to current toolbar"
|
||
msgstr "για προσθήκη στη τρέχουσα σειρά εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "προσθήκη νέας γραμμής εργαλείων στη τρέχουσα γραμμή εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "προσθήκη νέας γραμμής εργαλείων στη γραμμή εργαλείων που είναι στη κορυφή"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
|
||
msgid "to add to top toolbar"
|
||
msgstr "για προσθήκη στη σειρά εργαλείων της κορυφής"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
|
||
msgid "to replace top toolbar"
|
||
msgstr "για αντικατάσταση της σειράς εργαλείων της κορυφής"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbar.caption
|
||
msgid "from a Toolbar File (.toolbar)"
|
||
msgstr "Από ένα Αρχείο Γραμμής Εργαλείων (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "για προσθήκη στη τρέχουσα σειρά εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "προσθήκη νέας γραμμής εργαλείων στη τρέχουσα γραμμή εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "προσθήκη νέας γραμμής εργαλείων στη γραμμή εργαλείων που είναι στη κορυφή"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "για προσθήκη στη σειρά εργαλείων της κορυφής"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "για αντικατάσταση της σειράς εργαλείων της κορυφής"
|
||
|
||
#: tfrmoptionstoolbar.miimportseparator.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbar.caption
|
||
msgid "from a single TC .BAR file"
|
||
msgstr "Από ένα απλό TC .BAR αρχείο"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
|
||
msgid "to add to current toolbar"
|
||
msgstr "για προσθήκη στη τρέχουσα σειρά εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "προσθήκη νέας γραμμής εργαλείων στη τρέχουσα γραμμή εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "προσθήκη νέας γραμμής εργαλείων στη γραμμή εργαλείων που είναι στη κορυφή"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
|
||
msgid "to add to top toolbar"
|
||
msgstr "για προσθήκη στη σειρά εργαλείων της κορυφής"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION"
|
||
msgid "to replace top toolbar"
|
||
msgstr "για αντικατάσταση της σειράς εργαλείων της κορυφής"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcini.caption
|
||
msgid "from \"wincmd.ini\" of TC..."
|
||
msgstr "Από \"wincmd.ini\" του TC..."
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
|
||
msgid "to add to current toolbar"
|
||
msgstr "για προσθήκη στη τρέχουσα σειρά εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "προσθήκη νέας γραμμής εργαλείων στην τρέχουσα γραμμή εργαλείων"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "προσθήκη νέας γραμμής εργαλείων στη γραμμή εργαλείων που είναι στη κορυφή"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
|
||
msgid "to add to top toolbar"
|
||
msgstr "για προσθήκη στη σειρά εργαλείων της κορυφής"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
|
||
msgid "to replace top toolbar"
|
||
msgstr "για αντικατάσταση της σειράς εργαλείων της κορυφής"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
|
||
msgid "just after current selection"
|
||
msgstr "Αμέσως μετά την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
|
||
msgid "as first element"
|
||
msgstr "ως πρώτο στοιχείο"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
|
||
msgid "as last element"
|
||
msgstr "ως τελευταίο στοιχείο"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
|
||
msgid "just prior current selection"
|
||
msgstr "Αμέσως πριν την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstoolbar.misearchandreplace.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION"
|
||
msgid "Search and replace..."
|
||
msgstr "Αναζήτηση και αντικατάσταση..."
|
||
|
||
#: tfrmoptionstoolbar.miseparator1.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator10.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator11.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator13.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator14.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator2.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator6.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator7.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator8.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator9.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "Αμέσως μετά την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
||
msgid "as first element"
|
||
msgstr "ως πρώτο στοιχείο"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "ως τελευταίο στοιχείο"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "Αμέσως πριν την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
||
msgid "in all of all the above..."
|
||
msgstr "σε όλα τα ανωτέρω..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
||
msgid "in all commands..."
|
||
msgstr "σε όλες τις εντολές..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
||
msgid "in all icon names..."
|
||
msgstr "σε όλα τα ονόματα εικονιδίων..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
||
msgid "in all parameters..."
|
||
msgstr "σε όλες τις παραμέτρους..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
||
msgid "in all start path..."
|
||
msgstr "σε όλες τις διαδρομές εκκίνησης...."
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
|
||
msgid "just after current selection"
|
||
msgstr "Αμέσως μετά την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
|
||
msgid "as first element"
|
||
msgstr "ως πρώτο στοιχείο"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
|
||
msgid "as last element"
|
||
msgstr "ως τελευταίο στοιχείο"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
|
||
msgid "just prior current selection"
|
||
msgstr "Αμέσως πριν την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
||
msgid "Button type"
|
||
msgstr "Τύπος Κουμπιού"
|
||
|
||
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
||
msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
||
msgid "&Keep terminal window open after executing program"
|
||
msgstr "Διατήρηση παραθύρου τερματικού ανοικτό μετά την εκτέλεση του προγράμματος"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
||
msgid "&Execute in terminal"
|
||
msgstr "Εκτέλεση σε τερματικό"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
||
msgid "&Use external program"
|
||
msgstr "Χρήση εξωτερικού προγράμματος"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
||
msgid "A&dditional parameters"
|
||
msgstr "Επιπρόσθετες παράμετροι"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolspath.caption
|
||
msgid "&Path to program to execute"
|
||
msgstr "Διαδρομή προγράμματος προς εκτέλεση"
|
||
|
||
#: tfrmoptionstooltips.btnaddfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "Προσθήκη"
|
||
|
||
#: tfrmoptionstooltips.btnapplyfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "Εφαρμογή"
|
||
|
||
#: tfrmoptionstooltips.btndeletefields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmoptionstooltips.btnfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Πρότυπο..."
|
||
|
||
#: tfrmoptionstooltips.chkshowtooltip.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.CHKSHOWTOOLTIP.CAPTION"
|
||
msgid "&Show tooltip for files in the file panel"
|
||
msgstr "Εμφάνιση υπόδειξης για αρχεία στο πάνελ αρχείων"
|
||
|
||
#: tfrmoptionstooltips.gbcustomfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
|
||
msgid "Custom fields by file type"
|
||
msgstr "Εξατομικευμένα πεδία κατά τύπο αρχείου"
|
||
|
||
#: tfrmoptionstooltips.lblfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
|
||
msgid "Category &hint:"
|
||
msgstr "Συμβουλή Κατηγορίας:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsmask.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "Μάσκα Κατηγορίας:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsname.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "Όνομα Κατηγορίας:"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
||
msgid "With double-click on the bar on top of a file panel"
|
||
msgstr "Με διπλό κλικ στην κορυφή πάνω από το πάνελ Αρχείου"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr "Με το μενού και εσωτερική εντολή"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
||
msgid "Double click in tree select and exit"
|
||
msgstr "Διπλό κλικ σε επιλογή Δέντρου και έξοδος"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr "Με το μενού και εσωτερική εντολή"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
||
msgid "With double-click on a tab (if configured for it)"
|
||
msgstr "Με διπλό κλικ σε μια Καρτέλα (αν έχει οριστεί έτσι)"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
||
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
||
msgstr "Όταν γίνεται χρήση της συντόμευσης πληκτρολογίου, θα γίνει έξοδος από το παράθυρο επιστρέφοντας την τρέχουσα επιλογή"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
||
msgid "Single mouse click in tree select and exit"
|
||
msgstr "Απλό κλικ του ποντικιού σε επιλογή δέντρου και έξοδος"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
||
msgid "Use it for Command Line History"
|
||
msgstr "Χρήση στο Ιστορικό Γραμμής Εντολών"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
||
msgid "Use it for the Dir History"
|
||
msgstr "Χρήση στο Ιστορικό Καταλόγου"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
||
msgid "Use it for the View History (Visited paths for active view)"
|
||
msgstr "Χρήση στο Ιστορικό Προβολής (προβεβλημένες διαδρομές για την ενεργή προβολή)"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
||
msgid "Behavior regarding selection:"
|
||
msgstr "Συμπεριφορά που αφορά την Επιλογή:"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
||
msgid "Tree View Menus related options:"
|
||
msgstr "Επιλογές σχετικές με τα Μενού Προβολής Δέντρου:"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
||
msgid "Where to use Tree View Menus:"
|
||
msgstr "Που θα γίνει χρήση Μενού Προβολής Δέντρου:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblnote.caption
|
||
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
||
msgstr "*ΣΗΜΕΙΩΣΗ: Όσον αφορά ρυθμίσεις όπως τη διάκριση πεζών-κεφαλαίων, αγνόηση τονισμού ή όχι, αυτές αποθηκεύονται ξεχωριστά για το κάθε περιεχόμενο από τη μια χρήση και περίοδο λειτουργίας στην άλλη."
|
||
|
||
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
||
msgid "With Directory Hotlist:"
|
||
msgstr "Με Hotlist Καταλόγου:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
||
msgid "With Favorite Tabs:"
|
||
msgstr "Με Αγαπημένες Καρτέλες:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
||
msgid "With History:"
|
||
msgstr "Με Ιστορικό:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
||
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
||
msgid "Use and display keyboard shortcut for choosing items"
|
||
msgstr "Χρήση και Προβολή συντόμευσης πληκτρολογίου για την επιλογή αντικειμένων"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
||
msgid "Layout and colors options:"
|
||
msgstr "Διάταξη και Επιλογές Χρωμάτων:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
||
msgid "Background color:"
|
||
msgstr "Χρώμα Παρασκηνίου:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
||
msgid "Cursor color:"
|
||
msgstr "Χρώμα Κέρσορα:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
||
msgid "Found text color:"
|
||
msgstr "Χρώμα Ευρεθέντος Κειμένου:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
||
msgid "Found text under cursor:"
|
||
msgstr "Ευρεθέν Κείμενο κάτω από τον κέρσορα:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
||
msgid "Normal text color:"
|
||
msgstr "Χρώμα Κανονικού Κειμένου:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
||
msgid "Normal text under cursor:"
|
||
msgstr "Κανονικό Κείμενο κάτω από τον κέρσορα:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
||
msgid "Tree View Menu Preview:"
|
||
msgstr "Προεπισκόπηση Μενού Προβολής Δέντρου:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
||
msgid "Secondary text color:"
|
||
msgstr "Χρώμα δευτερεύοντος κειμένου:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
||
msgid "Secondary text under cursor:"
|
||
msgstr "Δευτερεύον κείμενο κάτω από τον κέρσορα:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
||
msgid "Shortcut color:"
|
||
msgstr "Χρώμα συντόμευσης:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
||
msgid "Shortcut under cursor:"
|
||
msgstr "Συντόμευση κάτω από τον κέρσορα:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
||
msgid "Unselectable text color:"
|
||
msgstr "Χρώμα μη επιλέξιμου κειμένου:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
||
msgid "Unselectable under cursor:"
|
||
msgstr "Μη επιλέξιμο κάτω από τον κέρσορα:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
||
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
||
msgstr "Κάντε αλλαγή χρώματος στα αριστερά και θα εμφανιστεί εδώ μια Προεπισκόπηση του πως θα εμφανίζονται τα Μενού Προβολής Δέντρου με αυτό το δείγμα."
|
||
|
||
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
||
msgid "Viewer Book Mode"
|
||
msgstr "Λειτουργία Προβολέα Βιβλίων"
|
||
|
||
#: tfrmoptionsviewer.gbviewerexample.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
|
||
msgid "Example"
|
||
msgstr "Παράδειγμα"
|
||
|
||
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
||
msgid "&Background color in book viewer"
|
||
msgstr "Χρώμα παρασκηνίου στον προβολέα βιβλίων"
|
||
|
||
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
||
msgid "&Font color in book viewer"
|
||
msgstr "Χρώμα Γραμματοσειράς στον προβολέα βιβλίων"
|
||
|
||
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
||
msgid "&Number of columns in book viewer"
|
||
msgstr "Αριθμός στηλών στον προβολέα βιβλίων"
|
||
|
||
#: tfrmpackdlg.btnconfig.caption
|
||
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "Διαμόρφωση"
|
||
|
||
#: tfrmpackdlg.caption
|
||
msgctxt "TFRMPACKDLG.CAPTION"
|
||
msgid "Pack files"
|
||
msgstr "Πακετάρισμα αρχείων"
|
||
|
||
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
||
msgid "C&reate separate archives, one per selected file/dir"
|
||
msgstr "Δημιουργία ξεχωριστών αρχειοθηκών, μια για κάθε ξεχωριστό αρχείο/κατάλογο"
|
||
|
||
#: tfrmpackdlg.cbcreatesfx.caption
|
||
msgid "Create self e&xtracting archive"
|
||
msgstr "Δημιουργία αυτο-εξαγώμενης αρχειοθήκης"
|
||
|
||
#: tfrmpackdlg.cbencrypt.caption
|
||
msgid "Encr&ypt"
|
||
msgstr "Κρυπτογράφηση"
|
||
|
||
#: tfrmpackdlg.cbmovetoarchive.caption
|
||
msgid "Mo&ve to archive"
|
||
msgstr "Μετακίνηση στην αρχειοθήκη"
|
||
|
||
#: tfrmpackdlg.cbmultivolume.caption
|
||
msgid "&Multiple disk archive"
|
||
msgstr "Πολλαπλή αρχειοθήκη δίσκου"
|
||
|
||
#: tfrmpackdlg.cbotherplugins.caption
|
||
msgid "=>"
|
||
msgstr "=>"
|
||
|
||
#: tfrmpackdlg.cbputintarfirst.caption
|
||
msgid "P&ut in the TAR archive first"
|
||
msgstr "Τοποθέτηση πρώτο στην TAR αρχειοθήκη"
|
||
|
||
#: tfrmpackdlg.cbstoredir.caption
|
||
msgid "Also &pack path names (only recursed)"
|
||
msgstr "Επίσης πακετάρισμα διαδρομών ονομάτων (μόνο των αναδρομικών)"
|
||
|
||
#: tfrmpackdlg.lblprompt.caption
|
||
msgid "Pack file(s) to the file:"
|
||
msgstr "Πακετάρισμα αρχείου(ων) στο αρχείο:"
|
||
|
||
#: tfrmpackdlg.rgpacker.caption
|
||
msgid "Packer"
|
||
msgstr "Εφαρμογή Πακεταρίσματος"
|
||
|
||
#: tfrmpackinfodlg.btnclose.caption
|
||
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
||
msgid "Unpack &all and execute"
|
||
msgstr "Ξεπακετάρισμα όλων και εκτέλεση"
|
||
|
||
#: tfrmpackinfodlg.btnunpackandexec.caption
|
||
msgid "&Unpack and execute"
|
||
msgstr "Ξεπακετάρισμα και εκτέλεση"
|
||
|
||
#: tfrmpackinfodlg.caption
|
||
msgctxt "TFRMPACKINFODLG.CAPTION"
|
||
msgid "Properties of packed file"
|
||
msgstr "Ιδιότητες πακεταρισμένου αρχείου"
|
||
|
||
#: tfrmpackinfodlg.lblattributes.caption
|
||
msgid "Attributes:"
|
||
msgstr "Ιδιότητες:"
|
||
|
||
#: tfrmpackinfodlg.lblcompressionratio.caption
|
||
msgid "Compression ratio:"
|
||
msgstr "Αναλογία Συμπίεσης:"
|
||
|
||
#: tfrmpackinfodlg.lbldate.caption
|
||
msgid "Date:"
|
||
msgstr "Ημερομηνία:"
|
||
|
||
#: tfrmpackinfodlg.lblmethod.caption
|
||
msgid "Method:"
|
||
msgstr "Μέθοδος:"
|
||
|
||
#: tfrmpackinfodlg.lbloriginalsize.caption
|
||
msgid "Original size:"
|
||
msgstr "Αυθεντικό μέγεθος:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedfile.caption
|
||
msgid "File:"
|
||
msgstr "Αρχείο:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedsize.caption
|
||
msgid "Packed size:"
|
||
msgstr "Μέγεθος πακεταρισμένου:"
|
||
|
||
#: tfrmpackinfodlg.lblpacker.caption
|
||
msgid "Packer:"
|
||
msgstr "Εφαρμογή Πακεταρίσματος:"
|
||
|
||
#: tfrmpackinfodlg.lbltime.caption
|
||
msgid "Time:"
|
||
msgstr "Χρόνος:"
|
||
|
||
#: tfrmquicksearch.btncancel.caption
|
||
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmquicksearch.btncancel.hint
|
||
msgid "Close filter panel"
|
||
msgstr "Κλείσιμο πάνελ φίλτρου"
|
||
|
||
#: tfrmquicksearch.edtsearch.hint
|
||
msgid "Enter text to search for or filter by"
|
||
msgstr "Εισάγετε κείμενο για αναζήτηση ή εφαρμόστε φίλτρο για"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.caption
|
||
msgid "Aa"
|
||
msgstr "Αα"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.hint
|
||
msgid "Case Sensitive"
|
||
msgstr "Διάκριση Πεζών-Κεφαλαίων"
|
||
|
||
#: tfrmquicksearch.sbdirectories.caption
|
||
msgid "D"
|
||
msgstr "Κ"
|
||
|
||
#: tfrmquicksearch.sbdirectories.hint
|
||
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
||
msgid "Directories"
|
||
msgstr "Κατάλογοι"
|
||
|
||
#: tfrmquicksearch.sbfiles.caption
|
||
msgid "F"
|
||
msgstr "Α"
|
||
|
||
#: tfrmquicksearch.sbfiles.hint
|
||
msgctxt "tfrmquicksearch.sbfiles.hint"
|
||
msgid "Files"
|
||
msgstr "Αρχεία"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.caption
|
||
msgid "{"
|
||
msgstr "{"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.hint
|
||
msgid "Match Beginning"
|
||
msgstr "Αντιστοίχηση που Αρχίζει"
|
||
|
||
#: tfrmquicksearch.sbmatchending.caption
|
||
msgid "}"
|
||
msgstr "}"
|
||
|
||
#: tfrmquicksearch.sbmatchending.hint
|
||
msgid "Match Ending"
|
||
msgstr "Αντιστοίχηση που Τελειώνει"
|
||
|
||
#: tfrmquicksearch.tglfilter.caption
|
||
msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION"
|
||
msgid "Filter"
|
||
msgstr "Φίλτρο"
|
||
|
||
#: tfrmquicksearch.tglfilter.hint
|
||
msgid "Toggle between search or filter"
|
||
msgstr "Εναλλαγή μεταξύ αναζήτησης και φίλτρου"
|
||
|
||
#: tfrmsearchplugin.btnadd.caption
|
||
msgid "&More rules"
|
||
msgstr "Περισσότεροι κανόνες"
|
||
|
||
#: tfrmsearchplugin.btndelete.caption
|
||
msgid "L&ess rules"
|
||
msgstr "Λιγότεροι κανόνες"
|
||
|
||
#: tfrmsearchplugin.chkuseplugins.caption
|
||
msgid "Use &content plugins, combine with:"
|
||
msgstr "Χρήση προσθέτων περιεχομένου, συνδυασμός με:"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[0].text
|
||
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
|
||
msgid "Plugin"
|
||
msgstr "Πρόσθετο"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[1].text
|
||
msgid "Field"
|
||
msgstr "Πεδίο"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[2].text
|
||
msgid "Operator"
|
||
msgstr "Χειριστής"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[3].text
|
||
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[3].TEXT"
|
||
msgid "Value"
|
||
msgstr "Τιμή"
|
||
|
||
#: tfrmsearchplugin.rband.caption
|
||
msgid "&AND (all match)"
|
||
msgstr "ΚΑΙ (όσα ταιριάζουν)"
|
||
|
||
#: tfrmsearchplugin.rbor.caption
|
||
msgid "&OR (any match)"
|
||
msgstr "Ή (όποιο ταιριάζει)"
|
||
|
||
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmselecttextrange.btppanel.closebutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Βοήθεια"
|
||
|
||
#: tfrmselecttextrange.btppanel.okbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmselecttextrange.lblselecttext.caption
|
||
msgid "&Select the characters to insert:"
|
||
msgstr "Επιλέξτε τους χαρακτήρες για εισαγωγή:"
|
||
|
||
#: tfrmsetfileproperties.btncancel.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmsetfileproperties.btnok.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmsetfileproperties.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
|
||
msgid "Change attributes"
|
||
msgstr "Αλλαγή Ιδιοτήτων"
|
||
|
||
#: tfrmsetfileproperties.cbsgid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmsetfileproperties.cbsticky.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Κολημμένα"
|
||
|
||
#: tfrmsetfileproperties.cbsuid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmsetfileproperties.chkarchive.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
|
||
msgid "Archive"
|
||
msgstr "Αρχειοθήκη"
|
||
|
||
#: tfrmsetfileproperties.chkcreationtime.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
|
||
msgid "Created:"
|
||
msgstr "Δημιουργήθηκε:"
|
||
|
||
#: tfrmsetfileproperties.chkhidden.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
|
||
msgid "Hidden"
|
||
msgstr "Κρυφό"
|
||
|
||
#: tfrmsetfileproperties.chklastaccesstime.caption
|
||
msgid "Accessed:"
|
||
msgstr "Προσπελάστηκε:"
|
||
|
||
#: tfrmsetfileproperties.chklastwritetime.caption
|
||
msgid "Modified:"
|
||
msgstr "Τροποποιήθηκε:"
|
||
|
||
#: tfrmsetfileproperties.chkreadonly.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
|
||
msgid "Read only"
|
||
msgstr "Μόνο για Ανάγνωση"
|
||
|
||
#: tfrmsetfileproperties.chkrecursive.caption
|
||
msgid "Including subfolders"
|
||
msgstr "Συμπεριβαλομένων των υποφακέλων"
|
||
|
||
#: tfrmsetfileproperties.chksystem.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
|
||
msgid "System"
|
||
msgstr "Σύστημα"
|
||
|
||
#: tfrmsetfileproperties.gbtimesamp.caption
|
||
msgid "Timestamp properties"
|
||
msgstr "Ιδιότητες χρόνου τελευταίας πρόσβασης"
|
||
|
||
#: tfrmsetfileproperties.gbunixattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Ιδιότητες"
|
||
|
||
#: tfrmsetfileproperties.gbwinattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Ιδιότητες"
|
||
|
||
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Bits:"
|
||
|
||
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Γκρουπ"
|
||
|
||
#: tfrmsetfileproperties.lblattrinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(γκρι πεδίο σημαίνει τιμή χωρίς αλλαγή)"
|
||
|
||
#: tfrmsetfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Άλλα"
|
||
|
||
#: tfrmsetfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Ιδιοκτήτης"
|
||
|
||
#: tfrmsetfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmsetfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Κείμενο:"
|
||
|
||
#: tfrmsetfileproperties.lblexec.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Εκτέλεση"
|
||
|
||
#: tfrmsetfileproperties.lblmodeinfo.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(γκρι πεδίο σημαίνει τιμή χωρίς αλλαγή)"
|
||
|
||
#: tfrmsetfileproperties.lbloctal.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Octal:"
|
||
|
||
#: tfrmsetfileproperties.lblread.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Ανάγνωση"
|
||
|
||
#: tfrmsetfileproperties.lblwrite.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Εγγραφή"
|
||
|
||
#: tfrmsplitter.btncancel.caption
|
||
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmsplitter.btnftchoice.caption
|
||
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmsplitter.btnok.caption
|
||
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: tfrmsplitter.btnrelativeftchoice.hint
|
||
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης διαδρομής"
|
||
|
||
#: tfrmsplitter.caption
|
||
msgctxt "TFRMSPLITTER.CAPTION"
|
||
msgid "Splitter"
|
||
msgstr "Διαχωριστής"
|
||
|
||
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
||
msgid "Require a CRC32 verification file"
|
||
msgstr "Απαιτεί ένα αρχείο επιβεβαίωσης CRC32"
|
||
|
||
#: tfrmsplitter.cmbxsize.text
|
||
msgid "1457664B - 3.5\""
|
||
msgstr "1457664B - 3.5\""
|
||
|
||
#: tfrmsplitter.grbxfile.caption
|
||
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ονομασία αρχείου"
|
||
|
||
#: tfrmsplitter.grbxsize.caption
|
||
msgid "Size and number of parts"
|
||
msgstr "Μέγεθος και αριθμητικό πλήθος των τμημάτων"
|
||
|
||
#: tfrmsplitter.lbdirtarget.caption
|
||
msgid "Directory &target"
|
||
msgstr "Στόχος Καταλόγου"
|
||
|
||
#: tfrmsplitter.lbfilesource.caption
|
||
msgid "File &source"
|
||
msgstr "Πηγή Αρχείου"
|
||
|
||
#: tfrmsplitter.lblnumberparts.caption
|
||
msgid "&Number of parts"
|
||
msgstr "Αριθμός τμημάτων"
|
||
|
||
#: tfrmsplitter.rbtnbyte.caption
|
||
msgid "&Bytes"
|
||
msgstr "&Bytes"
|
||
|
||
#: tfrmsplitter.rbtngigab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
|
||
msgid "&Gigabytes"
|
||
msgstr "&Gigabytes"
|
||
|
||
#: tfrmsplitter.rbtnkilob.caption
|
||
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
|
||
msgid "&Kilobytes"
|
||
msgstr "&Kilobytes"
|
||
|
||
#: tfrmsplitter.rbtnmegab.caption
|
||
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
|
||
msgid "&Megabytes"
|
||
msgstr "&Megabytes"
|
||
|
||
#: tfrmstartingsplash.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblbuild.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
|
||
msgid "Build"
|
||
msgstr "Εσωτερική Έκδοση"
|
||
|
||
#: tfrmstartingsplash.lblfreepascalver.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmstartingsplash.lbllazarusver.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmstartingsplash.lbloperatingsystem.caption
|
||
msgid "Operating System"
|
||
msgstr "Λειτουργικό Σύστημα"
|
||
|
||
#: tfrmstartingsplash.lblplatform.caption
|
||
msgid "Platform"
|
||
msgstr "Σύστημα"
|
||
|
||
#: tfrmstartingsplash.lblrevision.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
|
||
msgid "Revision"
|
||
msgstr "Αναθεωρημένη Έκδοση"
|
||
|
||
#: tfrmstartingsplash.lbltitle.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblversion.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
|
||
msgid "Version"
|
||
msgstr "Έκδοση"
|
||
|
||
#: tfrmstartingsplash.lblwidgetsetver.caption
|
||
msgid "WidgetsetVer"
|
||
msgstr "WidgetsetVer"
|
||
|
||
#: tfrmsymlink.btncancel.caption
|
||
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmsymlink.btnok.caption
|
||
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmsymlink.caption
|
||
msgid "Create symbolic link"
|
||
msgstr "Δημιουργία συμβολοδεσμού"
|
||
|
||
#: tfrmsymlink.lblexistingfile.caption
|
||
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "Προορισμός τον οποίο θα υποδείξει ο δεσμός"
|
||
|
||
#: tfrmsymlink.lbllinktocreate.caption
|
||
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "Όνομα Δεσμού"
|
||
|
||
#: tfrmsyncdirsdlg.btnclose.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
|
||
msgid "Close"
|
||
msgstr "Κλείσιμο"
|
||
|
||
#: tfrmsyncdirsdlg.btncompare.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Σύγκριση"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir1.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir2.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Συγχρονισμός"
|
||
|
||
#: tfrmsyncdirsdlg.caption
|
||
msgid "Synchronize directories"
|
||
msgstr "Συγχρονισμός καταλόγων"
|
||
|
||
#: tfrmsyncdirsdlg.cbextfilter.text
|
||
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
||
msgid "asymmetric"
|
||
msgstr "Ασύμμετρο"
|
||
|
||
#: tfrmsyncdirsdlg.chkbycontent.caption
|
||
msgid "by content"
|
||
msgstr "Ανά περιεχόμενο"
|
||
|
||
#: tfrmsyncdirsdlg.chkignoredate.caption
|
||
msgid "ignore date"
|
||
msgstr "αγνόηση ημερομηνίας"
|
||
|
||
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
||
msgid "only selected"
|
||
msgstr "Μόνο το(α) επιλεγμένο(α)"
|
||
|
||
#: tfrmsyncdirsdlg.chksubdirs.caption
|
||
msgid "Subdirs"
|
||
msgstr "Υποκατάλογοι"
|
||
|
||
#: tfrmsyncdirsdlg.groupbox1.caption
|
||
msgid "Show:"
|
||
msgstr "Εμφάνιση:"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Όνομα"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
|
||
msgid "Size"
|
||
msgstr "Μέγεθος "
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
|
||
msgid "Date"
|
||
msgstr "Ημερομηνία"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
||
msgid "<=>"
|
||
msgstr "<=>"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
|
||
msgid "Date"
|
||
msgstr "Ημερομηνία"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
|
||
msgid "Size"
|
||
msgstr "Μέγεθος "
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
||
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
|
||
msgid "Name"
|
||
msgstr "Όνομα"
|
||
|
||
#: tfrmsyncdirsdlg.label1.caption
|
||
msgid "(in main window)"
|
||
msgstr "(στο κύριο παράθυρο)"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Σύγκριση"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
||
msgid "View left"
|
||
msgstr "Προβολή Αριστερά"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
||
msgid "View right"
|
||
msgstr "Προβολή Δεξιά"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyright.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmsyncdirsdlg.sbduplicates.caption
|
||
msgid "duplicates"
|
||
msgstr "Διπλότυπα"
|
||
|
||
#: tfrmsyncdirsdlg.sbequal.caption
|
||
msgid "="
|
||
msgstr "="
|
||
|
||
#: tfrmsyncdirsdlg.sbnotequal.caption
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: tfrmsyncdirsdlg.sbsingles.caption
|
||
msgid "singles"
|
||
msgstr "Μονά"
|
||
|
||
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
||
msgid "Please press \"Compare\" to start"
|
||
msgstr "Παρακαλώ πιέστε \"Σύγκριση\" για εκκίνηση"
|
||
|
||
#: tfrmsyncdirsperformdlg.caption
|
||
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
|
||
msgid "Synchronize"
|
||
msgstr "Συγχρονισμός"
|
||
|
||
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
||
msgid "Confirm overwrites"
|
||
msgstr "Επιβεβαίωση αντικαταστημένων"
|
||
|
||
#: tfrmtreeviewmenu.caption
|
||
msgctxt "tfrmtreeviewmenu.caption"
|
||
msgid "Tree View Menu"
|
||
msgstr "Μενού Προβολής Δέντρου"
|
||
|
||
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
||
msgid "Select your hot directory:"
|
||
msgstr "Επιλογή Hot Directory:"
|
||
|
||
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
||
msgid "Search is case sensitive"
|
||
msgstr "Η Αναζήτηση γίνεται με διάκριση πεζών-κεφαλαίων"
|
||
|
||
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
||
msgid "Full collapse"
|
||
msgstr "Πλήρη Σύμπτυξη"
|
||
|
||
#: tfrmtreeviewmenu.pmifullexpand.caption
|
||
msgid "Full expand"
|
||
msgstr "Πλήρη Διεύρυνση"
|
||
|
||
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
||
msgid "Search ignore accents and ligatures"
|
||
msgstr "Αναζήτηση αγνόησης χρήσης τονισμού και διφθόγγων"
|
||
|
||
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
||
msgid "Search is not case sensitive"
|
||
msgstr "Η Αναζήτηση δεν είναι με διάκριση πεζών-κεφαλαίων"
|
||
|
||
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
||
msgid "Search is strict regarding accents and ligatures"
|
||
msgstr "Η Αναζήτηση αφορά αυστηρά και μόνο τονισμό και διφθόγγους"
|
||
|
||
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
||
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
||
msgstr "Απαγόρευση προβολής περιεχομένου κλάδου \"μόνο και μόνο\" επειδή η ζητούμενη ακολουθία βρέθηκε στο όνομα κλάδου"
|
||
|
||
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
||
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
||
msgstr "Αν η ζητούμενη ακολουθία βρέθηκε σε ένα όνομα κλάδου, προβολή όλου του κλάδου ακόμη και αν τα στοιχεία δεν ταιριάζουν"
|
||
|
||
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
||
msgid "Close Tree View Menu"
|
||
msgstr "Κλείσιμο Μενού Προβολής Δέντρου"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Ρύθμιση του Μενού Προβολής Δέντρου"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
||
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Ρύθμιση Χρωμάτων Μενού Προβολής Δέντρου"
|
||
|
||
#: tfrmtweakplugin.btnadd.caption
|
||
msgid "A&dd new"
|
||
msgstr "Προσθήκη νέου"
|
||
|
||
#: tfrmtweakplugin.btncancel.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: tfrmtweakplugin.btnchange.caption
|
||
msgid "C&hange"
|
||
msgstr "Αλλαγή"
|
||
|
||
#: tfrmtweakplugin.btndefault.caption
|
||
msgid "De&fault"
|
||
msgstr "Προκαθορισμένα"
|
||
|
||
#: tfrmtweakplugin.btnok.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: tfrmtweakplugin.btnremove.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "Αφαίρεση"
|
||
|
||
#: tfrmtweakplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
|
||
msgid "Tweak plugin"
|
||
msgstr "Επεξεργασία προσθέτου"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
||
msgid "De&tect archive type by content"
|
||
msgstr "Εντοπισμός τύπου αρχειοθήκης από τα περιεχόμενα"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
||
msgid "Can de&lete files"
|
||
msgstr "Δυνατότητα διαγραφής αρχείων"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
||
msgid "Supports e&ncryption"
|
||
msgstr "Υποστηρίζει Κρυπτογράφηση"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
||
msgid "Sho&w as normal files (hide packer icon)"
|
||
msgstr "Εμφάνιση ως κανονικά αρχεία (κρύψιμο εικονιδίου εφαρμογής πακεταρίσματος)"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
||
msgid "Supports pac&king in memory"
|
||
msgstr "Υποστήριξη πακεταρίσματος στη μνήμη"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
||
msgid "Can &modify existing archives"
|
||
msgstr "Δυνατότητα τροποποίησης υπάρχοντων αρχείων"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
||
msgid "&Archive can contain multiple files"
|
||
msgstr "Η Αρχειοθήκη μπορεί να περιλαμβάνει πολλαπλά αρχεία"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_new.caption
|
||
msgid "Can create new archi&ves"
|
||
msgstr "Δυνατότητα δημιουργίας νέων αρχείων"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_options.caption
|
||
msgid "S&upports the options dialogbox"
|
||
msgstr "Υποστηρίζει το πλαίσιο διαλόγου ρυθμίσεων"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
||
msgid "Allow searchin&g for text in archives"
|
||
msgstr "Επιτρέψτε αναζήτηση κειμένου στα αρχεία"
|
||
|
||
#: tfrmtweakplugin.lbldescription.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
|
||
msgid "&Description:"
|
||
msgstr "Περιγραφή:"
|
||
|
||
#: tfrmtweakplugin.lbldetectstr.caption
|
||
msgid "D&etect string:"
|
||
msgstr "Εντοπισμός ακολουθίας:"
|
||
|
||
#: tfrmtweakplugin.lblextension.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
|
||
msgid "&Extension:"
|
||
msgstr "Επέκταση:"
|
||
|
||
#: tfrmtweakplugin.lblflags.caption
|
||
msgid "Flags:"
|
||
msgstr "Σημαίες:"
|
||
|
||
#: tfrmtweakplugin.lblname.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
|
||
msgid "&Name:"
|
||
msgstr "Όνομα:"
|
||
|
||
#: tfrmtweakplugin.lblplugin.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "Πρόσθετο:"
|
||
|
||
#: tfrmtweakplugin.lblplugin1.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "Πρόσθετο:"
|
||
|
||
#: tfrmviewer.actabout.caption
|
||
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
|
||
msgid "About Viewer..."
|
||
msgstr "Σχετικά με τον Προβολέα..."
|
||
|
||
#: tfrmviewer.actabout.hint
|
||
msgid "Displays the About message"
|
||
msgstr "Εμφανίζει το \"Σχετικά\" μήνυμα"
|
||
|
||
#: tfrmviewer.actchangeencoding.caption
|
||
msgid "Change encoding"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actcopyfile.caption
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
||
msgid "Copy File"
|
||
msgstr "Αντιγραφή Αρχείου"
|
||
|
||
#: tfrmviewer.actcopyfile.hint
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
||
msgid "Copy File"
|
||
msgstr "Αντιγραφή Αρχείου"
|
||
|
||
#: tfrmviewer.actcopytoclipboard.caption
|
||
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
||
msgid "Copy To Clipboard"
|
||
msgstr "Αντιγραφή στο Πρόχειρο"
|
||
|
||
#: tfrmviewer.actcopytoclipboardformatted.caption
|
||
msgid "Copy To Clipboard Formatted"
|
||
msgstr "Αντιγραφή στο Πρόχειρο μετά από Διαμόρφωση"
|
||
|
||
#: tfrmviewer.actdeletefile.caption
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
||
msgid "Delete File"
|
||
msgstr "Διαγραφή Αρχείου"
|
||
|
||
#: tfrmviewer.actdeletefile.hint
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
||
msgid "Delete File"
|
||
msgstr "Διαγραφή Αρχείου"
|
||
|
||
#: tfrmviewer.actexitviewer.caption
|
||
msgctxt "tfrmviewer.actexitviewer.caption"
|
||
msgid "E&xit"
|
||
msgstr "Έξοδος"
|
||
|
||
#: tfrmviewer.actfind.caption
|
||
msgctxt "tfrmviewer.actfind.caption"
|
||
msgid "Find"
|
||
msgstr "Εύρεση"
|
||
|
||
#: tfrmviewer.actfindnext.caption
|
||
msgctxt "tfrmviewer.actfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Εύρεση επόμενου"
|
||
|
||
#: tfrmviewer.actfindprev.caption
|
||
msgctxt "tfrmviewer.actfindprev.caption"
|
||
msgid "Find previous"
|
||
msgstr "Εύρεση Προηγούμενου"
|
||
|
||
#: tfrmviewer.actfullscreen.caption
|
||
msgctxt "tfrmviewer.actfullscreen.caption"
|
||
msgid "Full Screen"
|
||
msgstr "Πλήρης Οθόνη"
|
||
|
||
#: tfrmviewer.actimagecenter.caption
|
||
msgctxt "tfrmviewer.actimagecenter.caption"
|
||
msgid "Center"
|
||
msgstr "Κέντρο"
|
||
|
||
#: tfrmviewer.actloadnextfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
|
||
msgid "&Next"
|
||
msgstr "Επόμενο"
|
||
|
||
#: tfrmviewer.actloadnextfile.hint
|
||
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT"
|
||
msgid "Load Next File"
|
||
msgstr "Φόρτωση Επόμενου Αρχείου"
|
||
|
||
#: tfrmviewer.actloadprevfile.caption
|
||
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
|
||
msgid "&Previous"
|
||
msgstr "Προηγούμενο"
|
||
|
||
#: tfrmviewer.actloadprevfile.hint
|
||
msgid "Load Previous File"
|
||
msgstr "Φόρτωση Προηγούμενου Αρχείου"
|
||
|
||
#: tfrmviewer.actmirrorhorz.caption
|
||
msgid "Mirror Horizontally"
|
||
msgstr "Αντικατοπτρισμός Οριζοντίως"
|
||
|
||
#: tfrmviewer.actmirrorhorz.hint
|
||
msgctxt "tfrmviewer.actmirrorhorz.hint"
|
||
msgid "Mirror"
|
||
msgstr "Καθρεφτισμός"
|
||
|
||
#: tfrmviewer.actmirrorvert.caption
|
||
msgid "Mirror Vertically"
|
||
msgstr "Αντικατοπτρισμός Καθέτως"
|
||
|
||
#: tfrmviewer.actmovefile.caption
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
||
msgid "Move File"
|
||
msgstr "Μετακίνηση Αρχείου"
|
||
|
||
#: tfrmviewer.actmovefile.hint
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
||
msgid "Move File"
|
||
msgstr "Μετακίνηση Αρχείου"
|
||
|
||
#: tfrmviewer.actpreview.caption
|
||
msgctxt "tfrmviewer.actpreview.caption"
|
||
msgid "Preview"
|
||
msgstr "Προεπισκόπηση"
|
||
|
||
#: tfrmviewer.actreload.caption
|
||
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
||
msgid "Reload"
|
||
msgstr "Επαναφόρτωση"
|
||
|
||
#: tfrmviewer.actreload.hint
|
||
msgid "Reload current file"
|
||
msgstr "Επαναφόρτωση τρέχοντος αρχείου"
|
||
|
||
#: tfrmviewer.actrotate180.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
|
||
msgid "+ 180"
|
||
msgstr "+ 180"
|
||
|
||
#: tfrmviewer.actrotate180.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
|
||
msgid "Rotate 180 degrees"
|
||
msgstr "Περιστροφή 180°"
|
||
|
||
#: tfrmviewer.actrotate270.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
|
||
msgid "- 90"
|
||
msgstr "- 90"
|
||
|
||
#: tfrmviewer.actrotate270.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
|
||
msgid "Rotate -90 degrees"
|
||
msgstr "Περιστροφή -90°"
|
||
|
||
#: tfrmviewer.actrotate90.caption
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
|
||
msgid "+ 90"
|
||
msgstr "+ 90"
|
||
|
||
#: tfrmviewer.actrotate90.hint
|
||
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
|
||
msgid "Rotate +90 degrees"
|
||
msgstr "Περιστροφή +90°"
|
||
|
||
#: tfrmviewer.actsave.caption
|
||
msgctxt "tfrmviewer.actsave.caption"
|
||
msgid "Save"
|
||
msgstr "Αποθήκευση "
|
||
|
||
#: tfrmviewer.actsaveas.caption
|
||
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
|
||
msgid "Save As..."
|
||
msgstr "Αποθήκευση Ως..."
|
||
|
||
#: tfrmviewer.actsaveas.hint
|
||
msgid "Save File As..."
|
||
msgstr "Αποθήκευση Αρχείου Ως..."
|
||
|
||
#: tfrmviewer.actscreenshot.caption
|
||
msgctxt "tfrmviewer.actscreenshot.caption"
|
||
msgid "Screenshot"
|
||
msgstr "Στιγμιότυπο Οθόνης"
|
||
|
||
#: tfrmviewer.actscreenshotdelay3sec.caption
|
||
msgid "Delay 3 sec"
|
||
msgstr "Καθυστέρηση 3 δευτερόλεπτα"
|
||
|
||
#: tfrmviewer.actscreenshotdelay5sec.caption
|
||
msgid "Delay 5 sec"
|
||
msgstr "Καθυστέρηση 5 δευτερόλεπτα"
|
||
|
||
#: tfrmviewer.actselectall.caption
|
||
msgctxt "tfrmviewer.actselectall.caption"
|
||
msgid "Select All"
|
||
msgstr "Επιλογή όλων"
|
||
|
||
#: tfrmviewer.actshowasbin.caption
|
||
msgctxt "tfrmviewer.actshowasbin.caption"
|
||
msgid "Show as &Bin"
|
||
msgstr "Εμφάνιση ως Δυαδικό"
|
||
|
||
#: tfrmviewer.actshowasbook.caption
|
||
msgctxt "tfrmviewer.actshowasbook.caption"
|
||
msgid "Show as B&ook"
|
||
msgstr "Εμφάνιση ως Βιβλίο"
|
||
|
||
#: tfrmviewer.actshowasdec.caption
|
||
msgid "Show as &Dec"
|
||
msgstr "Προβολής ως Δεκαδικό"
|
||
|
||
#: tfrmviewer.actshowashex.caption
|
||
msgctxt "tfrmviewer.actshowashex.caption"
|
||
msgid "Show as &Hex"
|
||
msgstr "Εμφάνιση ως Δεκαεξαδικό"
|
||
|
||
#: tfrmviewer.actshowastext.caption
|
||
msgctxt "tfrmviewer.actshowastext.caption"
|
||
msgid "Show as &Text"
|
||
msgstr "Εμφάνιση ως Κείμενο"
|
||
|
||
#: tfrmviewer.actshowaswraptext.caption
|
||
msgctxt "tfrmviewer.actshowaswraptext.caption"
|
||
msgid "Show as &Wrap text"
|
||
msgstr "Εμφάνιση ως Αναδιπλούμενο Κείμενο"
|
||
|
||
#: tfrmviewer.actshowgraphics.caption
|
||
msgctxt "tfrmviewer.actshowgraphics.caption"
|
||
msgid "Graphics"
|
||
msgstr "Γραφικά"
|
||
|
||
#: tfrmviewer.actshowplugins.caption
|
||
msgctxt "tfrmviewer.actshowplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Πρόσθετα"
|
||
|
||
#: tfrmviewer.actstretchimage.caption
|
||
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
|
||
msgid "Stretch"
|
||
msgstr "Άπλωμα"
|
||
|
||
#: tfrmviewer.actstretchimage.hint
|
||
msgid "Stretch Image"
|
||
msgstr "Άπλωμα Εικόνας"
|
||
|
||
#: tfrmviewer.actstretchonlylarge.caption
|
||
msgctxt "tfrmviewer.actstretchonlylarge.caption"
|
||
msgid "Stretch only large"
|
||
msgstr "Άπλωμα μόνο Μεγάλων"
|
||
|
||
#: tfrmviewer.actzoom.caption
|
||
msgid "Zoom"
|
||
msgstr "Μεγέθυνση"
|
||
|
||
#: tfrmviewer.actzoomin.caption
|
||
msgctxt "tfrmviewer.actzoomin.caption"
|
||
msgid "Zoom In"
|
||
msgstr "Μεγέθυνση"
|
||
|
||
#: tfrmviewer.actzoomout.caption
|
||
msgctxt "tfrmviewer.actzoomout.caption"
|
||
msgid "Zoom Out"
|
||
msgstr "Μίκρυνση"
|
||
|
||
#: tfrmviewer.btncopyfile.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmviewer.btncopyfile1.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
|
||
msgid "Copy"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: tfrmviewer.btncuttuimage.hint
|
||
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
|
||
msgid "Crop"
|
||
msgstr "Περικοπή"
|
||
|
||
#: tfrmviewer.btndeletefile.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmviewer.btndeletefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: tfrmviewer.btnfullscreen.hint
|
||
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
||
msgid "Full Screen"
|
||
msgstr "Πλήρης Οθόνη"
|
||
|
||
#: tfrmviewer.btngifmove.caption
|
||
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmviewer.btngiftobmp.caption
|
||
msgid "S"
|
||
msgstr "S"
|
||
|
||
#: tfrmviewer.btnhightlight.hint
|
||
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
||
msgid "Highlight"
|
||
msgstr "Υπογράμμιση"
|
||
|
||
#: tfrmviewer.btnmovefile.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
|
||
msgid "Move"
|
||
msgstr "Μετακίνηση"
|
||
|
||
#: tfrmviewer.btnmovefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
|
||
msgid "Move"
|
||
msgstr "Μετακίνηση"
|
||
|
||
#: tfrmviewer.btnnextgifframe.caption
|
||
msgid "||>"
|
||
msgstr "||>"
|
||
|
||
#: tfrmviewer.btnpaint.hint
|
||
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
||
msgid "Paint"
|
||
msgstr "Ζωγραφική"
|
||
|
||
#: tfrmviewer.btnprevgifframe.caption
|
||
msgid "<||"
|
||
msgstr "<||"
|
||
|
||
#: tfrmviewer.btnredeye.hint
|
||
msgid "Red Eyes"
|
||
msgstr "Κόκκινα Μάτια"
|
||
|
||
#: tfrmviewer.btnresize.hint
|
||
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
|
||
msgid "Resize"
|
||
msgstr "Αλλαγή Μεγέθους"
|
||
|
||
#: tfrmviewer.btnundo.hint
|
||
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Αναίρεση"
|
||
|
||
#: tfrmviewer.caption
|
||
msgctxt "TFRMVIEWER.CAPTION"
|
||
msgid "Viewer"
|
||
msgstr "Προβολέας"
|
||
|
||
#: tfrmviewer.cbslideshow.caption
|
||
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Slide Show"
|
||
|
||
#: tfrmviewer.comboboxpaint.text
|
||
msgid "Pen"
|
||
msgstr "Στυλό"
|
||
|
||
#: tfrmviewer.comboboxwidth.text
|
||
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmviewer.gboxhightlight.caption
|
||
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
||
msgid "Highlight"
|
||
msgstr "Υπογράμμιση"
|
||
|
||
#: tfrmviewer.gboxpaint.caption
|
||
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
||
msgid "Paint"
|
||
msgstr "Ζωγραφική"
|
||
|
||
#: tfrmviewer.gboxslideshow.caption
|
||
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Slide Show"
|
||
|
||
#: tfrmviewer.gboxview.caption
|
||
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Προβολή"
|
||
|
||
#: tfrmviewer.lblhightlight.caption
|
||
msgid "0x0"
|
||
msgstr "0x0"
|
||
|
||
#: tfrmviewer.miabout.caption
|
||
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "Σχετικά"
|
||
|
||
#: tfrmviewer.midiv1.caption
|
||
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv2.caption
|
||
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv3.caption
|
||
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv4.caption
|
||
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv5.caption
|
||
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miedit.caption
|
||
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: tfrmviewer.miencoding.caption
|
||
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Κωδικοποίηση"
|
||
|
||
#: tfrmviewer.mifile.caption
|
||
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "Αρχείο"
|
||
|
||
#: tfrmviewer.miimage.caption
|
||
msgid "&Image"
|
||
msgstr "Εικόνα"
|
||
|
||
#: tfrmviewer.miprint.caption
|
||
msgid "Print..."
|
||
msgstr "Εκτύπωση..."
|
||
|
||
#: tfrmviewer.mirotate.caption
|
||
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
|
||
msgid "Rotate"
|
||
msgstr "Περιστροφή"
|
||
|
||
#: tfrmviewer.miscreenshot.caption
|
||
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
||
msgid "Screenshot"
|
||
msgstr "Στιγμιότυπο Οθόνης"
|
||
|
||
#: tfrmviewer.miseparator.caption
|
||
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miview.caption
|
||
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
||
msgid "&View"
|
||
msgstr "Προβολή"
|
||
|
||
#: tfrmviewer.pmiselectall.caption
|
||
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Επιλογή όλων"
|
||
|
||
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Όταν το αρχείο υπάρχει"
|
||
|
||
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Όταν το αρχείο υπάρχει"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Αντιγραφή ημερομηνίας/ώρας"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
||
msgid "Work in background (separate connection)"
|
||
msgstr "Εργασία στο παρασκήνιο (ξεχωριστή σύνδεση)"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Όταν το αρχείο υπάρχει"
|
||
|
||
#: uexifreader.rsdatetimeoriginal
|
||
msgid "Date taken"
|
||
msgstr "Ημερομηνία πρόσληψης"
|
||
|
||
#: uexifreader.rsimageheight
|
||
msgctxt "uexifreader.rsimageheight"
|
||
msgid "Height"
|
||
msgstr "Ύψος"
|
||
|
||
#: uexifreader.rsimagewidth
|
||
msgctxt "uexifreader.rsimagewidth"
|
||
msgid "Width"
|
||
msgstr "Πλάτος"
|
||
|
||
#: uexifreader.rsmake
|
||
msgid "Manufacturer"
|
||
msgstr "Κατασκευαστής"
|
||
|
||
#: uexifreader.rsmodel
|
||
msgid "Camera model"
|
||
msgstr "Μοντέλο Κάμερας"
|
||
|
||
#: uexifreader.rsorientation
|
||
msgid "Orientation"
|
||
msgstr "Προσανατολισμός"
|
||
|
||
#: ulng.msgtrytolocatecrcfile
|
||
msgid ""
|
||
"This file cannot be found and could help to validate final combination of files:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Could you make it available and press \"OK\" when ready,\n"
|
||
"or press \"CANCEL\" to continue without it?\n"
|
||
msgstr ""
|
||
"Αυτό το αρχείο δε μπορεί να βρεθεί και αυτό θα μπορούσε να βοηθήσει στην επικύρωση του τελικού συνδυασμού αρχείων:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Θα μπορούσατε να το κάνετε διαθέσιμο πιέζοντας \"ΟΚ\"όταν είστε έτοιμοι,\n"
|
||
"ή πιέστε \"Ακύρωση\" για να συνεχίσετε χωρίς αυτό;\n"
|
||
|
||
#: ulng.rscancelfilter
|
||
msgid "Cancel Quick Filter"
|
||
msgstr "Ακύρωση Γρήγορου Φίλτρου"
|
||
|
||
#: ulng.rscanceloperation
|
||
msgid "Cancel Current Operation"
|
||
msgstr "Ακύρωση Τρέχουσας Λειτουργίας"
|
||
|
||
#: ulng.rscaptionforaskingfilename
|
||
msgid "Enter filename, with extension, for dropped text"
|
||
msgstr "Εισαγωγή ονόματος αρχείου, με επέκταση, για το εναποθετημένο κείμενο"
|
||
|
||
#: ulng.rscaptionfortextformattoimport
|
||
msgid "Text format to import"
|
||
msgstr "Τύπος Κειμένου προς εισαγωγή"
|
||
|
||
#: ulng.rschecksumverifybroken
|
||
msgid "Broken:"
|
||
msgstr "Κατεστραμμένο:"
|
||
|
||
#: ulng.rschecksumverifygeneral
|
||
msgid "General:"
|
||
msgstr "Γενικά:"
|
||
|
||
#: ulng.rschecksumverifymissing
|
||
msgid "Missing:"
|
||
msgstr "Λείπει:"
|
||
|
||
#: ulng.rschecksumverifyreaderror
|
||
msgid "Read error:"
|
||
msgstr "Λάθος Ανάγνωσης: "
|
||
|
||
#: ulng.rschecksumverifysuccess
|
||
msgid "Success:"
|
||
msgstr "Επιτυχία:"
|
||
|
||
#: ulng.rschecksumverifytext
|
||
msgid "Enter checksum and select algorithm:"
|
||
msgstr "Εισαγωγή αθροίσματος ελέγχου και επιλογή αλγόριθμου:"
|
||
|
||
#: ulng.rschecksumverifytitle
|
||
msgid "Verify checksum"
|
||
msgstr "Επιβεβαίωση αθροίσματος ελέγχου"
|
||
|
||
#: ulng.rschecksumverifytotal
|
||
msgid "Total:"
|
||
msgstr "Συνολικά:"
|
||
|
||
#: ulng.rsclearfiltersornot
|
||
msgid "Do you want to clear filters for this new search?"
|
||
msgstr "Επιθυμείτε το καθαρισμό φίλτρων για αυτή τη νέα αναζήτηση;"
|
||
|
||
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
||
msgid "Clipboard doesn't contain any valid toolbar data."
|
||
msgstr "Το Πρόχειρο δεν περιέχει κάποια έγκυρα δεδομένα γραμμής εργαλείων."
|
||
|
||
#: ulng.rscmdcategorylistinorder
|
||
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
||
msgstr "Όλα;Ενεργό Πάνελ;Αριστερό Πάνελ;Δεξιό Πάνελ;Εργασίες Αρχείου;Ρύθμιση;Δίκτυο;Διάφορα;Παράλληλη Πόρτα;Εκτύπωση;Επιλογέας;Ασφάλεια;Πρόχειρο;FTP;Πλοήγηση;Βοήθεια;Παράθυρο;Γραμμή Εντολών;Εργαλεία;Προβολή;Χρήστης;Καρτέλες;Διάταξη;Καταγραφή"
|
||
|
||
#: ulng.rscmdkindofsort
|
||
msgid "Legacy sorted;A-Z sorted"
|
||
msgstr "Ταξινόμηση της Legacy ;Α-Ω ταξινόμηση"
|
||
|
||
#: ulng.rscolattr
|
||
msgid "Attr"
|
||
msgstr "Ιδιότητα"
|
||
|
||
#: ulng.rscoldate
|
||
msgctxt "ulng.rscoldate"
|
||
msgid "Date"
|
||
msgstr "Ημερομηνία"
|
||
|
||
#: ulng.rscolext
|
||
msgid "Ext"
|
||
msgstr "Εξωτερικό"
|
||
|
||
#: ulng.rscolname
|
||
msgctxt "ulng.rscolname"
|
||
msgid "Name"
|
||
msgstr "Όνομα"
|
||
|
||
#: ulng.rscolsize
|
||
msgctxt "ulng.rscolsize"
|
||
msgid "Size"
|
||
msgstr "Μέγεθος"
|
||
|
||
#: ulng.rsconfcolalign
|
||
msgid "Align"
|
||
msgstr "Ευθυγράμμιση"
|
||
|
||
#: ulng.rsconfcolcaption
|
||
msgid "Caption"
|
||
msgstr "Σύλληψη"
|
||
|
||
#: ulng.rsconfcoldelete
|
||
msgctxt "ulng.rsconfcoldelete"
|
||
msgid "Delete"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: ulng.rsconfcolfieldcont
|
||
msgid "Field contents"
|
||
msgstr "Περιεχόμενα Πεδίου"
|
||
|
||
#: ulng.rsconfcolmove
|
||
msgctxt "ulng.rsconfcolmove"
|
||
msgid "Move"
|
||
msgstr "Μετακίνηση"
|
||
|
||
#: ulng.rsconfcolwidth
|
||
msgctxt "ulng.rsconfcolwidth"
|
||
msgid "Width"
|
||
msgstr "Πλάτος"
|
||
|
||
#: ulng.rsconfcustheader
|
||
msgid "Customize column"
|
||
msgstr "Προσαρμογή στήλης"
|
||
|
||
#: ulng.rsconfigurationfileassociation
|
||
msgid "Configure file association"
|
||
msgstr "Διαμόρφωση συσχετισμού αρχείων"
|
||
|
||
#: ulng.rsconfirmexecution
|
||
msgid "Confirming command line and parameters"
|
||
msgstr "Επιβεβαίωση της γραμμής εντολών και παραμέτρων"
|
||
|
||
#: ulng.rscopynametemplate
|
||
msgid "Copy (%d) %s"
|
||
msgstr "Αντιγραφή (%d) %s"
|
||
|
||
#: ulng.rsdefaultimporteddctoolbarhint
|
||
msgid "Imported DC toolbar"
|
||
msgstr "Εισαγμένη σειρά Εργαλείων του DC"
|
||
|
||
#: ulng.rsdefaultimportedtctoolbarhint
|
||
msgid "Imported TC toolbar"
|
||
msgstr "Εισαγμένη σειρά Εργαλείων του TC"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtext
|
||
msgid "_DroppedText"
|
||
msgstr "_ΕναποθετημένοΚείμενο"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
||
msgid "_DroppedHTMLtext"
|
||
msgstr "_ΕναποθετημένοHTMLκείμενο"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
||
msgid "_DroppedRichtext"
|
||
msgstr "_ΕναποθετημένοΠλούσιοκείμενο"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
||
msgid "_DroppedSimpleText"
|
||
msgstr "_ΕναποθετημένοΑπλόΚείμενο"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
||
msgid "_DroppedUnicodeUTF16text"
|
||
msgstr "_ΕναποθετημένοUnicodeUTF16κείμενο"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
||
msgid "_DroppedUnicodeUTF8text"
|
||
msgstr "_ΕναποθετημένοUnicodeUTF8κείμενο"
|
||
|
||
#: ulng.rsdiffadds
|
||
msgid " Adds: "
|
||
msgstr "Προσθέτει:"
|
||
|
||
#: ulng.rsdiffdeletes
|
||
msgid " Deletes: "
|
||
msgstr "Διαγραφή:"
|
||
|
||
#: ulng.rsdifffilesidentical
|
||
msgid "The two files are identical!"
|
||
msgstr "Τα δύο αρχεία είναι όμοια!"
|
||
|
||
#: ulng.rsdiffmatches
|
||
msgid " Matches: "
|
||
msgstr "Αντιστοιχίσεις:"
|
||
|
||
#: ulng.rsdiffmodifies
|
||
msgid " Modifies: "
|
||
msgstr "Μεταβολές:"
|
||
|
||
#: ulng.rsdlgbuttonabort
|
||
msgid "Ab&ort"
|
||
msgstr "Απόρριψη"
|
||
|
||
#: ulng.rsdlgbuttonall
|
||
msgctxt "ulng.rsdlgbuttonall"
|
||
msgid "A&ll"
|
||
msgstr "Όλα"
|
||
|
||
#: ulng.rsdlgbuttonappend
|
||
msgid "A&ppend"
|
||
msgstr "Επισύναψη"
|
||
|
||
#: ulng.rsdlgbuttonautorenamesource
|
||
msgid "A&uto-rename source files"
|
||
msgstr "Αυτόματη ονομασία πηγαίων αρχείων"
|
||
|
||
#: ulng.rsdlgbuttoncancel
|
||
msgctxt "ulng.rsdlgbuttoncancel"
|
||
msgid "&Cancel"
|
||
msgstr "Ακύρωση"
|
||
|
||
#: ulng.rsdlgbuttoncontinue
|
||
msgid "&Continue"
|
||
msgstr "Συνέχιση"
|
||
|
||
#: ulng.rsdlgbuttoncopyinto
|
||
msgid "&Merge"
|
||
msgstr "Συγχώνευση"
|
||
|
||
#: ulng.rsdlgbuttoncopyintoall
|
||
msgid "Mer&ge All"
|
||
msgstr "Συγχώνευση Όλων"
|
||
|
||
#: ulng.rsdlgbuttonexitprogram
|
||
msgid "E&xit program"
|
||
msgstr "Έξοδος προγράμματος"
|
||
|
||
#: ulng.rsdlgbuttonignore
|
||
msgid "Ig&nore"
|
||
msgstr "Αγνόηση"
|
||
|
||
#: ulng.rsdlgbuttonignoreall
|
||
msgid "I&gnore All"
|
||
msgstr "Αγνόηση όλων"
|
||
|
||
#: ulng.rsdlgbuttonno
|
||
msgid "&No"
|
||
msgstr "Όχι"
|
||
|
||
#: ulng.rsdlgbuttonnone
|
||
msgid "Non&e"
|
||
msgstr "Κανένα"
|
||
|
||
#: ulng.rsdlgbuttonok
|
||
msgctxt "ulng.rsdlgbuttonok"
|
||
msgid "&OK"
|
||
msgstr "OK"
|
||
|
||
#: ulng.rsdlgbuttonother
|
||
msgid "Ot&her"
|
||
msgstr "Άλλα"
|
||
|
||
#: ulng.rsdlgbuttonoverwrite
|
||
msgid "&Overwrite"
|
||
msgstr "Αντικατάσταση"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteall
|
||
msgid "Overwrite &All"
|
||
msgstr "Αντικατάσταση Όλων"
|
||
|
||
#: ulng.rsdlgbuttonoverwritelarger
|
||
msgid "Overwrite All &Larger"
|
||
msgstr "Αντικατάσταση Όλων των Μεγαλύτερων"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteolder
|
||
msgid "Overwrite All Ol&der"
|
||
msgstr "Αντικατάσταση Όλων των Παλαιοτέρων"
|
||
|
||
#: ulng.rsdlgbuttonoverwritesmaller
|
||
msgid "Overwrite All S&maller"
|
||
msgstr "Αντικατάσταση Όλων των Μικρότερων"
|
||
|
||
#: ulng.rsdlgbuttonrename
|
||
msgctxt "ulng.rsdlgbuttonrename"
|
||
msgid "R&ename"
|
||
msgstr "Μετονομασία"
|
||
|
||
#: ulng.rsdlgbuttonresume
|
||
msgid "&Resume"
|
||
msgstr "Ολοκλήρωση"
|
||
|
||
#: ulng.rsdlgbuttonretry
|
||
msgid "Re&try"
|
||
msgstr "Επαναπροσπάθεια"
|
||
|
||
#: ulng.rsdlgbuttonretryadmin
|
||
msgid "As Ad&ministrator"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdlgbuttonskip
|
||
msgid "&Skip"
|
||
msgstr "Παράβλεψη"
|
||
|
||
#: ulng.rsdlgbuttonskipall
|
||
msgid "S&kip All"
|
||
msgstr "Παράβλεψη Όλων"
|
||
|
||
#: ulng.rsdlgbuttonyes
|
||
msgid "&Yes"
|
||
msgstr "Ναι"
|
||
|
||
#: ulng.rsdlgcp
|
||
msgctxt "ulng.rsdlgcp"
|
||
msgid "Copy file(s)"
|
||
msgstr "Αντιγραφή αρχείου(ων)"
|
||
|
||
#: ulng.rsdlgmv
|
||
msgid "Move file(s)"
|
||
msgstr "Μετακίνηση αρχείου(ων)"
|
||
|
||
#: ulng.rsdlgoppause
|
||
msgctxt "ulng.rsdlgoppause"
|
||
msgid "Pau&se"
|
||
msgstr "Παύση"
|
||
|
||
#: ulng.rsdlgopstart
|
||
msgctxt "ulng.rsdlgopstart"
|
||
msgid "&Start"
|
||
msgstr "Εκκίνηση"
|
||
|
||
#: ulng.rsdlgqueue
|
||
msgctxt "ulng.rsdlgqueue"
|
||
msgid "Queue"
|
||
msgstr "Ουρά"
|
||
|
||
#: ulng.rsdlgspeed
|
||
msgid "Speed %s/s"
|
||
msgstr "Ταχύτητα %s/s"
|
||
|
||
#: ulng.rsdlgspeedtime
|
||
msgid "Speed %s/s, time remaining %s"
|
||
msgstr "Ταχύτητα %s/s, εναπομένων χρόνος %s"
|
||
|
||
#: ulng.rsdraganddroptextformat
|
||
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
||
msgstr "Μορφή Rich Text;Μορφή HTML;Μορφή Unicode;Μορφή Απλού Κειμένου"
|
||
|
||
#: ulng.rsdrivenolabel
|
||
msgid "<no label>"
|
||
msgstr "<χωρίς ετικέτα>"
|
||
|
||
#: ulng.rsdrivenomedia
|
||
msgid "<no media>"
|
||
msgstr "<χωρίς μέσο>"
|
||
|
||
#: ulng.rseditabouttext
|
||
msgid "Internal Editor of Double Commander."
|
||
msgstr "Εσωτερικός επεξεργαστής του Double Commander."
|
||
|
||
#: ulng.rseditgotolinequery
|
||
msgid "Goto line:"
|
||
msgstr "Μετάβαση στη γραμμή:"
|
||
|
||
#: ulng.rseditgotolinetitle
|
||
msgctxt "ulng.rseditgotolinetitle"
|
||
msgid "Goto Line"
|
||
msgstr "Μετάβαση στη γραμμή"
|
||
|
||
#: ulng.rseditnewfile
|
||
msgid "new.txt"
|
||
msgstr "new.txt"
|
||
|
||
#: ulng.rseditnewfilename
|
||
msgid "Filename:"
|
||
msgstr "Όνομα αρχείου:"
|
||
|
||
#: ulng.rseditnewopen
|
||
msgid "Open file"
|
||
msgstr "Άνοιγμα Αρχείου"
|
||
|
||
#: ulng.rseditsearchback
|
||
msgid "&Backward"
|
||
msgstr "Πίσω"
|
||
|
||
#: ulng.rseditsearchcaption
|
||
msgctxt "ulng.rseditsearchcaption"
|
||
msgid "Search"
|
||
msgstr "Αναζήτηση"
|
||
|
||
#: ulng.rseditsearchfrw
|
||
msgid "&Forward"
|
||
msgstr "Μπροστά"
|
||
|
||
#: ulng.rseditsearchreplace
|
||
msgctxt "ulng.rseditsearchreplace"
|
||
msgid "Replace"
|
||
msgstr "Αντικατάσταση"
|
||
|
||
#: ulng.rseditwithexternaleditor
|
||
msgid "with external editor"
|
||
msgstr "με εξωτερικό επεξεργαστή"
|
||
|
||
#: ulng.rseditwithinternaleditor
|
||
msgid "with internal editor"
|
||
msgstr "με εσωτερικό επεξεργαστή"
|
||
|
||
#: ulng.rsexecuteviashell
|
||
msgctxt "ulng.rsexecuteviashell"
|
||
msgid "Execute via shell"
|
||
msgstr "Εκτέλεση μέσω κελύφους"
|
||
|
||
#: ulng.rsexecuteviaterminalclose
|
||
msgctxt "ulng.rsexecuteviaterminalclose"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Εκτέλεση μέσω τερματικού και κλείσιμό του"
|
||
|
||
#: ulng.rsexecuteviaterminalstayopen
|
||
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Εκτέλεση μέσω τερματικού και παραμονή αυτού ανοικτό"
|
||
|
||
#: ulng.rsfavtabspanelsideselection
|
||
msgid "Left;Right;Active;Inactive;Both;None"
|
||
msgstr "Αριστερά;Δεξιά;Ενεργό;Ανενεργό;Και τα δύο;Κανένα"
|
||
|
||
#: ulng.rsfavtabssavedirhistory
|
||
msgid "No;Yes"
|
||
msgstr "Όχι;Ναι"
|
||
|
||
#: ulng.rsfilenameexportedtcbarprefix
|
||
msgid "Exported_from_DC"
|
||
msgstr "Έχει_Εξαχθεί_από_DC"
|
||
|
||
#: ulng.rsfileopdirectoryexistsoptions
|
||
msgid "Ask;Merge;Skip"
|
||
msgstr "Ερώτηση;Συγχώνευση;Παράβλεψη"
|
||
|
||
#: ulng.rsfileopfileexistsoptions
|
||
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
||
msgstr "Ερώτηση;Αντικατάσταση;Αντικατάσταση παλαιότερων;Παράβλεψη"
|
||
|
||
#: ulng.rsfileopsetpropertyerroroptions
|
||
msgctxt "ulng.rsfileopsetpropertyerroroptions"
|
||
msgid "Ask;Don't set anymore;Ignore errors"
|
||
msgstr "Ερώτηση;Όχι επιπλέον καθορισμός;Αγνόηση λαθών"
|
||
|
||
#: ulng.rsfilterstatus
|
||
msgid "FILTER"
|
||
msgstr "ΦΙΛΤΡΟ"
|
||
|
||
#: ulng.rsfinddefinetemplate
|
||
msgid "Define template"
|
||
msgstr "Καθορισμός προτύπου"
|
||
|
||
#: ulng.rsfinddepth
|
||
msgid "%s level(s)"
|
||
msgstr "%s επίπεδο(α)"
|
||
|
||
#: ulng.rsfinddepthall
|
||
msgid "all (unlimited depth)"
|
||
msgstr "όλα (απεριόριστο εύρος)"
|
||
|
||
#: ulng.rsfinddepthcurdir
|
||
msgid "current dir only"
|
||
msgstr "τρέχων κατάλογος μόνο"
|
||
|
||
#: ulng.rsfinddirnoex
|
||
msgid "Directory %s does not exist!"
|
||
msgstr "Ο Κατάλογος %s δεν υπάρχει!"
|
||
|
||
#: ulng.rsfindfound
|
||
msgctxt "ulng.rsfindfound"
|
||
msgid "Found: %d"
|
||
msgstr "Βρέθηκαν: %d"
|
||
|
||
#: ulng.rsfindsavetemplatecaption
|
||
msgid "Save search template"
|
||
msgstr "Αποθήκευση αναζήτησης προτύπου"
|
||
|
||
#: ulng.rsfindsavetemplatetitle
|
||
msgid "Template name:"
|
||
msgstr "Όνομα Προτύπου:"
|
||
|
||
#: ulng.rsfindscanned
|
||
msgctxt "ulng.rsfindscanned"
|
||
msgid "Scanned: %d"
|
||
msgstr "Έχουν Σαρωθεί: %d"
|
||
|
||
#: ulng.rsfindscanning
|
||
msgid "Scanning"
|
||
msgstr "Σάρωση"
|
||
|
||
#: ulng.rsfindsearchfiles
|
||
msgctxt "ulng.rsfindsearchfiles"
|
||
msgid "Find files"
|
||
msgstr "Εύρεση αρχείων"
|
||
|
||
#: ulng.rsfindtimeofscan
|
||
msgid "Time of scan: "
|
||
msgstr "Ώρα σάρωσης:"
|
||
|
||
#: ulng.rsfindwherebeg
|
||
msgid "Begin at"
|
||
msgstr "Αρχή σε"
|
||
|
||
#: ulng.rsfreemsg
|
||
msgid "Free %s from %s bytes"
|
||
msgstr "Ελεύθερα %s από %s bytes"
|
||
|
||
#: ulng.rsfreemsgshort
|
||
msgid "%s bytes free"
|
||
msgstr "%s bytes ελεύθερα"
|
||
|
||
#: ulng.rsfuncatime
|
||
msgid "Access date/time"
|
||
msgstr "Πρόσβαση ημερομηνίας/ώρας"
|
||
|
||
#: ulng.rsfuncattr
|
||
msgctxt "ulng.rsfuncattr"
|
||
msgid "Attributes"
|
||
msgstr "Ιδιότητες"
|
||
|
||
#: ulng.rsfunccomment
|
||
msgctxt "ulng.rsfunccomment"
|
||
msgid "Comment"
|
||
msgstr "Σχόλιο"
|
||
|
||
#: ulng.rsfunccompressedsize
|
||
msgid "Compressed size"
|
||
msgstr "Συμπιεσμένο μέγεθος"
|
||
|
||
#: ulng.rsfuncctime
|
||
msgid "Creation date/time"
|
||
msgstr "Δημιουργία ημερομηνίας/ώρας"
|
||
|
||
#: ulng.rsfuncext
|
||
msgid "Extension"
|
||
msgstr "Επέκταση"
|
||
|
||
#: ulng.rsfuncgroup
|
||
msgctxt "ulng.rsfuncgroup"
|
||
msgid "Group"
|
||
msgstr "Γκρουπ"
|
||
|
||
#: ulng.rsfunchtime
|
||
msgid "Change date/time"
|
||
msgstr "Αλλαγή ημερομηνίας/ώρας"
|
||
|
||
#: ulng.rsfunclinkto
|
||
msgid "Link to"
|
||
msgstr "Δεσμός σε"
|
||
|
||
#: ulng.rsfuncmtime
|
||
msgid "Modification date/time"
|
||
msgstr "Αλλαγή Ημερομηνίας/Ώρας"
|
||
|
||
#: ulng.rsfuncname
|
||
msgctxt "ulng.rsfuncname"
|
||
msgid "Name"
|
||
msgstr "Όνομα"
|
||
|
||
#: ulng.rsfuncnamenoext
|
||
msgid "Name without extension"
|
||
msgstr "Όνομα χωρίς επέκταση"
|
||
|
||
#: ulng.rsfuncowner
|
||
msgctxt "ulng.rsfuncowner"
|
||
msgid "Owner"
|
||
msgstr "Ιδιοκτήτης"
|
||
|
||
#: ulng.rsfuncpath
|
||
msgctxt "ulng.rsfuncpath"
|
||
msgid "Path"
|
||
msgstr "Διαδρομή"
|
||
|
||
#: ulng.rsfuncsize
|
||
msgctxt "ulng.rsfuncsize"
|
||
msgid "Size"
|
||
msgstr "Μέγεθος"
|
||
|
||
#: ulng.rsfunctype
|
||
msgid "Type"
|
||
msgstr "Τύπος"
|
||
|
||
#: ulng.rsharderrcreate
|
||
msgid "Error creating hardlink."
|
||
msgstr "Λάθος στη δημιουργία δεσμού τύπου hardlink."
|
||
|
||
#: ulng.rshotdirforcesortingorderchoices
|
||
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
||
msgstr "κανένα;Όνομα, α-ω;Όνομα, ω-α;Εξωτ, α-ω;Εξωτ, ω-α;Μέγεθος 9-0;Μέγεθος 0-9;Ημέρα 9-0;Ημέρα 0-9"
|
||
|
||
#: ulng.rshotdirwarningabortrestorebackup
|
||
msgid ""
|
||
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
||
"\n"
|
||
"Are you sure you want to proceed?\n"
|
||
msgstr ""
|
||
"Προσοχή! Κατά την αποκατάσταση ενός .hotlist αντιγράφου, θα διαγραφεί η υπάρχουσα λίστα για να αντικατασταθεί από την σημαντική.\n"
|
||
"\n"
|
||
"Είστε σίγουροι οτι επιθυμείτε να συνεχίσετε;\n"
|
||
|
||
#: ulng.rshotkeycategorycopymovedialog
|
||
msgid "Copy/Move Dialog"
|
||
msgstr "Διάλογος Αντιγραφής/Μετακίνησης"
|
||
|
||
#: ulng.rshotkeycategorydiffer
|
||
msgctxt "ulng.rshotkeycategorydiffer"
|
||
msgid "Differ"
|
||
msgstr "Differ"
|
||
|
||
#: ulng.rshotkeycategoryeditcommentdialog
|
||
msgid "Edit Comment Dialog"
|
||
msgstr "Επεξεργασία Διαλόγου Σχολίου"
|
||
|
||
#: ulng.rshotkeycategoryeditor
|
||
msgctxt "ulng.rshotkeycategoryeditor"
|
||
msgid "Editor"
|
||
msgstr "Επεξεργαστής"
|
||
|
||
#: ulng.rshotkeycategoryfindfiles
|
||
msgctxt "ulng.rshotkeycategoryfindfiles"
|
||
msgid "Find files"
|
||
msgstr "Εύρεση αρχείων"
|
||
|
||
#: ulng.rshotkeycategorymain
|
||
msgid "Main"
|
||
msgstr "Κυρίως"
|
||
|
||
#: ulng.rshotkeycategoryviewer
|
||
msgctxt "ulng.rshotkeycategoryviewer"
|
||
msgid "Viewer"
|
||
msgstr "Προβολέας"
|
||
|
||
#: ulng.rshotkeyfilealreadyexists
|
||
msgid ""
|
||
"A setup with that name already exists.\n"
|
||
"Do you want to overwrite it?\n"
|
||
msgstr ""
|
||
"Μια εγκατάσταση με αυτή την ονομασία υπάρχει ήδη.\n"
|
||
"Επιθυμείτε αντικατάστασή της;\n"
|
||
|
||
#: ulng.rshotkeyfileconfirmdefault
|
||
msgid "Are you sure you want to restore default?"
|
||
msgstr "Είστε σίγουροι ότι επιθυμείτε αποκατάσταση των προκαθορισμένων;"
|
||
|
||
#: ulng.rshotkeyfileconfirmerasure
|
||
msgid "Are you sure you want to erase setup \"%s\"?"
|
||
msgstr "Είστε σίγουροι ότι επιθυμείτε διαγραφή της εγκατάστασης των \"%s\";"
|
||
|
||
#: ulng.rshotkeyfilecopyof
|
||
msgid "Copy of %s"
|
||
msgstr "Αντιγραφή των %s"
|
||
|
||
#: ulng.rshotkeyfileinputnewname
|
||
msgid "Input your new name"
|
||
msgstr "Εισάγετε τη νέα σας ονομασία:"
|
||
|
||
#: ulng.rshotkeyfilemustkeepone
|
||
msgid "You must keep at least one shortcut file."
|
||
msgstr "Πρέπει να διατηρηθεί τουλάχιστο ένα αρχείο συντόμευσης."
|
||
|
||
#: ulng.rshotkeyfilenewname
|
||
msgid "New name"
|
||
msgstr "Νέα Ονομασία"
|
||
|
||
#: ulng.rshotkeyfilesavemodified
|
||
msgid ""
|
||
"\"%s\" setup has been modified.\n"
|
||
"Do you want to save it now?\n"
|
||
msgstr ""
|
||
"\"%s\" Εγκαταστάσεις έχουν αλλάξει.\n"
|
||
"Επιθυμείτε αποθήκευση;\n"
|
||
|
||
#: ulng.rshotkeynoscenter
|
||
msgid "No shortcut with \"ENTER\""
|
||
msgstr "Δεν υπάρχει συντόμευση για \"ENTER\""
|
||
|
||
#: ulng.rshotkeysortorder
|
||
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
||
msgstr "Βάσει ονόματος εντολής;Βάσει κουμπιού συντόμευσης (ομαδοποιημένα);Βάσει κουμπιού συντόμευσης (ένα σε κάθε σειρά)"
|
||
|
||
#: ulng.rsimporttoolbarproblem
|
||
msgid "Cannot find reference to default bar file"
|
||
msgstr "Αδυναμία εύρεσης αναφοράς στο προκαθορισμένο αρχείο γραμμής εργαλείων"
|
||
|
||
#: ulng.rslistoffindfileswindows
|
||
msgid "List of \"Find files\" windows"
|
||
msgstr "Λίστα παραθύρων \"Αναζήτηση Αρχείων\""
|
||
|
||
#: ulng.rsmarkminus
|
||
msgid "Unselect mask"
|
||
msgstr "Αποεπιλογή Μάσκας"
|
||
|
||
#: ulng.rsmarkplus
|
||
msgid "Select mask"
|
||
msgstr "Επιλογή μάσκας"
|
||
|
||
#: ulng.rsmaskinput
|
||
msgid "Input mask:"
|
||
msgstr "Εισαγωγή μάσκας:"
|
||
|
||
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
||
msgid "A columns view with that name already exists."
|
||
msgstr "Μία προβολή στηλών με αυτό το όνομα ήδη υπάρχει"
|
||
|
||
#: ulng.rsmenuconfigurecolumnssavetochange
|
||
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
||
msgstr "Για να αλλάξετε την τρέχουσα ρύθμιση προβολής στηλών, κάντε ΑΠΟΘΗΚΕΥΣΗ, ΑΝΤΙΓΡΑΦΗ ή ΔΙΑΓΡΑΦΗ τρέχουσας ρύθμισης"
|
||
|
||
#: ulng.rsmenuconfigurecustomcolumns
|
||
msgid "Configure custom columns"
|
||
msgstr "Διαμόρφωση εξατομικευμένων στηλών"
|
||
|
||
#: ulng.rsmenuconfigureentercustomcolumnname
|
||
msgid "Enter new custom columns name"
|
||
msgstr "Εισάγετε νέα προσαρμοσμένα χρώματα στηλών"
|
||
|
||
#: ulng.rsmnuactions
|
||
msgctxt "ulng.rsmnuactions"
|
||
msgid "Actions"
|
||
msgstr "Ενέργειες"
|
||
|
||
#: ulng.rsmnucontentdefault
|
||
msgid "<Default>"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnucontentoctal
|
||
msgid "Octal"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnucopynetnamestoclip
|
||
msgid "Copy names with UNC path"
|
||
msgstr "Αντιγραφή ονομάτων με UNC διαδρομή"
|
||
|
||
#: ulng.rsmnudisconnectnetworkdrive
|
||
msgid "Disconnect Network Drive..."
|
||
msgstr "Αποσύνδεση Δικτυακού Οδηγού..."
|
||
|
||
#: ulng.rsmnuedit
|
||
msgctxt "ulng.rsmnuedit"
|
||
msgid "Edit"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: ulng.rsmnueject
|
||
msgid "Eject"
|
||
msgstr "Εξαγωγή"
|
||
|
||
#: ulng.rsmnuextracthere
|
||
msgid "Extract here..."
|
||
msgstr "Εξαγωγή εδώ..."
|
||
|
||
#: ulng.rsmnumapnetworkdrive
|
||
msgid "Map Network Drive..."
|
||
msgstr "Σχεδιασμός Δικτυακού Οδηγού..."
|
||
|
||
#: ulng.rsmnumount
|
||
msgid "Mount"
|
||
msgstr "Προσάρτηση"
|
||
|
||
#: ulng.rsmnunew
|
||
msgctxt "ulng.rsmnunew"
|
||
msgid "New"
|
||
msgstr "Νέο"
|
||
|
||
#: ulng.rsmnunomedia
|
||
msgid "No media available"
|
||
msgstr "Δεν υπάρχει διαθέσιμο Μέσο"
|
||
|
||
#: ulng.rsmnuopen
|
||
msgctxt "ulng.rsmnuopen"
|
||
msgid "Open"
|
||
msgstr "Άνοιγμα"
|
||
|
||
#: ulng.rsmnuopenwith
|
||
msgid "Open with"
|
||
msgstr "Άνοιγμα με"
|
||
|
||
#: ulng.rsmnuopenwithother
|
||
msgctxt "ulng.rsmnuopenwithother"
|
||
msgid "Other..."
|
||
msgstr "Άλλα..."
|
||
|
||
#: ulng.rsmnupackhere
|
||
msgid "Pack here..."
|
||
msgstr "Πακετάρισμα εδώ..."
|
||
|
||
#: ulng.rsmnusortby
|
||
msgid "Sort by"
|
||
msgstr "Ταξινόμηση κατά"
|
||
|
||
#: ulng.rsmnuumount
|
||
msgid "Unmount"
|
||
msgstr "Αποπροσάρτηση"
|
||
|
||
#: ulng.rsmnuview
|
||
msgctxt "ulng.rsmnuview"
|
||
msgid "View"
|
||
msgstr "Προβολή"
|
||
|
||
#: ulng.rsmsgaccount
|
||
msgid "Account:"
|
||
msgstr "Λογαριασμός:"
|
||
|
||
#: ulng.rsmsgalldcintcmds
|
||
msgid "All Double Commander internal commands"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgarchivercustomparams
|
||
msgid "Additional parameters for archiver command-line:"
|
||
msgstr "Επιπρόσθετες παράμετροι για τη γραμμή εντολών του προγράμματος συμπίεσης:"
|
||
|
||
#: ulng.rsmsgaskquoteornot
|
||
msgid "Do you want to enclose between quotes?"
|
||
msgstr "Επιθυμείτε να εισαχθεί μεταξύ εισαγωγικών;"
|
||
|
||
#: ulng.rsmsgbadcrc32
|
||
msgid ""
|
||
"Bad CRC32 for resulting file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Do you want to keep the resulting corrupted file anyway?\n"
|
||
msgstr ""
|
||
"Κακό CRC32 για τελικό αρχείο:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Επιθυμείτε να κρατήσετε το κατεστραμμένο τελικό αρχείο ως έχει;\n"
|
||
|
||
#: ulng.rsmsgcannotcopymoveitself
|
||
msgid "You can not copy/move a file \"%s\" to itself!"
|
||
msgstr "Δεν μπορείτε να αντιγράψετε/μετακινήσετε ένα αρχείο \"%s\" σε αυτό το ίδιο!"
|
||
|
||
#: ulng.rsmsgcannotdeletedirectory
|
||
msgid "Cannot delete directory %s"
|
||
msgstr "Αδυναμία διαγραφής καταλόγου %s"
|
||
|
||
#: ulng.rsmsgcannotoverwritedirectory
|
||
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
||
msgstr "Δεν είναι δυνατή η αντικατάσταση του καταλόγου \"%s\" με τον μη-κατάλογο \"%s\""
|
||
|
||
#: ulng.rsmsgchdirfailed
|
||
msgid "ChDir to [%s] failed!"
|
||
msgstr "ChDir σε [%s] απέτυχε!"
|
||
|
||
#: ulng.rsmsgcloseallinactivetabs
|
||
msgid "Remove all inactive tabs?"
|
||
msgstr "Αφαίρεση όλων των ανενεργών καρτελών;"
|
||
|
||
#: ulng.rsmsgcloselockedtab
|
||
msgid "This tab (%s) is locked! Close anyway?"
|
||
msgstr "Αυτή η καρτέλα (%s) είναι κλειδωμένη! Κλείσιμο ως έχει;"
|
||
|
||
#: ulng.rsmsgcofirmuserparam
|
||
msgid "Confirmation of parameter"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgconfirmquit
|
||
msgid "Are you sure you want to quit?"
|
||
msgstr "Είστε σίγουροι οτι επιθυμείτε έξοδο;"
|
||
|
||
#: ulng.rsmsgcopybackward
|
||
msgid "The file %s has changed. Do you want to copy it backward?"
|
||
msgstr "Το αρχείο %s έχει αλλάξει. Επιθυμείτε να το αντιγράψετε αντίστροφα;"
|
||
|
||
#: ulng.rsmsgcouldnotcopybackward
|
||
msgid "Could not copy backward - do you want to keep the changed file?"
|
||
msgstr "Αδυναμία αντίστροφης αντιγραφής - επιθυμείτε να διατηρήσετε το αλλαγμένο αρχείο;"
|
||
|
||
#: ulng.rsmsgcpfldr
|
||
msgid "Copy %d selected files/directories?"
|
||
msgstr "Αντιγραφή %d επιλεγμένων αρχείων/καταλόγων;"
|
||
|
||
#: ulng.rsmsgcpsel
|
||
msgid "Copy selected \"%s\"?"
|
||
msgstr "Αντιγραφή επιλεγμένου \"%s\";"
|
||
|
||
#: ulng.rsmsgcreateanewfiletype
|
||
msgid "< Create a new file type \"%s files\" >"
|
||
msgstr "< Δημιουργία ενός νέου τύπου αρχείου \"%s αρχεία\" >"
|
||
|
||
#: ulng.rsmsgdctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a DC Toolbar file"
|
||
msgstr "Εισάγετε τοποθεσία και όνομα αρχείου που θα αποθηκευθεί το αρχείο γραμμής εργαλείων του DC"
|
||
|
||
#: ulng.rsmsgdefaultcustomactionname
|
||
msgid "Custom action"
|
||
msgstr "Προσαρμοσμένη ενέργεια"
|
||
|
||
#: ulng.rsmsgdeletepartiallycopied
|
||
msgid "Delete the partially copied file ?"
|
||
msgstr "Διαγραφή μερικώς αντιγραμμένου αρχείου ;"
|
||
|
||
#: ulng.rsmsgdelfldr
|
||
msgid "Delete %d selected files/directories?"
|
||
msgstr "Διαγραφή %d επιλεγμένων αρχείων/καταλόγων;"
|
||
|
||
#: ulng.rsmsgdelfldrt
|
||
msgid "Delete %d selected files/directories into trash can?"
|
||
msgstr "Διαγραφή %d επιλεγμένων αρχείων/καταλόγων στο κάδο αχρήστων;"
|
||
|
||
#: ulng.rsmsgdelsel
|
||
msgid "Delete selected \"%s\"?"
|
||
msgstr "Διαγραφή επιλεγμένων \"%s\";"
|
||
|
||
#: ulng.rsmsgdelselt
|
||
msgid "Delete selected \"%s\" into trash can?"
|
||
msgstr "Διαγραφή επιλεγμένων \"%s\" στο κάδο αχρήστων;"
|
||
|
||
#: ulng.rsmsgdeltotrashforce
|
||
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
||
msgstr "Αδυναμία διαγραφής \"%s\" στα απορρίμματα! Διαγραφή άμεσα;"
|
||
|
||
#: ulng.rsmsgdisknotavail
|
||
msgid "Disk is not available"
|
||
msgstr "Ο Δίσκος δεν είναι διαθέσιμος"
|
||
|
||
#: ulng.rsmsgentercustomaction
|
||
msgid "Enter custom action name:"
|
||
msgstr "Εισάγετε νέο προσαρμοσμένο όνομα ενέργειας:"
|
||
|
||
#: ulng.rsmsgenterfileext
|
||
msgid "Enter file extension:"
|
||
msgstr "Εισάγετε την επέκταση αρχείου:"
|
||
|
||
#: ulng.rsmsgentername
|
||
msgid "Enter name:"
|
||
msgstr "Εισαγωγή ονόματος:"
|
||
|
||
#: ulng.rsmsgenternewfiletypename
|
||
msgid "Enter name of new file type to create for extension \"%s\""
|
||
msgstr "Εισαγωγή ονόματος του νέου τύπου αρχείου που δημιουργείται για την επέκταση \"%s\""
|
||
|
||
#: ulng.rsmsgerrbadarchive
|
||
msgid "CRC error in archive data"
|
||
msgstr "CRC λάθος στα δεδομένα αρχειοθήκης"
|
||
|
||
#: ulng.rsmsgerrbaddata
|
||
msgid "Data is bad"
|
||
msgstr "Άσχημα Δεδομένα"
|
||
|
||
#: ulng.rsmsgerrcannotconnect
|
||
msgid "Can not connect to server: \"%s\""
|
||
msgstr "Αδυναμία σύνδεσης στον διακομιστή: \"%s\""
|
||
|
||
#: ulng.rsmsgerrcannotcopyfile
|
||
msgid "Cannot copy file %s to %s"
|
||
msgstr "Αδυναμία αντιγραφής αρχείου %s στο %s"
|
||
|
||
#: ulng.rsmsgerrcreatefiledirectoryexists
|
||
msgid "There already exists a directory named \"%s\"."
|
||
msgstr "Εκεί υπάρχει ήδη ένας κατάλογος με το όνομα \"%s\"."
|
||
|
||
#: ulng.rsmsgerrdatenotsupported
|
||
msgid "Date %s is not supported"
|
||
msgstr "Ημερομηνία %s δεν υποστηρίζεται"
|
||
|
||
#: ulng.rsmsgerrdirexists
|
||
msgid "Directory %s exists!"
|
||
msgstr "Ο Κατάλογος %s υπάρχει!"
|
||
|
||
#: ulng.rsmsgerreaborted
|
||
msgid "Function aborted by user"
|
||
msgstr "Λειτουργία που έχει απορριφθεί από το χρήστη"
|
||
|
||
#: ulng.rsmsgerreclose
|
||
msgid "Error closing file"
|
||
msgstr "Λάθος κλεισίματος αρχείου"
|
||
|
||
#: ulng.rsmsgerrecreate
|
||
msgid "Cannot create file"
|
||
msgstr "Αδυναμία δημιουργίας αρχείου"
|
||
|
||
#: ulng.rsmsgerrendarchive
|
||
msgid "No more files in archive"
|
||
msgstr "Όχι άλλα αρχεία στην αρχειοθήκη"
|
||
|
||
#: ulng.rsmsgerreopen
|
||
msgid "Cannot open existing file"
|
||
msgstr "Αδυναμία ανοίγματος υπάρχοντος αρχείου"
|
||
|
||
#: ulng.rsmsgerreread
|
||
msgid "Error reading from file"
|
||
msgstr "Λάθος ανάγνωσης από το αρχείο"
|
||
|
||
#: ulng.rsmsgerrewrite
|
||
msgid "Error writing to file"
|
||
msgstr "Λάθος εγγραφής στο αρχείο"
|
||
|
||
#: ulng.rsmsgerrforcedir
|
||
msgid "Can not create directory %s!"
|
||
msgstr "Αδυναμία δημιουργίας καταλόγου %s!"
|
||
|
||
#: ulng.rsmsgerrinvalidlink
|
||
msgid "Invalid link"
|
||
msgstr "Μη Έγκυρος δεσμός"
|
||
|
||
#: ulng.rsmsgerrnofiles
|
||
msgid "No files found"
|
||
msgstr "Δεν βρέθηκαν αρχεία"
|
||
|
||
#: ulng.rsmsgerrnomemory
|
||
msgid "Not enough memory"
|
||
msgstr "Όχι αρκετή μνήμη"
|
||
|
||
#: ulng.rsmsgerrnotsupported
|
||
msgid "Function not supported!"
|
||
msgstr "Η λειτουργία δεν υποστηρίζεται!"
|
||
|
||
#: ulng.rsmsgerrorincontextmenucommand
|
||
msgid "Error in context menu command"
|
||
msgstr "Λάθος στην εντολή μενού περιεχόμενου"
|
||
|
||
#: ulng.rsmsgerrorloadingconfiguration
|
||
msgid "Error when loading configuration"
|
||
msgstr "Λάθος κατά την φόρτωση των ρυθμίσεων"
|
||
|
||
#: ulng.rsmsgerrregexpsyntax
|
||
msgid "Syntax error in regular expression!"
|
||
msgstr "Συντακτικό λάθος σε συνήθη φράση!"
|
||
|
||
#: ulng.rsmsgerrrename
|
||
msgid "Cannot rename file %s to %s"
|
||
msgstr "Αδυναμία μετονομασίας αρχείου %s σε %s"
|
||
|
||
#: ulng.rsmsgerrsaveassociation
|
||
msgid "Can not save association!"
|
||
msgstr "Αδύνατη η αποθήκευση συσχετισμού!"
|
||
|
||
#: ulng.rsmsgerrsavefile
|
||
msgid "Cannot save file"
|
||
msgstr "Αδύνατη η αποθήκευση αρχείου"
|
||
|
||
#: ulng.rsmsgerrsetattribute
|
||
msgid "Can not set attributes for \"%s\""
|
||
msgstr "Αδυναμία καθορισμού ιδιοτήτων για \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetdatetime
|
||
msgid "Can not set date/time for \"%s\""
|
||
msgstr "Αδυναμία ορισμού ημερομηνίας/ώρας για \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetownership
|
||
msgid "Can not set owner/group for \"%s\""
|
||
msgstr "Αδυναμία ορισμού ιδιοκτήτη/γκρουπ για \"%s\""
|
||
|
||
#: ulng.rsmsgerrsetpermissions
|
||
msgid "Can not set permissions for \"%s\""
|
||
msgstr "Αδυναμία ορισμού αδειών για \"%s\""
|
||
|
||
#: ulng.rsmsgerrsmallbuf
|
||
msgid "Buffer too small"
|
||
msgstr "Ενδιάμεση μνήμη πολύ μικρή"
|
||
|
||
#: ulng.rsmsgerrtoomanyfiles
|
||
msgid "Too many files to pack"
|
||
msgstr "Πάρα πολλά αρχεία για πακετάρισμα"
|
||
|
||
#: ulng.rsmsgerrunknownformat
|
||
msgid "Archive format unknown"
|
||
msgstr "Άγνωστη μορφή Αρχειοθήκης"
|
||
|
||
#: ulng.rsmsgfavoritetabsdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
||
msgstr "Είστε βέβαιοι οτι επιθυμείτε να αφαιρέσετε όλες τις καταχωρήσεις των Αγαπημένων Καρτελών σας; (Δεν υπάρχει \"αναίρεση\" σε αυτή την ενέργεια!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsdraghereentry
|
||
msgid "Drag here other entries"
|
||
msgstr "Μεταφορά με το ποντίκι εδώ άλλων καταχωρήσεων"
|
||
|
||
#: ulng.rsmsgfavoritetabsentername
|
||
msgid "Enter a name this Favorite Tabs entry"
|
||
msgstr "Εισαγωγή ενός ονόματος για αυτή τη καταχώρηση Αγαπημένης Καρτέλας"
|
||
|
||
#: ulng.rsmsgfavoritetabsenternametitle
|
||
msgid "Saving a new Favorite Tabs entry"
|
||
msgstr "Αποθήκευση μίας νέας καταχώρησης Αγαπημένων Καρτελών"
|
||
|
||
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
||
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
||
msgstr "Αριθμός Αγαπημένων Καρτελών που έχουν εξαχθεί επιτυχώς: %d στις %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsextramode
|
||
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
||
msgstr "Προκαθορισμένη επιπλέον ρύθμιση για αποθήκευση ιστορικού καταλόγου για νέες Αγαπημένες Καρτέλες:"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
||
msgid "Number of file(s) imported successfully: %d on %d"
|
||
msgstr "Αριθμός αρχείου(ων) που έχουν εισαχθεί επιτυχώς: %d στα %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
||
msgid "Legacy tabs imported"
|
||
msgstr "Εισήχθησαν καρτέλες Legacy"
|
||
|
||
#: ulng.rsmsgfavoritetabsimporttitle
|
||
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
||
msgstr "Επιλέξτε .tab αρχείο(α) για εισαγωγή (μπορούν να είναι και περισσότερα από ένα κάθε φορά!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
||
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
||
msgstr "Η τελευταία προσαρμογή Αγαπημένων Καρτελών δεν έχει αποθηκευθεί ακόμη. Επιθυμείτε να αποθηκεύσετε πριν να συνεχίσετε;"
|
||
|
||
#: ulng.rsmsgfavoritetabssimplemode
|
||
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "Διατήρηση αποθήκευσης ιστορικού καταλόγου με Αγαπημένες Καρτέλες:"
|
||
|
||
#: ulng.rsmsgfavoritetabssubmenuname
|
||
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Ονομασία υπομενού"
|
||
|
||
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
||
msgid "This will load the Favorite Tabs: \"%s\""
|
||
msgstr "Αυτό θα φορτώσει τις Αγαπημένες Καρτέλες: \"%s\""
|
||
|
||
#: ulng.rsmsgfavortietabssaveoverexisting
|
||
msgid "Save current tabs over existing Favorite Tabs entry"
|
||
msgstr "Αποθήκευση τρεχουσών καρτελών πάνω σε υπάρχουσα καταχώρηση Αγαπημένων Καρτελών"
|
||
|
||
#: ulng.rsmsgfilechangedsave
|
||
msgid "File %s changed, save?"
|
||
msgstr "Το αρχείο %s έχει αλλάξει, αποθήκευση;"
|
||
|
||
#: ulng.rsmsgfileexistsfileinfo
|
||
msgid "%s bytes, %s"
|
||
msgstr "%s bytes, %s"
|
||
|
||
#: ulng.rsmsgfileexistsoverwrite
|
||
msgid "Overwrite:"
|
||
msgstr "Αντικατάσταση:"
|
||
|
||
#: ulng.rsmsgfileexistsrwrt
|
||
msgid "File %s exists, overwrite?"
|
||
msgstr "Το Αρχείο %s υπάρχει, αντικατάσταση;"
|
||
|
||
#: ulng.rsmsgfileexistswithfile
|
||
msgid "With file:"
|
||
msgstr "Με το αρχείο:"
|
||
|
||
#: ulng.rsmsgfilenotfound
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Το Αρχείο \"%s\" δε βρέθηκε."
|
||
|
||
#: ulng.rsmsgfileoperationsactive
|
||
msgid "File operations active"
|
||
msgstr "Εργασίες Αρχείου ενεργές"
|
||
|
||
#: ulng.rsmsgfileoperationsactivelong
|
||
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
||
msgstr "Κάποιες εργασίες αρχείου δεν έχουν ακόμη τελειώσει. Κλείνοντας τον Double Commander ίσως προκληθεί απώλεια δεδομένων."
|
||
|
||
#: ulng.rsmsgfilepathovermaxpath
|
||
msgid ""
|
||
"The target name length (%d) is more than %d characters!\n"
|
||
"%s\n"
|
||
"Most programs will not be able to access a file/directory with such a long name!\n"
|
||
msgstr ""
|
||
"Το μήκος ονόματος στόχου (%d) είναι περισσότερο από %d χαρακτήρες!\n"
|
||
"%s\n"
|
||
"Τα περισσότερα προγράμματα δε θα μπορούν να έχουν πρόσβαση σε αρχείο/κατάλογο με τόσο μακρύ όνομα!\n"
|
||
|
||
#: ulng.rsmsgfilereadonly
|
||
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
||
msgstr "Το Αρχείο %s έχει σημανθεί για ανάγνωση μόνο. Διαγραφή;"
|
||
|
||
#: ulng.rsmsgfilesizetoobig
|
||
msgid "The file size of \"%s\" is too big for destination file system!"
|
||
msgstr "Το μέγεθος αρχείου του \"%s\" είναι πολύ μεγάλο για το προοριζόμενο σύστημα αρχείων!"
|
||
|
||
#: ulng.rsmsgfolderexistsrwrt
|
||
msgid "Folder %s exists, merge?"
|
||
msgstr "Ο Φάκελος %s υπάρχει, συγχώνευση;"
|
||
|
||
#: ulng.rsmsgfollowsymlink
|
||
msgid "Follow symlink \"%s\"?"
|
||
msgstr "Ακολουθείστε Συμβολοδεσμό \"%s\";"
|
||
|
||
#: ulng.rsmsgfortextformattoimport
|
||
msgid "Select the text format to import"
|
||
msgstr "Επιλέξτε τον τύπο κειμένου προς εισαγωγή"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectories
|
||
msgid "Add %d selected dirs"
|
||
msgstr "Προσθήκη %d επιλεγμένων καταλόγων"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectory
|
||
msgid "Add selected dir: "
|
||
msgstr "Προσθήκη του επιλεγμένου καταλόγου:"
|
||
|
||
#: ulng.rsmsghotdiraddthisdirectory
|
||
msgid "Add current dir: "
|
||
msgstr "Προσθήκη του τρέχοντος καταλόγου:"
|
||
|
||
#: ulng.rsmsghotdircommandname
|
||
msgid "Do command"
|
||
msgstr "Εκτέλεση Εντολής"
|
||
|
||
#: ulng.rsmsghotdircommandsample
|
||
msgid "cm_somthing"
|
||
msgstr "cm_somthing"
|
||
|
||
#: ulng.rsmsghotdirconfighotlist
|
||
msgctxt "ulng.rsmsghotdirconfighotlist"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Ρυθμίσεις του Καταλόγου Hotlist"
|
||
|
||
#: ulng.rsmsghotdirdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
||
msgstr "Είστε σίγουροι οτι επιθυμείτε να αφαιρέσετε όλες τις καταχωρήσεις από τον κατάλογο Hotlist; (Δεν υπάρχει \"Αναίρεση\" σε αυτή την ενέργεια!)"
|
||
|
||
#: ulng.rsmsghotdirdemocommand
|
||
msgid "This will execute the following command:"
|
||
msgstr "Αυτό θα εκτελέσει την ακόλουθη εντολή:"
|
||
|
||
#: ulng.rsmsghotdirdemoname
|
||
msgid "This is hot dir named "
|
||
msgstr "Αυτό είναι ονομασμένο hot dir"
|
||
|
||
#: ulng.rsmsghotdirdemopath
|
||
msgid "This will change active frame to the following path:"
|
||
msgstr "Αυτό θα αλλάξει το ενεργό πλαίσιο στην ακόλουθη διαδρομή:"
|
||
|
||
#: ulng.rsmsghotdirdemotarget
|
||
msgid "And inactive frame would change to the following path:"
|
||
msgstr "Και το ανενεργό πλαίσιο θα αλλάξει στην ακόλουθη διαδρομή:"
|
||
|
||
#: ulng.rsmsghotdirerrorbackuping
|
||
msgid "Error backuping entries..."
|
||
msgstr "Λάθος κατά τη λήψη αντιγράφου ασφαλείας των εισαγμένων εγγραφών..."
|
||
|
||
#: ulng.rsmsghotdirerrorexporting
|
||
msgid "Error exporting entries..."
|
||
msgstr "Λάθος εξαγωγής εγγραφών..."
|
||
|
||
#: ulng.rsmsghotdirexportall
|
||
msgid "Export all!"
|
||
msgstr "Εξαγωγή Όλων!"
|
||
|
||
#: ulng.rsmsghotdirexporthotlist
|
||
msgid "Export Directory Hotlist - Select the entries you want to export"
|
||
msgstr "Εξαγωγή Καταλόγου Hotlist - Επιλέξτε τις καταχωρήσεις που επιθυμείτε να εξαγάγετε"
|
||
|
||
#: ulng.rsmsghotdirexportsel
|
||
msgid "Export selected"
|
||
msgstr "Εξαγωγή Επιλεγμένων"
|
||
|
||
#: ulng.rsmsghotdirimportall
|
||
msgctxt "ulng.rsmsghotdirimportall"
|
||
msgid "Import all!"
|
||
msgstr "Εισαγωγή Όλων!"
|
||
|
||
#: ulng.rsmsghotdirimporthotlist
|
||
msgid "Import Directory Hotlist - Select the entries you want to import"
|
||
msgstr "Εισαγωγή Καταλόγου Hotlist - Επιλέξτε τις καταχωρήσεις που επιθυμείτε να εισαγάγετε"
|
||
|
||
#: ulng.rsmsghotdirimportsel
|
||
msgctxt "ulng.rsmsghotdirimportsel"
|
||
msgid "Import selected"
|
||
msgstr "Εισαγωγή επιλεγμένων"
|
||
|
||
#: ulng.rsmsghotdirjustpath
|
||
msgctxt "ulng.rsmsghotdirjustpath"
|
||
msgid "&Path:"
|
||
msgstr "Διαδρομή"
|
||
|
||
#: ulng.rsmsghotdirlocatehotlistfile
|
||
msgid "Locate \".hotlist\" file to import"
|
||
msgstr "Εντοπισμός \".hotlist\" αρχείου προς εισαγωγή"
|
||
|
||
#: ulng.rsmsghotdirname
|
||
msgid "Hotdir name"
|
||
msgstr "Όνομα Hotdir"
|
||
|
||
#: ulng.rsmsghotdirnbnewentries
|
||
msgid "Number of new entries: %d"
|
||
msgstr "Αριθμός νέων καταχωρήσεων: %d"
|
||
|
||
#: ulng.rsmsghotdirnothingtoexport
|
||
msgid "Nothing selected to export!"
|
||
msgstr "Δεν έχει επιλεχθεί τίποτα προς εξαγωγή!"
|
||
|
||
#: ulng.rsmsghotdirpath
|
||
msgid "Hotdir path"
|
||
msgstr "Διαδρομή Hotdir"
|
||
|
||
#: ulng.rsmsghotdirreaddselecteddirectory
|
||
msgid "Re-Add selected dir: "
|
||
msgstr "Επαναπροσθήκη του επιλεγμένου καταλόγου:"
|
||
|
||
#: ulng.rsmsghotdirreaddthisdirectory
|
||
msgid "Re-Add current dir: "
|
||
msgstr "Επαναπροσθήκη του τρέχων καταλόγου:"
|
||
|
||
#: ulng.rsmsghotdirrestorewhat
|
||
msgid "Enter location and filename of Directory Hotlist to restore"
|
||
msgstr "Εισαγωγή τοποθεσίας και ονόματος αρχείου του καταλόγου Hotlist για επαναφορά"
|
||
|
||
#: ulng.rsmsghotdirsimplecommand
|
||
msgctxt "ulng.rsmsghotdirsimplecommand"
|
||
msgid "Command:"
|
||
msgstr "Εντολή:"
|
||
|
||
#: ulng.rsmsghotdirsimpleendofmenu
|
||
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
||
msgid "(end of sub menu)"
|
||
msgstr "(τέλος του υπομενού)"
|
||
|
||
#: ulng.rsmsghotdirsimplemenu
|
||
msgctxt "ulng.rsmsghotdirsimplemenu"
|
||
msgid "Menu &name:"
|
||
msgstr "Ονομασία Μενού:"
|
||
|
||
#: ulng.rsmsghotdirsimplename
|
||
msgctxt "ulng.rsmsghotdirsimplename"
|
||
msgid "&Name:"
|
||
msgstr "Ονομασία:"
|
||
|
||
#: ulng.rsmsghotdirsimpleseparator
|
||
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
||
msgid "(separator)"
|
||
msgstr "(διαχωριστικό)"
|
||
|
||
#: ulng.rsmsghotdirsubmenuname
|
||
msgctxt "ulng.rsmsghotdirsubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Ονομασία υπομενού"
|
||
|
||
#: ulng.rsmsghotdirtarget
|
||
msgid "Hotdir target"
|
||
msgstr "Στόχος Hotdir"
|
||
|
||
#: ulng.rsmsghotdirtiporderpath
|
||
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Προσδιορίστε αν επιθυμείτε το ενεργό πλαίσιο να ταξινομηθεί με μια ειδική σειρά μετά την αλλαγή καταλόγου"
|
||
|
||
#: ulng.rsmsghotdirtipordertarget
|
||
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Προσδιορίστε αν επιθυμείτε το μη ενεργό πλαίσιο να ταξινομηθεί με μια ειδική σειρά μετά την αλλαγή καταλόγου"
|
||
|
||
#: ulng.rsmsghotdirtipspecialdirbut
|
||
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
||
msgstr "Κάποιες λειτουργίες για την επιλογή κατάλληλης σχετικής διαδρομής, απόλυτης, ειδικούς φακέλους παραθύρων, κ.λ.π."
|
||
|
||
#: ulng.rsmsghotdirtotalbackuped
|
||
msgid ""
|
||
"Total entries saved: %d\n"
|
||
"\n"
|
||
"Backup filename: %s\n"
|
||
msgstr ""
|
||
"Σύνολο καταχωρήσεων που έχουν αποθηκευθεί: %d\n"
|
||
"\n"
|
||
"Όνομα Αρχείου ασφαλείας: %s\n"
|
||
|
||
#: ulng.rsmsghotdirtotalexported
|
||
msgid "Total entries exported: "
|
||
msgstr "Σύνολο καταχωρήσεων που έχουν εξαχθεί:"
|
||
|
||
#: ulng.rsmsghotdirwhattodelete
|
||
msgid ""
|
||
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
||
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
||
msgstr ""
|
||
"Επιθυμείτε να διαγράψετε όλα τα στοιχεία εντός του υπομενού [%s];\n"
|
||
"Απαντώντας ΟΧΙ θα διαγράψετε μόνο τους οριοθέτες του μενού αλλά θα διατηρηθεί το στοιχείο μέσα στο υπομενού.\n"
|
||
|
||
#: ulng.rsmsghotdirwheretosave
|
||
msgid "Enter location and filename where to save a Directory Hotlist file"
|
||
msgstr "Εισαγωγή τοποθεσίας και ονόματος αρχείου όπου θα αποθηκευθεί ένα αρχείο καταλόγου Hotlist"
|
||
|
||
#: ulng.rsmsgincorrectfilelength
|
||
msgid "Incorrect resulting filelength for file : \"%s\""
|
||
msgstr "Μη Έγκυρο τελικό μήκος αρχείου για το αρχείο : \"%s\""
|
||
|
||
#: ulng.rsmsginsertnextdisk
|
||
msgid ""
|
||
"Please insert next disk or something similar.\n"
|
||
"\n"
|
||
"It is to allow writing this file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Number of bytes still to write: %d\n"
|
||
msgstr ""
|
||
"Παρακαλώ εισάγετε τον επόμενο δίσκο ή κάτι παρόμοιο.\n"
|
||
"\n"
|
||
"Ώστε να επιτραπεί εγγραφή σε αυτό το αρχείο:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Αριθμός bytes προς εγγραφή: %d\n"
|
||
|
||
#: ulng.rsmsginvalidcommandline
|
||
msgid "Error in command line"
|
||
msgstr "Λάθος στη γραμμή εντολών"
|
||
|
||
#: ulng.rsmsginvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Μη Έγκυρο όνομα αρχείου"
|
||
|
||
#: ulng.rsmsginvalidformatofconfigurationfile
|
||
msgid "Invalid format of configuration file"
|
||
msgstr "Άκυρος τύπος αρχείου ρυθμίσεων"
|
||
|
||
#: ulng.rsmsginvalidpath
|
||
msgid "Invalid path"
|
||
msgstr "Μη Έγκυρη διαδρομή"
|
||
|
||
#: ulng.rsmsginvalidpathlong
|
||
msgid "Path %s contains forbidden characters."
|
||
msgstr "Η Διαδρομή %s περιέχει απαγορευμένος χαρακτήρες."
|
||
|
||
#: ulng.rsmsginvalidplugin
|
||
msgid "This is not a valid plugin!"
|
||
msgstr "Αυτό είναι ένα μη έγκυρο πρόσθετο!"
|
||
|
||
#: ulng.rsmsginvalidpluginarchitecture
|
||
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
||
msgstr "Αυτό το πρόσθετο έχει δημιουργηθεί για τον Double Commander για %s.%sΔεν μπορεί να λειτουργήσει στον Double Commander για %s!"
|
||
|
||
#: ulng.rsmsginvalidquoting
|
||
msgid "Invalid quoting"
|
||
msgstr "Μη έγκυρη δημιουργία εισαγωγικών"
|
||
|
||
#: ulng.rsmsginvalidselection
|
||
msgid "Invalid selection."
|
||
msgstr "Μη Έγκυρη επιλογή."
|
||
|
||
#: ulng.rsmsgloadingfilelist
|
||
msgid "Loading file list..."
|
||
msgstr "Φόρτωση λίστας αρχείων..."
|
||
|
||
#: ulng.rsmsglocatetcconfiguation
|
||
msgid "Locate TC configuration file (wincmd.ini)"
|
||
msgstr "Εντοπισμός αρχείου ρυθμίσεων του TC (wincmd.ini)"
|
||
|
||
#: ulng.rsmsglocatetcexecutable
|
||
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
||
msgstr "Εντοπισμός αρχείου εκτέλεσης του TC (totalcmd.exe or totalcmd64.exe)"
|
||
|
||
#: ulng.rsmsglogcopy
|
||
msgid "Copy file %s"
|
||
msgstr "Αντιγραφή αρχείου %s"
|
||
|
||
#: ulng.rsmsglogdelete
|
||
msgid "Delete file %s"
|
||
msgstr "Διαγραφή αρχείου %s"
|
||
|
||
#: ulng.rsmsglogerror
|
||
msgid "Error: "
|
||
msgstr "Λάθος: "
|
||
|
||
#: ulng.rsmsglogextcmdlaunch
|
||
msgid "Launch external"
|
||
msgstr "Φόρτωση Εξωτερικά"
|
||
|
||
#: ulng.rsmsglogextcmdresult
|
||
msgid "Result external"
|
||
msgstr "Εξαγωγή Αποτελέσματος εξωτερικά"
|
||
|
||
#: ulng.rsmsglogextract
|
||
msgid "Extract file %s"
|
||
msgstr "Εξαγωγή Αρχείου %s"
|
||
|
||
#: ulng.rsmsgloginfo
|
||
msgid "Info: "
|
||
msgstr "Πληροφορίες:"
|
||
|
||
#: ulng.rsmsgloglink
|
||
msgid "Create link %s"
|
||
msgstr "Δημιουργία δεσμού %s"
|
||
|
||
#: ulng.rsmsglogmkdir
|
||
msgid "Create directory %s"
|
||
msgstr "Δημιουργία καταλόγου %s"
|
||
|
||
#: ulng.rsmsglogmove
|
||
msgid "Move file %s"
|
||
msgstr "Μετακίνηση αρχείου %s"
|
||
|
||
#: ulng.rsmsglogpack
|
||
msgid "Pack to file %s"
|
||
msgstr "Πακετάρισμα στο αρχείο %s"
|
||
|
||
#: ulng.rsmsglogrmdir
|
||
msgid "Remove directory %s"
|
||
msgstr "Αφαίρεση καταλόγου %s"
|
||
|
||
#: ulng.rsmsglogsuccess
|
||
msgid "Done: "
|
||
msgstr "Έγινε:"
|
||
|
||
#: ulng.rsmsglogsymlink
|
||
msgid "Create symlink %s"
|
||
msgstr "Δημιουργία συμβολοδεσμού %s"
|
||
|
||
#: ulng.rsmsglogtest
|
||
msgid "Test file integrity %s"
|
||
msgstr "Δοκιμή ακεραιότητας αρχείου %s"
|
||
|
||
#: ulng.rsmsglogwipe
|
||
msgid "Wipe file %s"
|
||
msgstr "Ασφαλής Διαγραφή αρχείου %s"
|
||
|
||
#: ulng.rsmsglogwipedir
|
||
msgid "Wipe directory %s"
|
||
msgstr "Ασφαλής Διαγραφή καταλόγου %s"
|
||
|
||
#: ulng.rsmsgmasterpassword
|
||
msgid "Master Password"
|
||
msgstr "Κύριο Συνθηματικό"
|
||
|
||
#: ulng.rsmsgmasterpasswordenter
|
||
msgid "Please enter the master password:"
|
||
msgstr "Παρακαλώ εισάγετε το κύριο συνθηματικό:"
|
||
|
||
#: ulng.rsmsgnewfile
|
||
msgid "New file"
|
||
msgstr "Νέο Αρχείο"
|
||
|
||
#: ulng.rsmsgnextvolunpack
|
||
msgid "Next volume will be unpacked"
|
||
msgstr "Ο Επόμενος τόμος θα ξεπακεταριστεί"
|
||
|
||
#: ulng.rsmsgnofiles
|
||
msgid "No files"
|
||
msgstr "Δεν υπάρχουν αρχεία"
|
||
|
||
#: ulng.rsmsgnofilesselected
|
||
msgid "No files selected."
|
||
msgstr "Δεν έχουν επιλεχθεί αρχεία."
|
||
|
||
#: ulng.rsmsgnofreespacecont
|
||
msgid "No enough free space on target drive, Continue?"
|
||
msgstr "Όχι αρκετός ελεύθερος χώρος στον στοχευμένο οδηγό, Συνέχιση;"
|
||
|
||
#: ulng.rsmsgnofreespaceretry
|
||
msgid "No enough free space on target drive, Retry?"
|
||
msgstr "Όχι αρκετός ελεύθερος χώρος στον στοχευμένο οδηγό, Δοκιμή Ξανά;"
|
||
|
||
#: ulng.rsmsgnotdelete
|
||
msgid "Can not delete file %s"
|
||
msgstr "Αδυναμία διαγραφής αρχείου %s"
|
||
|
||
#: ulng.rsmsgnotimplemented
|
||
msgid "Not implemented."
|
||
msgstr "Δεν έχει εφαρμοστεί."
|
||
|
||
#: ulng.rsmsgobjectnotexists
|
||
msgid "Object does not exist!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgpanelpreview
|
||
msgctxt "ulng.rsmsgpanelpreview"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Παρακάτω είναι μία προεπισκόπηση. Μπορείται να μετακινήσετε τον κέρσορα και να επιλέξετε αρχεία ώστε να έχετε άμεσα μία πραγματική εικόνα και αίσθηση των διαφόρων ρυθμίσεων."
|
||
|
||
#: ulng.rsmsgpassword
|
||
msgid "Password:"
|
||
msgstr "Συνθηματικό:"
|
||
|
||
#: ulng.rsmsgpassworddiff
|
||
msgid "Passwords are different!"
|
||
msgstr "Τα συνθηματικά διαφέρουν!"
|
||
|
||
#: ulng.rsmsgpasswordenter
|
||
msgid "Please enter the password:"
|
||
msgstr "Παρακαλώ εισάγετε το συνθηματικό:"
|
||
|
||
#: ulng.rsmsgpasswordfirewall
|
||
msgid "Password (Firewall):"
|
||
msgstr "Συνθηματικό (Τείχος Προστασίας):"
|
||
|
||
#: ulng.rsmsgpasswordverify
|
||
msgid "Please re-enter the password for verification:"
|
||
msgstr "Παρακαλώ επανεισάγετε το συνθηματικό για ταυτοποίηση:"
|
||
|
||
#: ulng.rsmsgpopuphotdelete
|
||
msgid "&Delete %s"
|
||
msgstr "%Διαγραφή %s"
|
||
|
||
#: ulng.rsmsgpresetalreadyexists
|
||
msgid "Preset \"%s\" already exists. Overwrite?"
|
||
msgstr "Τα προκαθορισμένα \"%s\" ήδη υπάρχουν. Αντικατάσταση;"
|
||
|
||
#: ulng.rsmsgproblemexecutingcommand
|
||
msgid "Problem executing command (%s)"
|
||
msgstr "Πρόβλημα κατά την εκτέλεση της εντολής (%s)"
|
||
|
||
#: ulng.rsmsgpromptaskingfilename
|
||
msgid "Filename for dropped text:"
|
||
msgstr "Όνομα Αρχείου για εναποθετημένο κείμενο:"
|
||
|
||
#: ulng.rsmsgprovidethisfile
|
||
msgid "Please, make this file available. Retry?"
|
||
msgstr "Παρακαλώ, κάντε αυτό το αρχείο διαθέσιμο. Δοκιμή ξανά;"
|
||
|
||
#: ulng.rsmsgrenamefavtabs
|
||
msgid "Enter new friendly name for this Favorite Tabs"
|
||
msgstr "Εισαγωγή νέου φιλικού ονόματος για αυτή την Αγαπημένη Καρτέλα"
|
||
|
||
#: ulng.rsmsgrenamefavtabsmenu
|
||
msgid "Enter new name for this menu"
|
||
msgstr "Εισαγωγή νέου ονόματος για αυτό το μενού"
|
||
|
||
#: ulng.rsmsgrenfldr
|
||
msgid "Rename/move %d selected files/directories?"
|
||
msgstr "Μετονομασία/μετακίνηση %d επιλεγμένων αρχείων/καταλόγων;"
|
||
|
||
#: ulng.rsmsgrensel
|
||
msgid "Rename/move selected \"%s\"?"
|
||
msgstr "Μετονομασία/μετακίνηση επιλεγμένων \"%s\";"
|
||
|
||
#: ulng.rsmsgrestartforapplychanges
|
||
msgid "Please, restart Double Commander in order to apply changes"
|
||
msgstr "Παρακαλώ επανεκκινείστε τον Double Commander ώστε να εφαρμοστούν οι αλλαγές"
|
||
|
||
#: ulng.rsmsgsekectfiletype
|
||
msgid "Select to which file type to add extension \"%s\""
|
||
msgstr "Επιλογή σε ποιους τύπους αρχείων να προστεθεί επέκταση \"%s\""
|
||
|
||
#: ulng.rsmsgselectedinfo
|
||
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
||
msgstr "Επιλεγμένα: %s από %s, αρχεία: %d από %d, φάκελοι: %d από %d"
|
||
|
||
#: ulng.rsmsgselectexecutablefile
|
||
msgid "Select executable file for"
|
||
msgstr "Επιλογή εκτελέσιμου αρχείου για"
|
||
|
||
#: ulng.rsmsgselectonlychecksumfiles
|
||
msgid "Please select only checksum files!"
|
||
msgstr "Παρακαλώ επιλέξτε μόνο αρχεία αθροίσματος ελέγχου!"
|
||
|
||
#: ulng.rsmsgsellocnextvol
|
||
msgid "Please select location of next volume"
|
||
msgstr "Παρακαλώ επιλέξτε τοποθεσία του επόμενου τόμου"
|
||
|
||
#: ulng.rsmsgsetvolumelabel
|
||
msgid "Set volume label"
|
||
msgstr "Καθορισμός ετικέτας τόμου"
|
||
|
||
#: ulng.rsmsgspecialdir
|
||
msgid "Special Dirs"
|
||
msgstr "Ειδικοί Κατάλογοι"
|
||
|
||
#: ulng.rsmsgspecialdiraddacti
|
||
msgid "Add path from active frame"
|
||
msgstr "Προσθήκη διαδρομής από το ενεργό πλαίσιο"
|
||
|
||
#: ulng.rsmsgspecialdiraddnonacti
|
||
msgid "Add path from inactive frame"
|
||
msgstr "Προσθήκη διαδρομής από το ανενεργό πλαίσιο"
|
||
|
||
#: ulng.rsmsgspecialdirbrowssel
|
||
msgid "Browse and use selected path"
|
||
msgstr "Εξερεύνηση και χρήση της επιλεγμένης διαδρομής"
|
||
|
||
#: ulng.rsmsgspecialdirenvvar
|
||
msgid "Use environment variable..."
|
||
msgstr "Χρήση μεταβλητής περιβάλλοντος..."
|
||
|
||
#: ulng.rsmsgspecialdirgotodc
|
||
msgid "Go to Double Commander special path..."
|
||
msgstr "Μετάβαση στην ειδική διαδρομή του Double Commander..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoenvvar
|
||
msgid "Go to environment variable..."
|
||
msgstr "Μετάβαση στην μεταβλητή περιβάλλοντος..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoother
|
||
msgid "Go to other Windows special folder..."
|
||
msgstr "Μετάβαση σε άλλο ειδικό φάκελο των Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirgototc
|
||
msgid "Go to Windows special folder (TC)..."
|
||
msgstr "Μετάβαση στον ειδικό φάκελο των Windows (TC)..."
|
||
|
||
#: ulng.rsmsgspecialdirmakereltohotdir
|
||
msgid "Make relative to hotdir path"
|
||
msgstr "Δημιουργία σχετικής διαδρομής για την hotdir"
|
||
|
||
#: ulng.rsmsgspecialdirmkabso
|
||
msgid "Make path absolute"
|
||
msgstr "Ορίστε ως απόλυτη τη διαδρομή"
|
||
|
||
#: ulng.rsmsgspecialdirmkdcrel
|
||
msgid "Make relative to Double Commander special path..."
|
||
msgstr "Ορίστε ως σχετική την ειδική διαδρομή του Double Commander..."
|
||
|
||
#: ulng.rsmsgspecialdirmkenvrel
|
||
msgid "Make relative to environment variable..."
|
||
msgstr "Ορίστε ως σχετική για την μεταβλητή περιβάλλοντος..."
|
||
|
||
#: ulng.rsmsgspecialdirmktctel
|
||
msgid "Make relative to Windows special folder (TC)..."
|
||
msgstr "Ορίστε ως σχετική για τον ειδικό Windows φάκελο (TC)..."
|
||
|
||
#: ulng.rsmsgspecialdirmkwnrel
|
||
msgid "Make relative to other Windows special folder..."
|
||
msgstr "Ορίστε ως σχετική για άλλον ειδικό φάκελο των Windows... "
|
||
|
||
#: ulng.rsmsgspecialdirusedc
|
||
msgid "Use Double Commander special path..."
|
||
msgstr "Χρήση της ειδικής διαδρομής του Double Commander..."
|
||
|
||
#: ulng.rsmsgspecialdirusehotdir
|
||
msgid "Use hotdir path"
|
||
msgstr "Χρήση διαδρομής hotdir"
|
||
|
||
#: ulng.rsmsgspecialdiruseother
|
||
msgid "Use other Windows special folder..."
|
||
msgstr "Χρήση άλλου ειδικού φακέλου των Windows..."
|
||
|
||
#: ulng.rsmsgspecialdirusetc
|
||
msgid "Use Windows special folder (TC)..."
|
||
msgstr "Χρήση του ειδικού φακέλου των Windows (TC)..."
|
||
|
||
#: ulng.rsmsgtabforopeninginnewtab
|
||
msgid "This tab (%s) is locked! Open directory in another tab?"
|
||
msgstr "Αυτή η καρτέλα (%s) είναι κλειδωμένη! Άνοιγμα καταλόγου σε άλλη καρτέλα;"
|
||
|
||
#: ulng.rsmsgtabrenamecaption
|
||
msgid "Rename tab"
|
||
msgstr "Μετονομασία καρτέλας"
|
||
|
||
#: ulng.rsmsgtabrenameprompt
|
||
msgid "New tab name:"
|
||
msgstr "Όνομα νέας καρτέλας:"
|
||
|
||
#: ulng.rsmsgtargetdir
|
||
msgid "Target path:"
|
||
msgstr "Διαδρομή στόχου:"
|
||
|
||
#: ulng.rsmsgtcconfignotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration file:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Λάθος! Αδυναμία εύρεσης αρχείου TC ρυθμίσεων:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcexecutablenotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration executable:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Λάθος! Αδυναμία εύρεσης εκτελέσιμου TC ρυθμίσεων:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcisrunning
|
||
msgid ""
|
||
"Error! TC is still running but it should be closed for this operation.\n"
|
||
"Close it and press OK or press CANCEL to abort.\n"
|
||
msgstr ""
|
||
"Λάθος! Ο TC ακόμη λειτουργεί αλλά θα έπρεπε να είναι κλειστός για αυτή τη λειτουργία.\n"
|
||
"Κλείστε τον και πιέστε ΟΚ ή πιέστε ΑΚΥΡΩΣΗ για απόρριψη.\n"
|
||
|
||
#: ulng.rsmsgtctoolbarnotfound
|
||
msgid ""
|
||
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Λάθος! Αδυναμία εύρεσης επιθυμητού φακέλου εξαγωγής TC γραμμής εργαλείων:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a TC Toolbar file"
|
||
msgstr "Εισαγωγή τοποθεσίας και ονόματος αρχείου που θα αποθηκευθεί ένα αρχείο γραμμής εργαλείων του TC"
|
||
|
||
#: ulng.rsmsgthisisnowinclipboard
|
||
msgid "\"%s\" is now in the clipboard"
|
||
msgstr "\"%s\" είναι τώρα στο πρόχειρο"
|
||
|
||
#: ulng.rsmsgtitleextnotinfiletype
|
||
msgid "Extension of selected file is not in any recognized file types"
|
||
msgstr "Η Επέκταση του επιλεγμένου αρχείου δεν είναι κάποιος γνωστός τύπος αρχείου"
|
||
|
||
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
||
msgid "Locate \".toolbar\" file to import"
|
||
msgstr "Εντοπισμός \".toolbar\" αρχείο για εισαγωγή"
|
||
|
||
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
||
msgid "Locate \".BAR\" file to import"
|
||
msgstr "Εντοπισμός \".BAR\" αρχείο για εισαγωγή"
|
||
|
||
#: ulng.rsmsgtoolbarrestorewhat
|
||
msgid "Enter location and filename of Toolbar to restore"
|
||
msgstr "Εισαγωγή τοποθεσίας και ονόματος αρχείου της Γραμμής Εργαλείων για επαναφορά"
|
||
|
||
#: ulng.rsmsgtoolbarsaved
|
||
msgid ""
|
||
"Saved!\n"
|
||
"Toolbar filename: %s\n"
|
||
msgstr ""
|
||
"Αποθηκεύτηκε!\n"
|
||
"Όνομα Αρχείου Γραμμής Εργαλείων: %s\n"
|
||
|
||
#: ulng.rsmsgtoomanyfilesselected
|
||
msgid "Too many files selected."
|
||
msgstr "Έχουν επιλεχθεί πάρα πολλά αρχεία."
|
||
|
||
#: ulng.rsmsgundeterminednumberoffile
|
||
msgid "Undetermined"
|
||
msgstr "Απροσδιόριστο"
|
||
|
||
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
||
msgid "ERROR: Unexpected Tree View Menu usage!"
|
||
msgstr "ΛΑΘΟΣ: Μη προβλεπόμενη χρήση Μενού Προβολής Δέντρου!"
|
||
|
||
#: ulng.rsmsgurl
|
||
msgid "URL:"
|
||
msgstr "URL:"
|
||
|
||
#: ulng.rsmsguserdidnotsetextension
|
||
msgid "<NO EXT>"
|
||
msgstr "<ΟΧΙ ΕΞΩΤΕΡ>"
|
||
|
||
#: ulng.rsmsguserdidnotsetname
|
||
msgid "<NO NAME>"
|
||
msgstr "<ΧΩΡΙΣ ΟΝΟΜΑ>"
|
||
|
||
#: ulng.rsmsgusername
|
||
msgid "User name:"
|
||
msgstr "Όνομα Χρήστη:"
|
||
|
||
#: ulng.rsmsgusernamefirewall
|
||
msgid "User name (Firewall):"
|
||
msgstr "Όνομα χρήστη (Τείχος Προστασίας):"
|
||
|
||
#: ulng.rsmsgvolumelabel
|
||
msgid "Volume label:"
|
||
msgstr "Ετικέτα τόμου:"
|
||
|
||
#: ulng.rsmsgvolumesizeenter
|
||
msgid "Please enter the volume size:"
|
||
msgstr "Παρακαλώ εισαγάγετε το μέγεθος τόμου:"
|
||
|
||
#: ulng.rsmsgwipefldr
|
||
msgid "Wipe %d selected files/directories?"
|
||
msgstr "Ασφαλής Διαγραφή %d επιλεγμένων αρχείων/καταλόγων;"
|
||
|
||
#: ulng.rsmsgwipesel
|
||
msgid "Wipe selected \"%s\"?"
|
||
msgstr "Ασφαλής Διαγραφή επιλεγμένων \"%s\";"
|
||
|
||
#: ulng.rsmsgwithactionwith
|
||
msgid "with"
|
||
msgstr "με"
|
||
|
||
#: ulng.rsmulrenautorename
|
||
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmulrenfilenamestylelist
|
||
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
||
msgstr "Χωρίς αλλαγή;ΚΕΦΑΛΑΙΟ;μικρό;Πρώτο γράμμα κεφαλαίο;Πρώτο Γράμμα κάθε Λέξης Κεφαλαίο;"
|
||
|
||
#: ulng.rsmulrenwarningduplicate
|
||
msgid "Warning, duplicate names!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmulrenwronglinesnumber
|
||
msgid "File contains wrong number of lines: %d, should be %d!"
|
||
msgstr "Το Αρχείο περιέχει λάθος αριθμό γραμμών: Το %d, θα έπρεπε να είναι %d!"
|
||
|
||
#: ulng.rsnewsearchclearfilteroptions
|
||
msgid "Keep;Clear;Prompt"
|
||
msgstr "Διατήρηση;Καθαρισμός;Υπενθύμιση"
|
||
|
||
#: ulng.rsnoequivalentinternalcommand
|
||
msgid "No internal equivalent command"
|
||
msgstr "Δεν υπάρχει ισοδύναμη εσωτερική εντολή"
|
||
|
||
#: ulng.rsnofindfileswindowyet
|
||
msgid "Sorry, no \"Find files\" window yet..."
|
||
msgstr "Λυπούμαστε, δεν υπάρχει παράθυρο \"Αναζήτηση Αρχείων\" ακόμη..."
|
||
|
||
#: ulng.rsnootherfindfileswindowtoclose
|
||
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
||
msgstr "Λυπούμαστε, δεν υπάρχει άλλο παράθυρο \"Αναζήτηση Αρχείων\" προς κλείσιμο και απελευθέρωση από τη μνήμη..."
|
||
|
||
#: ulng.rsoperaborted
|
||
msgid "Aborted"
|
||
msgstr "Έχει απορριφθεί"
|
||
|
||
#: ulng.rsopercalculatingchecksum
|
||
msgid "Calculating checksum"
|
||
msgstr "Υπολογισμός αθροίσματος ελέγχου"
|
||
|
||
#: ulng.rsopercalculatingchecksumin
|
||
msgid "Calculating checksum in \"%s\""
|
||
msgstr "Υπολογισμός αθροίσματος ελέγχου σε \"%s\""
|
||
|
||
#: ulng.rsopercalculatingchecksumof
|
||
msgid "Calculating checksum of \"%s\""
|
||
msgstr "Υπολογισμός αθροίσματος ελέγχου του \"%s\""
|
||
|
||
#: ulng.rsopercalculatingstatictics
|
||
msgctxt "ulng.rsopercalculatingstatictics"
|
||
msgid "Calculating"
|
||
msgstr "Υπολογισμός"
|
||
|
||
#: ulng.rsopercalculatingstatisticsin
|
||
msgid "Calculating \"%s\""
|
||
msgstr "Υπολογισμός \"%s\""
|
||
|
||
#: ulng.rsopercombining
|
||
msgid "Joining"
|
||
msgstr "Ένωση"
|
||
|
||
#: ulng.rsopercombiningfromto
|
||
msgid "Joining files in \"%s\" to \"%s\""
|
||
msgstr "Ένωση αρχείων από \"%s\" σε \"%s\""
|
||
|
||
#: ulng.rsopercopying
|
||
msgid "Copying"
|
||
msgstr "Αντιγραφή"
|
||
|
||
#: ulng.rsopercopyingfromto
|
||
msgid "Copying from \"%s\" to \"%s\""
|
||
msgstr "Αντιγραφή από \"%s\" σε \"%s\""
|
||
|
||
#: ulng.rsopercopyingsomethingto
|
||
msgid "Copying \"%s\" to \"%s\""
|
||
msgstr "Αντιγραφή \"%s\" σε \"%s\""
|
||
|
||
#: ulng.rsopercreatingdirectory
|
||
msgid "Creating directory"
|
||
msgstr "Δημιουργία καταλόγου"
|
||
|
||
#: ulng.rsopercreatingsomedirectory
|
||
msgid "Creating directory \"%s\""
|
||
msgstr "Δημιουργία καταλόγου \"%s\""
|
||
|
||
#: ulng.rsoperdeleting
|
||
msgctxt "ulng.rsoperdeleting"
|
||
msgid "Deleting"
|
||
msgstr "Διαγραφή"
|
||
|
||
#: ulng.rsoperdeletingin
|
||
msgid "Deleting in \"%s\""
|
||
msgstr "Διαγραφή σε \"%s\" "
|
||
|
||
#: ulng.rsoperdeletingsomething
|
||
msgid "Deleting \"%s\""
|
||
msgstr "Διαγραφή \"%s\""
|
||
|
||
#: ulng.rsoperexecuting
|
||
msgid "Executing"
|
||
msgstr "Εκτέλεση"
|
||
|
||
#: ulng.rsoperexecutingsomething
|
||
msgid "Executing \"%s\""
|
||
msgstr "Εκτέλεση \"%s\""
|
||
|
||
#: ulng.rsoperextracting
|
||
msgid "Extracting"
|
||
msgstr "Εξαγωγή"
|
||
|
||
#: ulng.rsoperextractingfromto
|
||
msgid "Extracting from \"%s\" to \"%s\""
|
||
msgstr "Εξαγωγή από \"%s\" σε \"%s\""
|
||
|
||
#: ulng.rsoperfinished
|
||
msgid "Finished"
|
||
msgstr "Τελείωσε"
|
||
|
||
#: ulng.rsoperlisting
|
||
msgid "Listing"
|
||
msgstr "Προβολή Λίστας"
|
||
|
||
#: ulng.rsoperlistingin
|
||
msgid "Listing \"%s\""
|
||
msgstr "Προβολή Λίστας \"%s\""
|
||
|
||
#: ulng.rsopermoving
|
||
msgid "Moving"
|
||
msgstr "Μετακίνηση"
|
||
|
||
#: ulng.rsopermovingfromto
|
||
msgid "Moving from \"%s\" to \"%s\""
|
||
msgstr "Μετακίνηση από \"%s\"σε \"%s\""
|
||
|
||
#: ulng.rsopermovingsomethingto
|
||
msgid "Moving \"%s\" to \"%s\""
|
||
msgstr "Μετακίνηση \"%s\"σε \"%s\""
|
||
|
||
#: ulng.rsopernotstarted
|
||
msgid "Not started"
|
||
msgstr "Δεν έχει εκκινηθεί"
|
||
|
||
#: ulng.rsoperpacking
|
||
msgid "Packing"
|
||
msgstr "Πακετάρισμα"
|
||
|
||
#: ulng.rsoperpackingfromto
|
||
msgid "Packing from \"%s\" to \"%s\""
|
||
msgstr "Πακετάρισμα από \"%s\" σε \"%s\""
|
||
|
||
#: ulng.rsoperpackingsomethingto
|
||
msgid "Packing \"%s\" to \"%s\""
|
||
msgstr "Πακετάρισμα \"%s\" σε \"%s\""
|
||
|
||
#: ulng.rsoperpaused
|
||
msgid "Paused"
|
||
msgstr "Έχει παυθεί"
|
||
|
||
#: ulng.rsoperpausing
|
||
msgid "Pausing"
|
||
msgstr "Παύση"
|
||
|
||
#: ulng.rsoperrunning
|
||
msgid "Running"
|
||
msgstr "Εκτέλεση"
|
||
|
||
#: ulng.rsopersettingproperty
|
||
msgid "Setting property"
|
||
msgstr "Καθορισμός ιδιότητας"
|
||
|
||
#: ulng.rsopersettingpropertyin
|
||
msgid "Setting property in \"%s\""
|
||
msgstr "Καθορισμός ιδιότητας σε \"%s\""
|
||
|
||
#: ulng.rsopersettingpropertyof
|
||
msgid "Setting property of \"%s\""
|
||
msgstr "Καθορισμός ιδιότητας των \"%s\""
|
||
|
||
#: ulng.rsopersplitting
|
||
msgid "Splitting"
|
||
msgstr "Διαμερισμός"
|
||
|
||
#: ulng.rsopersplittingfromto
|
||
msgid "Splitting \"%s\" to \"%s\""
|
||
msgstr "Διαμερισμός \"%s\"σε \"%s\""
|
||
|
||
#: ulng.rsoperstarting
|
||
msgid "Starting"
|
||
msgstr "Εκκίνηση"
|
||
|
||
#: ulng.rsoperstopped
|
||
msgid "Stopped"
|
||
msgstr "Σταματημένο"
|
||
|
||
#: ulng.rsoperstopping
|
||
msgid "Stopping"
|
||
msgstr "Σταμάτημα"
|
||
|
||
#: ulng.rsopertesting
|
||
msgid "Testing"
|
||
msgstr "Δοκιμή"
|
||
|
||
#: ulng.rsopertestingin
|
||
msgid "Testing in \"%s\""
|
||
msgstr "Δοκιμή σε \"%s\""
|
||
|
||
#: ulng.rsopertestingsomething
|
||
msgid "Testing \"%s\""
|
||
msgstr "Δοκιμή \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksum
|
||
msgid "Verifying checksum"
|
||
msgstr "Επιβεβαίωση αθροίσματος ελέγχου"
|
||
|
||
#: ulng.rsoperverifyingchecksumin
|
||
msgid "Verifying checksum in \"%s\""
|
||
msgstr "Επιβεβαίωση αθροίσματος ελέγχου σε \"%s\""
|
||
|
||
#: ulng.rsoperverifyingchecksumof
|
||
msgid "Verifying checksum of \"%s\""
|
||
msgstr "Επιβεβαίωση αθροίσματος ελέγχου του \"%s\""
|
||
|
||
#: ulng.rsoperwaitingforconnection
|
||
msgid "Waiting for access to file source"
|
||
msgstr "Αναμονή για πρόσβαση στην πηγή αρχείων"
|
||
|
||
#: ulng.rsoperwaitingforfeedback
|
||
msgid "Waiting for user response"
|
||
msgstr "Αναμονή για απόκριση από τον χρήστη"
|
||
|
||
#: ulng.rsoperwiping
|
||
msgid "Wiping"
|
||
msgstr "Ασφαλής Διαγραφή"
|
||
|
||
#: ulng.rsoperwipingin
|
||
msgid "Wiping in \"%s\""
|
||
msgstr "Ασφαλής Διαγραφή σε \"%s\""
|
||
|
||
#: ulng.rsoperwipingsomething
|
||
msgid "Wiping \"%s\""
|
||
msgstr "Ασφαλής Διαγραφή \"%s\""
|
||
|
||
#: ulng.rsoperworking
|
||
msgid "Working"
|
||
msgstr "Επεξεργασία"
|
||
|
||
#: ulng.rsoptaddfrommainpanel
|
||
msgid "Add at &beginning;Add at the end;Smart add"
|
||
msgstr "Προσθήκη στην αρχή;Προσθήκη στο τέλος;Έξυπνη προσθήκη"
|
||
|
||
#: ulng.rsoptarchivedelete
|
||
msgctxt "ulng.rsoptarchivedelete"
|
||
msgid "Delete:"
|
||
msgstr "Διαγραφή:"
|
||
|
||
#: ulng.rsoptarchiveextractwithoutpath
|
||
msgid "Extract without path:"
|
||
msgstr "Εξαγωγή χωρίς διαδρομή:"
|
||
|
||
#: ulng.rsoptarchiveformmode
|
||
msgid "Format parsing mode:"
|
||
msgstr "Λειτουργία ανάλυσης μορφής:"
|
||
|
||
#: ulng.rsoptarchiveid
|
||
msgctxt "ulng.rsoptarchiveid"
|
||
msgid "ID:"
|
||
msgstr "ID:"
|
||
|
||
#: ulng.rsoptarchiveidpos
|
||
msgctxt "ulng.rsoptarchiveidpos"
|
||
msgid "ID Position:"
|
||
msgstr "Θέση ID:"
|
||
|
||
#: ulng.rsoptarchiveidseekrange
|
||
msgctxt "ulng.rsoptarchiveidseekrange"
|
||
msgid "ID Seek Range:"
|
||
msgstr "Διάστημα Αναζήτησης ID:"
|
||
|
||
#: ulng.rsoptarchiveparam
|
||
msgid "Parameter"
|
||
msgstr "Παράμετρος"
|
||
|
||
#: ulng.rsoptarchivepasswordquery
|
||
msgid "Password query string:"
|
||
msgstr "Γραμμή εισαγωγής συνθηματικού:"
|
||
|
||
#: ulng.rsoptarchiveselfextract
|
||
msgctxt "ulng.rsoptarchiveselfextract"
|
||
msgid "Create self extracting archive:"
|
||
msgstr "Δημιουργία αυτοεξαγώμενου αρχείου:"
|
||
|
||
#: ulng.rsoptarchivetest
|
||
msgctxt "ulng.rsoptarchivetest"
|
||
msgid "Test:"
|
||
msgstr "Test:"
|
||
|
||
#: ulng.rsoptarchivetypename
|
||
msgid "Archive type name:"
|
||
msgstr "Όνομα τύπου αρχειοθήκης:"
|
||
|
||
#: ulng.rsoptarchivevalue
|
||
msgctxt "ulng.rsoptarchivevalue"
|
||
msgid "Value"
|
||
msgstr "Τιμή"
|
||
|
||
#: ulng.rsoptassocpluginwith
|
||
msgid "Associate plugin \"%s\" with:"
|
||
msgstr "Συσχετισμός του προσθέτου \"%s\" με:"
|
||
|
||
#: ulng.rsoptautosizecolumn
|
||
msgid "First;Last;"
|
||
msgstr "Πρώτο;Τελευταίο;"
|
||
|
||
#: ulng.rsoptconfigsortorder
|
||
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
||
msgstr "Κλασική, σειρά legacy;Αλφαβητική σειρά (αλλά η γλώσσα ακόμη πρώτη)"
|
||
|
||
#: ulng.rsoptdifferframeposition
|
||
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
||
msgstr "Ενεργό πλαισιακό πάνελ στα αριστερά, ανενεργό στα δεξιά (legacy);Αριστερό πλαισιακό πάνελ στα αριστερά, δεξιό στα δεξιά"
|
||
|
||
#: ulng.rsoptdisable
|
||
msgid "Disable"
|
||
msgstr "Απενεργοποίηση"
|
||
|
||
#: ulng.rsoptenable
|
||
msgctxt "ulng.rsoptenable"
|
||
msgid "Enable"
|
||
msgstr "Ενεργοποίηση"
|
||
|
||
#: ulng.rsoptenterext
|
||
msgid "Enter extension"
|
||
msgstr "Εισάγετε επέκταση"
|
||
|
||
#: ulng.rsoptfavoritetabswheretoaddinlist
|
||
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
||
msgstr "Προσθήκη στην αρχή;Προσθήκη στο τέλος;Με Αλφαβητική σειρά"
|
||
|
||
#: ulng.rsoptfileoperationsprogresskind
|
||
msgid "separate window;minimized separate window;operations panel"
|
||
msgstr "ξεχωριστό παράθυρο;ελαχιστοποιημένο ξεχωριστό παράθυρο;πάνελ λειτουργειών"
|
||
|
||
#: ulng.rsoptfilesizeformat
|
||
msgid "float;B;K;M;G"
|
||
msgstr "float;B;K;M;G"
|
||
|
||
#: ulng.rsopthotkeysadddeleteshortcutlong
|
||
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
||
msgstr "Η συντόμευση %s για το cm_Delete θα κατοχυρωθεί, ώστε να χρησιμοποιηθεί για να γίνει αντιστροφή αυτής της ρύθμισης.."
|
||
|
||
#: ulng.rsopthotkeysaddhotkey
|
||
msgid "Add hotkey for %s"
|
||
msgstr "Προσθήκη ειδικού πλήκτρου για %s"
|
||
|
||
#: ulng.rsopthotkeysaddshortcutbutton
|
||
msgid "Add shortcut"
|
||
msgstr "Προσθήκη συντόμευσης"
|
||
|
||
#: ulng.rsopthotkeyscannotsetshortcut
|
||
msgid "Cannot set shortcut"
|
||
msgstr "Αδυναμία καθορισμού συντόμευσης"
|
||
|
||
#: ulng.rsopthotkeyschangeshortcut
|
||
msgid "Change shortcut"
|
||
msgstr "Αλλαγή συντόμευσης"
|
||
|
||
#: ulng.rsopthotkeyscommand
|
||
msgctxt "ulng.rsopthotkeyscommand"
|
||
msgid "Command"
|
||
msgstr "Εντολή"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
||
msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides"
|
||
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
||
msgstr "Η συντόμευση %s για το cm_Delete έχει μία παράμετρο που αντικαθιστά αυτή τη ρύθμιση. Επιθυμείτε να αλλάξετε αυτή τη παράμετρο και να κάνετε χρήση των γενικών ρυθμίσεων;"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
||
msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists"
|
||
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
||
msgstr "Η συντόμευση %s για το cm_Delete πρέπει να έχει μία παράμετρο που να ταιριάζει με τη συντόμευση %s. Επιθυμείτε να την αλλάξετε;"
|
||
|
||
#: ulng.rsopthotkeysdescription
|
||
msgctxt "ulng.rsopthotkeysdescription"
|
||
msgid "Description"
|
||
msgstr "Περιγραφή"
|
||
|
||
#: ulng.rsopthotkeysedithotkey
|
||
msgid "Edit hotkey for %s"
|
||
msgstr "Ρύθμιση ειδικού πλήκτρου για %s"
|
||
|
||
#: ulng.rsopthotkeysfixparameter
|
||
msgid "Fix parameter"
|
||
msgstr "Διόρθωση παραμέτρου"
|
||
|
||
#: ulng.rsopthotkeyshotkey
|
||
msgctxt "ulng.rsopthotkeyshotkey"
|
||
msgid "Hotkey"
|
||
msgstr "Ειδικό Πλήκτρο"
|
||
|
||
#: ulng.rsopthotkeyshotkeys
|
||
msgctxt "ulng.rsopthotkeyshotkeys"
|
||
msgid "Hotkeys"
|
||
msgstr "Ειδικά Πλήκτρα"
|
||
|
||
#: ulng.rsopthotkeysnohotkey
|
||
msgid "<none>"
|
||
msgstr "<κανένα>"
|
||
|
||
#: ulng.rsopthotkeysparameters
|
||
msgctxt "ulng.rsopthotkeysparameters"
|
||
msgid "Parameters"
|
||
msgstr "Παράμετροι"
|
||
|
||
#: ulng.rsopthotkeyssetdeleteshortcut
|
||
msgid "Set shortcut to delete file"
|
||
msgstr "Καθορισμός συντόμευσης για διαγραφή αρχείου"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
||
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
||
msgstr "Για να λειτουργήσει αυτή η ρύθμιση με τη συντόμευση %s, η συντόμευση %s πρέπει να κατοχυρωθεί στο cm_Delete αλλά είναι ήδη εκχωρημένη στο %s. Επιθυμείτε να την αλλάξετε;"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
||
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
||
msgstr "Η συντόμευση %s για το cm_Delete είναι μία ακολουθία συντόμευσης για την οποία ένα ειδικό πλήκτρο που να απασχολεί το Shift δεν μπορεί να οριστεί. Αυτή η ρύθμιση πιθανώς δε θα λειτουργήσει."
|
||
|
||
#: ulng.rsopthotkeysshortcutused
|
||
msgid "Shortcut in use"
|
||
msgstr "Συντόμευση σε χρήση"
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext1
|
||
msgid "Shortcut %s is already used."
|
||
msgstr "Συντόμευση %s έχει ήδη χρησιμοποιηθεί."
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext2
|
||
msgid "Change it to %s?"
|
||
msgstr "Αλλαγή σε %s;"
|
||
|
||
#: ulng.rsopthotkeysusedby
|
||
msgid "used for %s in %s"
|
||
msgstr "χρησιμοποιείται για %s σε %s"
|
||
|
||
#: ulng.rsopthotkeysusedwithdifferentparams
|
||
msgid "used for this command but with different parameters"
|
||
msgstr "χρησιμοποιείται για αυτή την εντολή αλλά με διαφορετικές παραμέτρους"
|
||
|
||
#: ulng.rsoptionseditorarchivers
|
||
msgctxt "ulng.rsoptionseditorarchivers"
|
||
msgid "Archivers"
|
||
msgstr "Εφαρμογές Συμπίεσης"
|
||
|
||
#: ulng.rsoptionseditorautorefresh
|
||
msgctxt "ulng.rsoptionseditorautorefresh"
|
||
msgid "Auto refresh"
|
||
msgstr "Αυτόματη Ανανέωση"
|
||
|
||
#: ulng.rsoptionseditorbehavior
|
||
msgctxt "ulng.rsoptionseditorbehavior"
|
||
msgid "Behaviors"
|
||
msgstr "Γενικές Ρυθμίσεις"
|
||
|
||
#: ulng.rsoptionseditorbriefview
|
||
msgctxt "ulng.rsoptionseditorbriefview"
|
||
msgid "Brief"
|
||
msgstr "Σύντομα"
|
||
|
||
#: ulng.rsoptionseditorcolors
|
||
msgctxt "ulng.rsoptionseditorcolors"
|
||
msgid "Colors"
|
||
msgstr "Χρώματα"
|
||
|
||
#: ulng.rsoptionseditorcolumnsview
|
||
msgid "Columns"
|
||
msgstr "Στήλες"
|
||
|
||
#: ulng.rsoptionseditorconfiguration
|
||
msgctxt "ulng.rsoptionseditorconfiguration"
|
||
msgid "Configuration"
|
||
msgstr "Διαμόρφωση"
|
||
|
||
#: ulng.rsoptionseditorcustomcolumns
|
||
msgid "Custom columns"
|
||
msgstr "Προσαρμοσμένες στήλες"
|
||
|
||
#: ulng.rsoptionseditordirectoryhotlist
|
||
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Κατάλογος Hotlist"
|
||
|
||
#: ulng.rsoptionseditordraganddrop
|
||
msgid "Drag & drop"
|
||
msgstr "Μεταφορά & απόθεση"
|
||
|
||
#: ulng.rsoptionseditordriveslistbutton
|
||
msgid "Drives list button"
|
||
msgstr "Κουμπιά Λίστας Οδηγών"
|
||
|
||
#: ulng.rsoptionseditorfavoritetabs
|
||
msgid "Favorite Tabs"
|
||
msgstr "Αγαπημένες Καρτέλες"
|
||
|
||
#: ulng.rsoptionseditorfileassicextra
|
||
msgid "File associations extra"
|
||
msgstr "Έξτρα Συσχετισμών Αρχείου"
|
||
|
||
#: ulng.rsoptionseditorfileassoc
|
||
msgctxt "ulng.rsoptionseditorfileassoc"
|
||
msgid "File associations"
|
||
msgstr "Συσχετισμοί Αρχείου"
|
||
|
||
#: ulng.rsoptionseditorfilenewfiletypes
|
||
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
||
msgid "New"
|
||
msgstr "Νέο"
|
||
|
||
#: ulng.rsoptionseditorfileoperations
|
||
msgctxt "ulng.rsoptionseditorfileoperations"
|
||
msgid "File operations"
|
||
msgstr "Λειτουργίες Αρχείου"
|
||
|
||
#: ulng.rsoptionseditorfilepanels
|
||
msgctxt "ulng.rsoptionseditorfilepanels"
|
||
msgid "File panels"
|
||
msgstr "Πάνελ Αρχείων"
|
||
|
||
#: ulng.rsoptionseditorfilesearch
|
||
msgctxt "ulng.rsoptionseditorfilesearch"
|
||
msgid "File search"
|
||
msgstr "Αναζήτηση Αρχείου"
|
||
|
||
#: ulng.rsoptionseditorfilesviews
|
||
msgid "Files views"
|
||
msgstr "Προβολές Αρχείων"
|
||
|
||
#: ulng.rsoptionseditorfiletypes
|
||
msgctxt "ulng.rsoptionseditorfiletypes"
|
||
msgid "File types"
|
||
msgstr "Τύποι Αρχείου"
|
||
|
||
#: ulng.rsoptionseditorfoldertabs
|
||
msgctxt "ulng.rsoptionseditorfoldertabs"
|
||
msgid "Folder tabs"
|
||
msgstr "Καρτέλες Φακέλων"
|
||
|
||
#: ulng.rsoptionseditorfoldertabsextra
|
||
msgid "Folder tabs extra"
|
||
msgstr "Έξτρα Καρτελών Φακέλων"
|
||
|
||
#: ulng.rsoptionseditorfonts
|
||
msgctxt "ulng.rsoptionseditorfonts"
|
||
msgid "Fonts"
|
||
msgstr "Γραμματοσειρές"
|
||
|
||
#: ulng.rsoptionseditorhighlighters
|
||
msgid "Highlighters"
|
||
msgstr "Μαρκαδόροι"
|
||
|
||
#: ulng.rsoptionseditorhotkeys
|
||
msgctxt "ulng.rsoptionseditorhotkeys"
|
||
msgid "Hot keys"
|
||
msgstr "Ειδικά Πλήκτρα"
|
||
|
||
#: ulng.rsoptionseditoricons
|
||
msgctxt "ulng.rsoptionseditoricons"
|
||
msgid "Icons"
|
||
msgstr "Εικονίδια"
|
||
|
||
#: ulng.rsoptionseditorignorelist
|
||
msgctxt "ulng.rsoptionseditorignorelist"
|
||
msgid "Ignore list"
|
||
msgstr "Λίστα Αγνοημένων"
|
||
|
||
#: ulng.rsoptionseditorkeyboard
|
||
msgid "Keys"
|
||
msgstr "Πλήκτρα"
|
||
|
||
#: ulng.rsoptionseditorlanguage
|
||
msgctxt "ulng.rsoptionseditorlanguage"
|
||
msgid "Language"
|
||
msgstr "Γλώσσα"
|
||
|
||
#: ulng.rsoptionseditorlayout
|
||
msgctxt "ulng.rsoptionseditorlayout"
|
||
msgid "Layout"
|
||
msgstr "Διάταξη"
|
||
|
||
#: ulng.rsoptionseditorlog
|
||
msgctxt "ulng.rsoptionseditorlog"
|
||
msgid "Log"
|
||
msgstr "Καταγραφή"
|
||
|
||
#: ulng.rsoptionseditormiscellaneous
|
||
msgctxt "ulng.rsoptionseditormiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Διάφορα"
|
||
|
||
#: ulng.rsoptionseditormouse
|
||
msgid "Mouse"
|
||
msgstr "Ποντίκι"
|
||
|
||
#: ulng.rsoptionseditoroptionschanged
|
||
msgid ""
|
||
"Options have changed in \"%s\"\n"
|
||
"\n"
|
||
"Do you want to save modifications?\n"
|
||
msgstr ""
|
||
"Οι Ρυθμίσεις έχουν αλλάξει στο \"%s\"\n"
|
||
"\n"
|
||
"Επιθυμείτε αποθήκευση των αλλαγών?\n"
|
||
|
||
#: ulng.rsoptionseditorplugins
|
||
msgctxt "ulng.rsoptionseditorplugins"
|
||
msgid "Plugins"
|
||
msgstr "Πρόσθετα"
|
||
|
||
#: ulng.rsoptionseditorquicksearch
|
||
msgctxt "ulng.rsoptionseditorquicksearch"
|
||
msgid "Quick search/filter"
|
||
msgstr "Φίλτρο ταχείας αναζήτησης"
|
||
|
||
#: ulng.rsoptionseditorterminal
|
||
msgctxt "ulng.rsoptionseditorterminal"
|
||
msgid "Terminal"
|
||
msgstr "Τερματικό"
|
||
|
||
#: ulng.rsoptionseditortoolbar
|
||
msgid "Toolbar"
|
||
msgstr "Γραμμή εργαλείων"
|
||
|
||
#: ulng.rsoptionseditortools
|
||
msgctxt "ulng.rsoptionseditortools"
|
||
msgid "Tools"
|
||
msgstr "Εργαλεία"
|
||
|
||
#: ulng.rsoptionseditortooltips
|
||
msgctxt "ulng.rsoptionseditortooltips"
|
||
msgid "Tooltips"
|
||
msgstr "Υποδείξεις"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenu
|
||
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
||
msgid "Tree View Menu"
|
||
msgstr "Μενού Προβολής Δέντρου"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenucolors
|
||
msgid "Tree View Menu Colors"
|
||
msgstr "Χρώματα Μενού Προβολής Δέντρου"
|
||
|
||
#: ulng.rsoptletters
|
||
msgid "None;Command Line;Quick Search;Quick Filter"
|
||
msgstr "Κανένα;Γραμμή Εντολών;Ταχεία αναζήτηση;Γρήγορο Φίλτρο"
|
||
|
||
#: ulng.rsoptmouseselectionbutton
|
||
msgid "Left button;Right button;"
|
||
msgstr "Αριστερό Κουμπί;Δεξιό Κουμπί;"
|
||
|
||
#: ulng.rsoptnewfilesposition
|
||
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
||
msgstr "στην κορυφή της λίστας αρχείου;μετά τους καταλόγους (αν οι κατάλογοι είναι τοποθετημένοι πριν τα αρχεία);σε ταξινομημένη θέση;στο τέλος της λίστας αρχείου"
|
||
|
||
#: ulng.rsoptpluginalreadyassigned
|
||
msgid "Plugin %s is already assigned for the following extensions:"
|
||
msgstr "Το Πρόσθετο %s έχει ήδη εκχωρηθεί για τις ακόλουθες επεκτάσεις:"
|
||
|
||
#: ulng.rsoptpluginsactive
|
||
msgctxt "ulng.rsoptpluginsactive"
|
||
msgid "Active"
|
||
msgstr "Ενεργό"
|
||
|
||
#: ulng.rsoptpluginsfilename
|
||
msgctxt "ulng.rsoptpluginsfilename"
|
||
msgid "File name"
|
||
msgstr "Ονομασία αρχείου"
|
||
|
||
#: ulng.rsoptpluginsname
|
||
msgctxt "ulng.rsoptpluginsname"
|
||
msgid "Name"
|
||
msgstr "Όνομα"
|
||
|
||
#: ulng.rsoptpluginsregisteredfor
|
||
msgctxt "ulng.rsoptpluginsregisteredfor"
|
||
msgid "Registered for"
|
||
msgstr "Έχει καταχωρηθεί σε"
|
||
|
||
#: ulng.rsoptsearchcase
|
||
msgid "&Sensitive;&Insensitive"
|
||
msgstr "Ενεργοποιημένο;Απενεργοποιημένο"
|
||
|
||
#: ulng.rsoptsearchitems
|
||
msgid "&Files;Di&rectories;Files a&nd Directories"
|
||
msgstr "Αρχεία;Κατάλογοι;Αρχεία και Κατάλογοι"
|
||
|
||
#: ulng.rsoptsearchopt
|
||
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
||
msgstr "&Κρύψιμο του πάνελ φίλτρου όταν δεν είναι εστιασμένο;συνέχιση αποθήκευσης ρυθμίσεων μετατροπών για την επόμενη συνεδρία"
|
||
|
||
#: ulng.rsoptsortcasesens
|
||
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
||
msgstr "χωρίς διάκριση πεζών-κεφαλαίων;σύμφωνα με τις ρυθμίσεις εντοπιότητας (αΑβΒγΓ);το πρώτο πεζό μετά κεφαλαίο (ΑΒΓαβγ)"
|
||
|
||
#: ulng.rsoptsortfoldermode
|
||
msgid "sort by name and show first;sort like files and show first;sort like files"
|
||
msgstr "ταξινόμηση κατά όνομα και εμφάνιση του πρώτου;ταξινόμηση σαν αρχεία και εμφάνιση του πρώτου;ταξινόμηση σαν αρχεία"
|
||
|
||
#: ulng.rsoptsortmethod
|
||
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
||
msgstr "Αλφαβητικά, σε σχέση με τον τονισμό;φυσική κατάταξη: αλφαβητικά και αριθμητικά"
|
||
|
||
#: ulng.rsopttabsposition
|
||
msgid "Top;Bottom;"
|
||
msgstr "Κορυφή;Κάτω;"
|
||
|
||
#: ulng.rsopttoolbarbuttontype
|
||
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
||
msgstr "Διαχωριστικό;Εσωτερική εντολή;Εξωτερική εντολή;Μενού"
|
||
|
||
#: ulng.rsopttypeofduplicatedrename
|
||
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
||
msgstr "DC legacy - Αντιγραφή (x) όνομα_αρχείου.επέκταση;Windows - όνομα_αρχείου (x).επέκταση;Άλλα - όνομα_αρχείου(x).επέκταση"
|
||
|
||
#: ulng.rsoptupdatedfilesposition
|
||
msgid "don't change position;use the same setting as for new files;to sorted position"
|
||
msgstr "χωρίς αλλαγή θέσης;χρήση της ίδιας ρύθμισης με τα νέα αρχεία;σε ταξινομημένη θέση"
|
||
|
||
#: ulng.rspropscontains
|
||
msgid "Files: %d, folders: %d"
|
||
msgstr "Αρχεία: %d, Φάκελοι: %d"
|
||
|
||
#: ulng.rspropserrchmod
|
||
msgid "Can not change access rights for \"%s\""
|
||
msgstr "Αδυναμία αλλαγής δικαιωμάτων πρόσβασης για \"%s\""
|
||
|
||
#: ulng.rspropserrchown
|
||
msgid "Can not change owner for \"%s\""
|
||
msgstr "Αδυναμία αλλαγής ιδιοκτησίας για \"%s\""
|
||
|
||
#: ulng.rspropsfile
|
||
msgctxt "ulng.rspropsfile"
|
||
msgid "File"
|
||
msgstr "Αρχείο"
|
||
|
||
#: ulng.rspropsfolder
|
||
msgctxt "ulng.rspropsfolder"
|
||
msgid "Directory"
|
||
msgstr "Κατάλογος"
|
||
|
||
#: ulng.rspropsnmdpipe
|
||
msgid "Named pipe"
|
||
msgstr "Ονομασμένο pipe"
|
||
|
||
#: ulng.rspropssocket
|
||
msgid "Socket"
|
||
msgstr "Socket"
|
||
|
||
#: ulng.rspropsspblkdev
|
||
msgid "Special block device"
|
||
msgstr "Ειδική block device"
|
||
|
||
#: ulng.rspropsspchrdev
|
||
msgid "Special character device"
|
||
msgstr "Ειδική character device"
|
||
|
||
#: ulng.rspropssymlink
|
||
msgid "Symbolic link"
|
||
msgstr "Συμβολoδεσμός"
|
||
|
||
#: ulng.rspropsunknowntype
|
||
msgid "Unknown type"
|
||
msgstr "Άγνωστος τύπος"
|
||
|
||
#: ulng.rssearchresult
|
||
msgid "Search result"
|
||
msgstr "Αναζήτηση αποτελέσματος"
|
||
|
||
#: ulng.rssearchstatus
|
||
msgid "SEARCH"
|
||
msgstr "ΑΝΑΖΗΤΗΣΗ"
|
||
|
||
#: ulng.rssearchtemplateunnamed
|
||
msgid "<unnamed template>"
|
||
msgstr "<πρότυπο χωρίς όνομα>"
|
||
|
||
#: ulng.rssearchwithdsxplugininprogress
|
||
msgid ""
|
||
"A file search using DSX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Μια αναζήτηση αρχείων με χρήση του προσθέτου DSX είναι ήδη σε εξέλιξη.\n"
|
||
"Πρέπει να ολοκληρωθεί αυτή ώστε να φορτωθεί μια νέα.\n"
|
||
|
||
#: ulng.rssearchwithwdxplugininprogress
|
||
msgid ""
|
||
"A file search using WDX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Μια αναζήτηση αρχείων με χρήση του προσθέτου WDX είναι ήδη σε εξέλιξη.\n"
|
||
"Πρέπει να ολοκληρωθεί αυτή ώστε να φορτωθεί μια νέα.\n"
|
||
|
||
#: ulng.rsselectdir
|
||
msgid "Select a directory"
|
||
msgstr "Επιλέξτε ένα κατάλογο"
|
||
|
||
#: ulng.rsselectyoufindfileswindow
|
||
msgid "Select your window"
|
||
msgstr "Επιλογή επιθυμητού παραθύρου"
|
||
|
||
#: ulng.rsshowhelpfor
|
||
msgid "&Show help for %s"
|
||
msgstr "Εμφάνιση βοήθειας για %s"
|
||
|
||
#: ulng.rssimplewordall
|
||
msgctxt "ulng.rssimplewordall"
|
||
msgid "All"
|
||
msgstr "Όλα"
|
||
|
||
#: ulng.rssimplewordcategory
|
||
msgctxt "ulng.rssimplewordcategory"
|
||
msgid "Category"
|
||
msgstr "Κατηγορία"
|
||
|
||
#: ulng.rssimplewordcolumnsingular
|
||
msgid "Column"
|
||
msgstr "Στήλη"
|
||
|
||
#: ulng.rssimplewordcommand
|
||
msgctxt "ulng.rssimplewordcommand"
|
||
msgid "Command"
|
||
msgstr "Εντολή"
|
||
|
||
#: ulng.rssimplewordfilename
|
||
msgid "Filename"
|
||
msgstr "Όνομα αρχείου"
|
||
|
||
#: ulng.rssimplewordfiles
|
||
msgid "files"
|
||
msgstr "Αρχεία"
|
||
|
||
#: ulng.rssimplewordletter
|
||
msgid "Letter"
|
||
msgstr "Γράμμα"
|
||
|
||
#: ulng.rssimplewordparameter
|
||
msgid "Param"
|
||
msgstr "Παράμετρος"
|
||
|
||
#: ulng.rssimplewordresult
|
||
msgid "Result"
|
||
msgstr "Αποτέλεσμα"
|
||
|
||
#: ulng.rssimplewordworkdir
|
||
msgid "WorkDir"
|
||
msgstr "Κατάλογος Εργασίας"
|
||
|
||
#: ulng.rssizeunitbytes
|
||
msgid "Bytes"
|
||
msgstr "Bytes"
|
||
|
||
#: ulng.rssizeunitgbytes
|
||
msgctxt "ulng.rssizeunitgbytes"
|
||
msgid "Gigabytes"
|
||
msgstr "Gigabytes"
|
||
|
||
#: ulng.rssizeunitkbytes
|
||
msgctxt "ulng.rssizeunitkbytes"
|
||
msgid "Kilobytes"
|
||
msgstr "Kilobytes"
|
||
|
||
#: ulng.rssizeunitmbytes
|
||
msgctxt "ulng.rssizeunitmbytes"
|
||
msgid "Megabytes"
|
||
msgstr "Megabytes"
|
||
|
||
#: ulng.rssizeunittbytes
|
||
msgid "Terabytes"
|
||
msgstr "Terabytes"
|
||
|
||
#: ulng.rsspacemsg
|
||
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
||
msgstr "Αρχεία: %d, Κατάλογοι: %d, Μέγεθος: %s (%s bytes)"
|
||
|
||
#: ulng.rsspliterrdirectory
|
||
msgid "Unable to create target directory!"
|
||
msgstr "Αδυναμία δημιουργίας καταλόγου στόχου!"
|
||
|
||
#: ulng.rsspliterrfilesize
|
||
msgid "Incorrect file size format!"
|
||
msgstr " Μη Έγκυρος τύπος μεγέθους αρχείου!"
|
||
|
||
#: ulng.rsspliterrsplitfile
|
||
msgid "Unable to split the file!"
|
||
msgstr "Αδυναμία διαμερισμού του Αρχείου!"
|
||
|
||
#: ulng.rssplitmsgmanyparts
|
||
msgid "The number of parts is more than 100! Continue?"
|
||
msgstr "Ο αριθμός τμημάτων είναι παραπάνω από 100! Συνέχιση;"
|
||
|
||
#: ulng.rssplitpredefinedsizes
|
||
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
msgstr "Αυτόματα;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
|
||
#: ulng.rssplitseldir
|
||
msgid "Select directory:"
|
||
msgstr "Επιλογή καταλόγου:"
|
||
|
||
#: ulng.rsstraccents
|
||
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
|
||
#: ulng.rsstraccentsstripped
|
||
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
|
||
#: ulng.rsstrpreviewjustpreview
|
||
msgid "Just preview"
|
||
msgstr "Μόνο προεπισκόπηση"
|
||
|
||
#: ulng.rsstrpreviewothers
|
||
msgid "Others"
|
||
msgstr "Άλλα"
|
||
|
||
#: ulng.rsstrpreviewsearchingletters
|
||
msgid "OU"
|
||
msgstr "OU"
|
||
|
||
#: ulng.rsstrpreviewsidenote
|
||
msgid "Side note"
|
||
msgstr "Υποσημείωση"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched1
|
||
msgid "Flat"
|
||
msgstr "Επίπεδο"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched2
|
||
msgid "Limited"
|
||
msgstr "Περιορισμένο"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched3
|
||
msgid "Simple"
|
||
msgstr "Απλό"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched1
|
||
msgid "Fabulous"
|
||
msgstr "Fabulous"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched2
|
||
msgid "Marvelous"
|
||
msgstr "Marvelous"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched3
|
||
msgid "Tremendous"
|
||
msgstr "Tremendous"
|
||
|
||
#: ulng.rsstrtvmchoosedirhistory
|
||
msgid "Choose your directory from Dir History"
|
||
msgstr "Επιλογή καταλόγου από το Ιστορικό Καταλόγου"
|
||
|
||
#: ulng.rsstrtvmchoosefavoritetabs
|
||
msgid "Choose you Favorite Tabs:"
|
||
msgstr "Επιλογή Αγαπημένων Καρτελών:"
|
||
|
||
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
||
msgid "Choose your command from Command Line History"
|
||
msgstr "Επιλογή Εντολής από το Ιστορικό Γραμμής Εντολών"
|
||
|
||
#: ulng.rsstrtvmchoosefrommainmenu
|
||
msgid "Choose your action from Main Menu"
|
||
msgstr "Επιλογή Ενέργειας από το Βασικό Μενού"
|
||
|
||
#: ulng.rsstrtvmchoosefromtoolbar
|
||
msgid "Choose your action from Maintool bar"
|
||
msgstr "Επιλογή Ενέργειας από τη γραμμή Βασικών Εργαλείων"
|
||
|
||
#: ulng.rsstrtvmchoosehotdirectory
|
||
msgid "Choose your directory from Hot Directory:"
|
||
msgstr "Επιλογή καταλόγου από το Hot Directory:"
|
||
|
||
#: ulng.rsstrtvmchooseviewhistory
|
||
msgid "Choose your directory from File View History"
|
||
msgstr "Επιλογή καταλόγου από το Ιστορικό Προβολής Αρχείου"
|
||
|
||
#: ulng.rsstrtvmchooseyourfileordir
|
||
msgid "Choose your file or your directory"
|
||
msgstr "Επιλογή αρχείου ή καταλόγου"
|
||
|
||
#: ulng.rssymerrcreate
|
||
msgid "Error creating symlink."
|
||
msgstr "Λάθος κατά τη δημιουργία συμβολοδεσμού."
|
||
|
||
#: ulng.rssyndefaulttext
|
||
msgctxt "ulng.rssyndefaulttext"
|
||
msgid "Default text"
|
||
msgstr "Προκαθορισμένο Κείμενο"
|
||
|
||
#: ulng.rssynlangplaintext
|
||
msgctxt "ulng.rssynlangplaintext"
|
||
msgid "Plain text"
|
||
msgstr "Απλό Κείμενο"
|
||
|
||
#: ulng.rstabsactionondoubleclickchoices
|
||
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
||
msgstr "Να μη γίνει τίποτα;Κλείσιμο καρτέλας;Πρόσβαση Αγαπημένων Καρτελών;Αναδυόμενο μενού Καρτελών"
|
||
|
||
#: ulng.rstimeunitday
|
||
msgctxt "ulng.rstimeunitday"
|
||
msgid "Day(s)"
|
||
msgstr "Μέρα(ες)"
|
||
|
||
#: ulng.rstimeunithour
|
||
msgid "Hour(s)"
|
||
msgstr "Ώρα(ες)"
|
||
|
||
#: ulng.rstimeunitminute
|
||
msgid "Minute(s)"
|
||
msgstr "Λεπτό(ά)"
|
||
|
||
#: ulng.rstimeunitmonth
|
||
msgid "Month(s)"
|
||
msgstr "Μήνας(ες)"
|
||
|
||
#: ulng.rstimeunitsecond
|
||
msgid "Second(s)"
|
||
msgstr "Δευτερόλεπτο(α)"
|
||
|
||
#: ulng.rstimeunitweek
|
||
msgid "Week(s)"
|
||
msgstr "Εβδομάδα(ες)"
|
||
|
||
#: ulng.rstimeunityear
|
||
msgid "Year(s)"
|
||
msgstr "Χρόνος(ια)"
|
||
|
||
#: ulng.rstitlerenamefavtabs
|
||
msgid "Rename Favorite Tabs"
|
||
msgstr "Μετονομασία Αγαπημένων Καρτελών"
|
||
|
||
#: ulng.rstitlerenamefavtabsmenu
|
||
msgid "Rename Favorite Tabs sub-menu"
|
||
msgstr "Μετονομασία υπο-μενού Αγαπημένων Καρτελών"
|
||
|
||
#: ulng.rstooldiffer
|
||
msgctxt "ulng.rstooldiffer"
|
||
msgid "Differ"
|
||
msgstr "Differ"
|
||
|
||
#: ulng.rstooleditor
|
||
msgctxt "ulng.rstooleditor"
|
||
msgid "Editor"
|
||
msgstr "Επεξεργαστής"
|
||
|
||
#: ulng.rstoolerroropeningdiffer
|
||
msgid "Error opening differ"
|
||
msgstr "Λάθος ανοίγματος differ"
|
||
|
||
#: ulng.rstoolerroropeningeditor
|
||
msgid "Error opening editor"
|
||
msgstr "Λάθος ανοίγματος επεξεργαστή"
|
||
|
||
#: ulng.rstoolerroropeningterminal
|
||
msgid "Error opening terminal"
|
||
msgstr "Λάθος ανοίγματος τερματικού"
|
||
|
||
#: ulng.rstoolerroropeningviewer
|
||
msgid "Error opening viewer"
|
||
msgstr "Λάθος ανοίγματος προβολέα"
|
||
|
||
#: ulng.rstoolterminal
|
||
msgctxt "ulng.rstoolterminal"
|
||
msgid "Terminal"
|
||
msgstr "Τερματικό"
|
||
|
||
#: ulng.rstoolviewer
|
||
msgctxt "ulng.rstoolviewer"
|
||
msgid "Viewer"
|
||
msgstr "Προβολέας"
|
||
|
||
#: ulng.rsunhandledexceptionmessage
|
||
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
||
msgstr "Παρακαλώ αναφέρετε αυτό το πρόβλημα στον αποσφαλματωτή με μία περιγραφή του τι έχετε κάνει και το ακόλουθο αρχείο:%sΠιέστε %s για να συνεχίσετε ή %s για απόρριψη του προγράμματος."
|
||
|
||
#: ulng.rsvarbothpanelactivetoinactive
|
||
msgid "Both panels, from active to inactive"
|
||
msgstr "Και τα δύο πάνελ, από το ενεργό στο ανενεργό"
|
||
|
||
#: ulng.rsvarbothpanellefttoright
|
||
msgid "Both panels, from left to right"
|
||
msgstr "Και τα δύο πάνελ, από τα αριστερά στα δεξιά"
|
||
|
||
#: ulng.rsvarcurrentpath
|
||
msgid "Path of panel"
|
||
msgstr "Διαδρομή του πάνελ"
|
||
|
||
#: ulng.rsvarencloseelement
|
||
msgid "Enclose each name in brackets or what you want"
|
||
msgstr "Βάλτε κάθε όνομα σε παρένθεση ή οτιδήποτε επιθυμείτε"
|
||
|
||
#: ulng.rsvarfilenamenoext
|
||
msgid "Just filename, no extension"
|
||
msgstr "Μόνο όνομα αρχείου, χωρίς επέκταση"
|
||
|
||
#: ulng.rsvarfullpath
|
||
msgid "Complete filename (path+filename)"
|
||
msgstr "Πλήρες όνομα αρχείου (διαδρομή και όνομα αρχείου)"
|
||
|
||
#: ulng.rsvarhelpwith
|
||
msgid "Help with \"%\" variables"
|
||
msgstr "Βοήθεια για \"%\" μεταβλητές"
|
||
|
||
#: ulng.rsvarinputparam
|
||
msgid "Will request request user to enter a parameter with a default suggested value"
|
||
msgstr "Θα ζητηθεί από το χρήστη να εισάγει μια παράμετρο με την προκαθορισμένη προτεινόμενη τιμή"
|
||
|
||
#: ulng.rsvarleftpanel
|
||
msgid "Left panel"
|
||
msgstr "Αριστερό πάνελ"
|
||
|
||
#: ulng.rsvarlistfilename
|
||
msgid "Temporary filename of list of filenames"
|
||
msgstr "Προσωρινό όνομα αρχείου τη λίστας με τα ονόματα αρχείων"
|
||
|
||
#: ulng.rsvarlistfullfilename
|
||
msgid "Temporary filename of list of complete filenames (path+filename)"
|
||
msgstr "Προσωρινό όνομα αρχείου τη λίστας με τα ολοκληρωμένα ονόματα αρχείων (διαδρομή+όνομα αρχείου)"
|
||
|
||
#: ulng.rsvarlistinutf16
|
||
msgid "Filenames in list in UTF-16 with BOM"
|
||
msgstr "Ονόματα αρχείων λίστας σε UTF-16 με BOM"
|
||
|
||
#: ulng.rsvarlistinutf16quoted
|
||
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
||
msgstr "Ονόματα αρχείων λίστας σε UTF-16 με BOM, μέσα σε διπλά εισαγωγικά"
|
||
|
||
#: ulng.rsvarlistinutf8
|
||
msgid "Filenames in list in UTF-8"
|
||
msgstr "Ονόματα αρχείων λίστας σε UTF-8"
|
||
|
||
#: ulng.rsvarlistinutf8quoted
|
||
msgid "Filenames in list in UTF-8, inside double quotes"
|
||
msgstr "Ονόματα αρχείων λίστας σε UTF-8, μέσα σε διπλά εισαγωγικά"
|
||
|
||
#: ulng.rsvarlistrelativefilename
|
||
msgid "Temporary filename of list of filenames with relative path"
|
||
msgstr "Προσωρινό όνομα αρχείου τη λίστας με τα ονόματα αρχείων με σχετική διαδρομή"
|
||
|
||
#: ulng.rsvaronlyextension
|
||
msgid "Only file extension"
|
||
msgstr "Μόνο επέκταση αρχείου"
|
||
|
||
#: ulng.rsvaronlyfilename
|
||
msgid "Only filename"
|
||
msgstr "Μόνο όνομα αρχείου"
|
||
|
||
#: ulng.rsvarotherexamples
|
||
msgid "Other example of what's possible"
|
||
msgstr "Άλλο παράδειγμα για το τι είναι δυνατό"
|
||
|
||
#: ulng.rsvarpath
|
||
#, fuzzy
|
||
#| msgid "Path, with ending delimiter"
|
||
msgid "Path, without ending delimiter"
|
||
msgstr "Διαδρομή, με τελικό οριοθέτη"
|
||
|
||
#: ulng.rsvarpercentchangetopound
|
||
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
||
msgstr "Από εδώ ως το τέλος της γραμμής, ο δείκτης της μεταβλητής επί τοις εκατό είναι το \"#\" σύμβολο"
|
||
|
||
#: ulng.rsvarpercentsign
|
||
msgid "Return the percent sign"
|
||
msgstr "Επιστροφή του συμβόλου επί τοις εκατό"
|
||
|
||
#: ulng.rsvarpoundchangetopercent
|
||
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
||
msgstr "Από εδώ ως το τέλος της γραμμής, ο δείκτης της μεταβλητής επί τοις εκατό είναι πάλι το \"%\" σύμβολο"
|
||
|
||
#: ulng.rsvarprependelement
|
||
msgid "Prepend each name with \"-a \" or what you want"
|
||
msgstr "Βάλτε ως πρόθυμα στα ονόματα ένα \"-α \" 'η ότι άλλο επιθυμείτε"
|
||
|
||
#: ulng.rsvarpromptuserforparam
|
||
msgid "%[Prompt user for param;Default value proposed]"
|
||
msgstr "%[Ερώτηση χρήστη για παράμετρο;Πρόταση προκαθορισμένης τιμής]"
|
||
|
||
#: ulng.rsvarrelativepathandfilename
|
||
msgid "Filename with relative path"
|
||
msgstr "Όνομα αρχείου με σχετική διαδρομή"
|
||
|
||
#: ulng.rsvarrightpanel
|
||
msgid "Right panel"
|
||
msgstr "Δεξιό πάνελ"
|
||
|
||
#: ulng.rsvarsecondelementrightpanel
|
||
msgid "Full path of second selected file in right panel"
|
||
msgstr "Πλήρης διαδρομή του δεύτερου επιλεγμένου αρχείου στο δεξιό πάνελ"
|
||
|
||
#: ulng.rsvarshowcommandprior
|
||
msgid "Show command prior execute"
|
||
msgstr "Εμφάνιση εντολής προ εκτέλεσης"
|
||
|
||
#: ulng.rsvarsimplemessage
|
||
msgid "%[Simple message]"
|
||
msgstr "%[Απλό μήνυμα]"
|
||
|
||
#: ulng.rsvarsimpleshowmessage
|
||
msgid "Will show a simple message"
|
||
msgstr "Θα εμφανίσει ένα απλό μήνυμα"
|
||
|
||
#: ulng.rsvarsourcepanel
|
||
msgid "Active panel (source)"
|
||
msgstr "Ενεργό πάνελ (πηγή)"
|
||
|
||
#: ulng.rsvartargetpanel
|
||
msgid "Inactive panel (target)"
|
||
msgstr "Ανενεργό πάνελ (στόχος)"
|
||
|
||
#: ulng.rsvarwillbequoted
|
||
msgid "Filenames will be quoted from here (default)"
|
||
msgstr "Τα ονόματα αρχείων θα μπουν σε εισαγωγικά από εδώ (προκαθορισμένο)"
|
||
|
||
#: ulng.rsvarwilldointerminal
|
||
msgid "Command will be done in terminal, remaining opened at the end"
|
||
msgstr "Η Εντολή θα εκτελεστεί σε τερματικό που θα μείνει ανοικτό στο τέλος"
|
||
|
||
#: ulng.rsvarwillhaveendingdelimiter
|
||
msgid "Paths will have ending delimiter"
|
||
msgstr "Οι Διαδρομές θα έχουν τελικό οριοθέτη"
|
||
|
||
#: ulng.rsvarwillnotbequoted
|
||
msgid "Filenames will not be quoted from here"
|
||
msgstr "Τα ονόματα αρχείων δε θα μπουν σε εισαγωγικά από εδώ"
|
||
|
||
#: ulng.rsvarwillnotdointerminal
|
||
msgid "Command will be done in terminal, closed at the end"
|
||
msgstr "Η εντολή θα πραγματοποιηθεί σε τερματικό που θα κλείσει στο τέλος"
|
||
|
||
#: ulng.rsvarwillnothaveendingdelimiter
|
||
msgid "Paths will not have ending delimiter (default)"
|
||
msgstr "Οι Διαδρομές δε θα έχουν τελικό οριοθέτη (προκαθορισμένο)"
|
||
|
||
#: ulng.rsvfsnetwork
|
||
msgctxt "ulng.rsvfsnetwork"
|
||
msgid "Network"
|
||
msgstr "Δίκτυο"
|
||
|
||
#: ulng.rsviewabouttext
|
||
msgid "Internal Viewer of Double Commander."
|
||
msgstr "Εσωτερικός Προβολέας του Double Commander."
|
||
|
||
#: ulng.rsviewbadquality
|
||
msgid "Bad Quality"
|
||
msgstr "Κακή Ποιότητα"
|
||
|
||
#: ulng.rsviewencoding
|
||
msgctxt "ulng.rsviewencoding"
|
||
msgid "Encoding"
|
||
msgstr "Κωδικοποίηση"
|
||
|
||
#: ulng.rsviewimagetype
|
||
msgid "Image Type"
|
||
msgstr "Τύπος Εικόνας"
|
||
|
||
#: ulng.rsviewnewsize
|
||
msgctxt "ulng.rsviewnewsize"
|
||
msgid "New Size"
|
||
msgstr "Νέο Μέγεθος"
|
||
|
||
#: ulng.rsviewnotfound
|
||
msgid "%s not found!"
|
||
msgstr "%s δεν βρέθηκαν!"
|
||
|
||
#: ulng.rsviewwithexternalviewer
|
||
msgid "with external viewer"
|
||
msgstr "με εξωτερικό προβολέα"
|
||
|
||
#: ulng.rsviewwithinternalviewer
|
||
msgid "with internal viewer"
|
||
msgstr "με εσωτερικό προβολέα"
|
||
|
||
#: ulng.rsxreplacements
|
||
msgid "Number of replacement: %d"
|
||
msgstr "Αριθμός αντικατάστασης: %d"
|
||
|
||
#: ulng.rszeroreplacement
|
||
msgid "No replacement took place."
|
||
msgstr "Δεν πραγματοποιήθηκε καμία αντικατάσταση."
|
||
|