doublecmd/language/doublecmd.nl.po
2017-09-19 19:35:04 +00:00

12015 lines
325 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.8.0 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: \n"
"Last-Translator: Pjotr <pjotrvertaalt@gmail.com>\n"
"Language-Team: Dutch\n"
"Language: nl\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Nederlands\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Vergelijken... %d%% (ESC om te annuleren)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Rechts: verwijder %d bestand(en)"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Gevonden bestanden: %d (Identiek: %d, Verschillend: %d, Uniek links: %d, Uniek rechts: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Links naar rechts: kopieer %d bestanden, totale grootte: %d bytes"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Rechts naar links: kopieer %d bestanden, totale grootte: %d bytes"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Kies sjabloon..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Controleer vrije ruimte"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Kopieer attributen"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Kopieer eigendom"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Kopieer rechten"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopieer datum/tijd"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Corrigeer koppelingen"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgid "Drop readonly fla&g"
msgstr "Laat alleen-lezen-vlag vallen"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Lege mappen uitsluiten"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Volg koppelingen"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "Reserveer ruimte"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Wat te doen bij niet kunnen instellen bestandstijd, attributen, enz."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Gebruik bestandsjabloon"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Als map bestaat"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgid "When &file exists"
msgstr "Als bestand bestaat"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Wanneer eigenschap niet ingesteld kan worden"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<geen sjabloon>"
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr "Sluiten"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Kopieer naar klembord"
#: tfrmabout.caption
msgctxt "tfrmabout.caption"
msgid "About"
msgstr "Over"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Bouwsel"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Thuispagina:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "tfrmabout.lblrevision.caption"
msgid "Revision"
msgstr "Revisie"
#: tfrmabout.lbltitle.caption
msgctxt "tfrmabout.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Versie"
#: tfrmattributesedit.btncancel.caption
msgctxt "tfrmattributesedit.btncancel.caption"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmattributesedit.btnok.caption
msgctxt "tfrmattributesedit.btnok.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Terugzetten"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Kies attributen"
#: tfrmattributesedit.cbarchive.caption
msgid "&Archive"
msgstr "A&rchiefbestand"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Gecomprimeerd"
#: tfrmattributesedit.cbdirectory.caption
msgid "&Directory"
msgstr "&Map"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "Ver&sleuteld"
#: tfrmattributesedit.cbhidden.caption
msgid "&Hidden"
msgstr "&Verborgen"
#: tfrmattributesedit.cbreadonly.caption
msgid "Read o&nly"
msgstr "Alleen-&lezen"
#: tfrmattributesedit.cbsgid.caption
msgctxt "tfrmattributesedit.cbsgid.caption"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "Verspreid"
#: tfrmattributesedit.cbsticky.caption
msgctxt "tfrmattributesedit.cbsticky.caption"
msgid "Sticky"
msgstr "Kleverig"
#: tfrmattributesedit.cbsuid.caption
msgctxt "tfrmattributesedit.cbsuid.caption"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Symbolische koppeling"
#: tfrmattributesedit.cbsystem.caption
msgid "S&ystem"
msgstr "Systeem"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Tijdelijk"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "NTFS-attributen"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Algemene attributen"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "tfrmattributesedit.lblattrbitsstr.caption"
msgid "Bits:"
msgstr "Bits:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "tfrmattributesedit.lblattrgroupstr.caption"
msgid "Group"
msgstr "Groep"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "tfrmattributesedit.lblattrotherstr.caption"
msgid "Other"
msgstr "Overig"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "tfrmattributesedit.lblattrownerstr.caption"
msgid "Owner"
msgstr "Eigenaar"
#: tfrmattributesedit.lblexec.caption
msgctxt "tfrmattributesedit.lblexec.caption"
msgid "Execute"
msgstr "Uitvoeren"
#: tfrmattributesedit.lblread.caption
msgctxt "tfrmattributesedit.lblread.caption"
msgid "Read"
msgstr "Lezen"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Als te&kst:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "tfrmattributesedit.lblwrite.caption"
msgid "Write"
msgstr "Schrijven"
#: tfrmchecksumcalc.caption
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Bereken checksum..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Open checksumbestand nadat klus voltooid is"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "Maak aparte checksum aan voor elk bestand"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "Sla checksumbestand(en) op in:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Sluiten"
#: tfrmchecksumverify.caption
msgctxt "tfrmchecksumverify.caption"
msgid "Verify checksum..."
msgstr "Verifiëer checksum..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "tfrmconnectionmanager.btnadd.caption"
msgid "A&dd"
msgstr "&Toevoegen"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "&Verbinden"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "tfrmconnectionmanager.btndelete.caption"
msgid "&Delete"
msgstr "Ver&wijderen"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "tfrmconnectionmanager.btnedit.caption"
msgid "&Edit"
msgstr "&Bewerken"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Verbindingsbeheerder"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Verbind met:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "Voeg toe aan wachtrij"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "Opties"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "Sla deze opties op als standaard"
#: tfrmcopydlg.caption
msgctxt "tfrmcopydlg.caption"
msgid "Copy file(s)"
msgstr "Kopieer bestand(en)"
#: tfrmcopydlg.mnunewqueue.caption
msgid "New queue"
msgstr "Nieuwe wachtrij"
#: tfrmcopydlg.mnuqueue1.caption
msgid "Queue 1"
msgstr "Wachtrij 1"
#: tfrmcopydlg.mnuqueue2.caption
msgid "Queue 2"
msgstr "Wachtrij 2"
#: tfrmcopydlg.mnuqueue3.caption
msgid "Queue 3"
msgstr "Wachtrij 3"
#: tfrmcopydlg.mnuqueue4.caption
msgid "Queue 4"
msgstr "Wachtrij 4"
#: tfrmcopydlg.mnuqueue5.caption
msgid "Queue 5"
msgstr "Wachtrij 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Beschrijving opslaan"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Commentaar bij bestand/map"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "Bewerk commentaar voor:"
#: tfrmdescredit.lblencoding.caption
msgid "&Encoding:"
msgstr "&Codering:"
#: tfrmdescredit.lblfilename.caption
msgctxt "tfrmdescredit.lblfilename.caption"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "Over"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Automatisch vergelijken"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Binaire modus"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "tfrmdiffer.actcancelcompare.caption"
msgid "Cancel"
msgstr "Annuleren"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Annuleren"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "tfrmdiffer.actcopylefttoright.caption"
msgid "Copy Block Right"
msgstr "Kopieer rechterblok"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Kopieer rechterblok"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "tfrmdiffer.actcopyrighttoleft.caption"
msgid "Copy Block Left"
msgstr "Kopieer linkerblok"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Kopieer linkerblok"
#: tfrmdiffer.acteditcopy.caption
msgctxt "tfrmdiffer.acteditcopy.caption"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmdiffer.acteditcut.caption
msgctxt "tfrmdiffer.acteditcut.caption"
msgid "Cut"
msgstr "Knippen"
#: tfrmdiffer.acteditdelete.caption
msgctxt "tfrmdiffer.acteditdelete.caption"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmdiffer.acteditpaste.caption
msgctxt "tfrmdiffer.acteditpaste.caption"
msgid "Paste"
msgstr "Plakken"
#: tfrmdiffer.acteditredo.caption
msgctxt "tfrmdiffer.acteditredo.caption"
msgid "Redo"
msgstr "Opnieuw uitvoeren"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Selecteer &alles"
#: tfrmdiffer.acteditundo.caption
msgctxt "tfrmdiffer.acteditundo.caption"
msgid "Undo"
msgstr "Ongedaan maken"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "Af&sluiten"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Eerste verschil"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Eerste verschil"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Negeer hoofdletters/kleine letters"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Negeer spaties"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Blijf schuiven"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Laatste verschil"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Laatste verschil"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Regelverschillen"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Volgende verschil"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Volgende verschil"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Open links..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Open rechts..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Schilder achtergrond"
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Vorige verschil"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Vorige verschil"
#: tfrmdiffer.actreload.caption
msgid "&Reload"
msgstr "Herladen"
#: tfrmdiffer.actreload.hint
msgctxt "tfrmdiffer.actreload.hint"
msgid "Reload"
msgstr "Herladen"
#: tfrmdiffer.actsave.caption
msgctxt "tfrmdiffer.actsave.caption"
msgid "Save"
msgstr "Opslaan"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Opslaan"
#: tfrmdiffer.actsaveas.caption
msgctxt "tfrmdiffer.actsaveas.caption"
msgid "Save as..."
msgstr "OPslaan als..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Opslaan als..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "tfrmdiffer.actsaveleft.caption"
msgid "Save Left"
msgstr "Opslaan links"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Opslaan links"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "tfrmdiffer.actsaveleftas.caption"
msgid "Save Left As..."
msgstr "Sla links op als..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Sla links op als..."
#: tfrmdiffer.actsaveright.caption
msgctxt "tfrmdiffer.actsaveright.caption"
msgid "Save Right"
msgstr "Opslaan rechts"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Opslaan rechts"
#: tfrmdiffer.actsaverightas.caption
msgctxt "tfrmdiffer.actsaverightas.caption"
msgid "Save Right As..."
msgstr "Sla rechts op als..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Sla rechts op als..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "tfrmdiffer.actstartcompare.caption"
msgid "Compare"
msgstr "Vergelijken"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Vergelijken"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "tfrmdiffer.btnleftencoding.hint"
msgid "Encoding"
msgstr "Codering"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Codering"
#: tfrmdiffer.caption
msgid "Compare files"
msgstr "Vergelijk bestanden"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "tfrmdiffer.midivider7.caption"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Links"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "&Rechts"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Acties"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Bewerken"
#: tfrmdiffer.mnuencoding.caption
msgctxt "tfrmdiffer.mnuencoding.caption"
msgid "En&coding"
msgstr "Codering"
#: tfrmdiffer.mnufile.caption
msgctxt "tfrmdiffer.mnufile.caption"
msgid "&File"
msgstr "&Bestand"
#: tfrmdiffer.mnuoptions.caption
msgid "&Options"
msgstr "&Opties"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Voeg nieuwe sneltoets toe aan volgorde"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Verwijder laatste sneltoets uit volgorde"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr "Alleen voor deze bedieningen"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parameters (elk op een aparte regel):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Sneltoetsen:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "Over"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "Over"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "Instellingen"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Instellingen"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Knippen"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Knippen"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Zoeken"
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Zoeken"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Zoek volgende"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Zoek volgende"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Zoek vorige"
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr "Ga naar regel..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "MAC (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Plakken"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Plakken"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Herongedaan maken"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Opnieuw uitvoeren"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "Vervangen"
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Vervangen"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Selecteer &alles"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Selecteer alles"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Ongedaan maken"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Ongedaan maken"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Sluiten"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Sluiten"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "Af&sluiten"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Afsluiten"
#: tfrmeditor.actfilenew.caption
msgid "&New"
msgstr "&Nieuw"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Nieuw"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Openen"
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Openen"
#: tfrmeditor.actfilesave.caption
msgctxt "tfrmeditor.actfilesave.caption"
msgid "&Save"
msgstr "Opslaan"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Opslaan"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Opslaan &als..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Opslaan als"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Sla alles op"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Sla alles op"
#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr "Bewerker"
#: tfrmeditor.help1.caption
msgctxt "tfrmeditor.help1.caption"
msgid "&Help"
msgstr "&Hulp"
#: tfrmeditor.menuitem1.caption
msgctxt "TFRMEDITOR.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Bewerken"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Codering"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Openen als"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Opslaan als"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Bestand"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Opmaakmarkering"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Einde van regel"
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n5.caption
msgctxt "TFRMEDITOR.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgid "C&ase sensitivity"
msgstr "Hoofdlettergevoeligheid"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgid "S&earch from caret"
msgstr "Zoek vanaf dakje ^"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgid "&Regular expressions"
msgstr "&Reguliere uitdrukkingen"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgid "Selected &text only"
msgstr "Alleen geselecteerde tekst"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgid "&Whole words only"
msgstr "&Alleen hele woorden"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgid "Option"
msgstr "Optie"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgid "&Replace with:"
msgstr "&Vervang door:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgid "&Search for:"
msgstr "&Zoek naar:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgid "Direction"
msgstr "Richting"
#: tfrmextractdlg.caption
msgid "Unpack files"
msgstr "Bestanden uitpakken"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "Pak bestandpadnamen uit indien opgeslagen met bestanden"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Pak elk archiefbestand uit in &aparte submap (naam van het archiefbestand)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "Overschrijf bestaande bestanden"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Naar de map:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "Pak bestanden uit die overeenkomen met bestandmasker:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "Wachtwoord voor versleutelde bestanden:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Sluiten"
#: tfrmfileexecuteyourself.caption
msgid "Wait..."
msgstr "Wacht..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Bestandnaam:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "tfrmfileexecuteyourself.lblfrompath.caption"
msgid "From:"
msgstr "Van:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Klik op Sluiten als tijdelijk bestand verwijderd kan worden."
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&Naar werkbalk"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "Toon alles"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Huidige bewerking:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Van:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Naar:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Sluiten"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "Eigenschappen instellen"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Instellen voor alle gekozen bestanden"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Sla dit bestand over"
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr "Eigenschappen"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Klevend"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Eigenaar"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Groep"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ander"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Eigenaar"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "tfrmfileproperties.lblattrtext.caption"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
msgid "Text:"
msgstr "Tekst:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Bevat:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Uitvoeren"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Bestandnaam"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "tfrmfileproperties.lblfilestr.caption"
msgid "File name"
msgstr "Bestandnaam"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Pad:"
#: tfrmfileproperties.lblgroupstr.caption
msgid "&Group"
msgstr "Groep"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Laatst benaderd:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Laatste wijziging:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Laatste statuswijziging:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "tfrmfileproperties.lbloctal.caption"
msgid "Octal:"
msgstr "Octaal:"
#: tfrmfileproperties.lblownerstr.caption
msgid "O&wner"
msgstr "Eigenaar"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lezen"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "tfrmfileproperties.lblsizestr.caption"
msgid "Size:"
msgstr "Grootte:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Symbolische koppeling naar:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Soort:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Schrijven"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Naam"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Waarde"
#: tfrmfileproperties.tsattributes.caption
msgctxt "tfrmfileproperties.tsattributes.caption"
msgid "Attributes"
msgstr "Attributen"
#: tfrmfileproperties.tsimage.caption
msgid "Image"
msgstr ""
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Eigenschappen"
#: tfrmfinddlg.actcancel.caption
msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION"
msgid "C&ancel"
msgstr "&Annuleren"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "&Sluiten"
#: tfrmfinddlg.actclose.caption
msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION"
msgid "&Close"
msgstr "Sluiten"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Bewerken"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "Voeg toe aan &lijstvenster"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Ga naar bestand"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION"
msgid "Find Data"
msgstr "Zoek gegevens"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Laatste zoekopdracht"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Nieuwe zoekopdracht"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Ga naar pagina 'Geavanceerd'"
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Ga naar pagina 'Laden/opslaan'"
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Ga naar pagina 'Invoegtoepassingen'"
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Ga naar pagina 'Resultaten'"
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Ga naar pagina 'Standaard'"
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Starten"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Tonen"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Toevoegen"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Hulp"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Opslaan"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Verwijderen"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "Laden"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "Op&slaan"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Opslaan met 'Begin in map'"
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Indien opgeslagen dan zal 'Begin in map' worden hersteld bij het laden van de sjabloon. Gebruik dit als u de zoekopdracht wilt vastknopen aan een bepaalde map"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Gebruik sjabloon"
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Zoek bestanden"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Hoofdlettergevoelig"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "&Datum vanaf:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Datum tot:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "Bestandgrootte vanaf:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Bestandgrootte tot:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "Zoek in archiefbestanden"
#: tfrmfinddlg.cbfindtext.caption
msgid "Find &text in file"
msgstr "Zoek tekst in bestand"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgid "Follow s&ymlinks"
msgstr "Volg symbolische koppelingen"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgid "Find files N&OT containing the text"
msgstr "Vind bestanden die NIET de tekst bevatten"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Niet ouder dan:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Geopende tabbladen"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Zoek naar deel van bestandnaam"
#: tfrmfinddlg.cbregexp.caption
msgid "&Regular expression"
msgstr "Reguliere uitdrukking"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "Vervang door"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Gekozen mappen en bestanden"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "Reguliere uitdrukking"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "&Tijd vanaf:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "Tijd tot:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "&Gebruik invoegtoepassing voor zoeken:"
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Geef mapnamen in die uitgesloten zijn van zoekopdrachten, gescheiden door puntkomma"
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Geef bestandnamen in die uitgesloten zijn van zoekopdrachten, gescheiden door puntkomma"
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Geef bestandnamen in gescheiden door puntkomma"
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Mappen"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Bestanden"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Zoek gegevens"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Attributen"
#: tfrmfinddlg.lblencoding.caption
msgid "Encodin&g:"
msgstr "Codering:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "Sluit submappen uit"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Sluit bestanden uit"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "&Bestandmasker"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Begin in map"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Doorzoek submappen:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Vorige zoekopdrachten:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Open in nieuw(e) tabblad(en)"
#: tfrmfinddlg.mioptions.caption
#, fuzzy
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Opties"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Verwijder uit lijst"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.miseparator1.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.miseparator2.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Toon alle gevonden elementen"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Toon in bewerker"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Toon in kijker"
#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Tonen"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Geavanceerd"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Laden/Opslaan"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Invoegtoepassingen"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Resultaten"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Standaard"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Zoeken"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Zoeken"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "Hoofdlettergevoelig"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Maak harde koppeling"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "tfrmhardlink.lblexistingfile.caption"
msgid "&Destination that the link will point to"
msgstr "&Bestemming waar de koppeling naar zal verwijzen"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "tfrmhardlink.lbllinktocreate.caption"
msgid "&Link name"
msgstr "&Naam van koppeling"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr "Importeer alles."
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr "Importeer geselecteerde"
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr "Kies de elementen die u wilt invoeren"
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Bij klikken op een submenu, selecteert dit het hele menu"
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Houd CTRL ingedrukt en klik op elementen om er meerdere te kiezen"
#: tfrmlinker.btnsave.caption
msgctxt "tfrmlinker.btnsave.caption"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgid "Linker"
msgstr "Koppelaar"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Opslaan in..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Element"
#: tfrmlinker.lblfilename.caption
msgid "&File name"
msgstr "&Bestandnaam"
#: tfrmlinker.spbtndown.caption
msgid "Do&wn"
msgstr "Om&laag"
#: tfrmlinker.spbtndown.hint
msgid "Down"
msgstr "Omlaag"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "&Verwijderen"
#: tfrmlinker.spbtnrem.hint
msgctxt "TFRMLINKER.SPBTNREM.HINT"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmlinker.spbtnup.caption
msgctxt "tfrmlinker.spbtnup.caption"
msgid "&Up"
msgstr "&Omhoog"
#: tfrmlinker.spbtnup.hint
msgid "Up"
msgstr "Omhoog"
#: tfrmmain.actabout.caption
msgid "&About"
msgstr "Over"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Voeg bestandnaam toe aan opdrachtregel"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Voeg pad en bestandnaam toe aan opdrachtregel"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Kopieer pad naar opdrachtregel"
#: tfrmmain.actbriefview.caption
msgid "Brief view"
msgstr "Korte weergave"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Korte weergave"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Bereken in gebruik zijnde ruimte..."
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Wijzig map"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Wijzig map naar uw persoonlijke map"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Wijzig map naar bovenliggende map"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Wijzig map naar root"
#: tfrmmain.actchecksumcalc.caption
msgid "Calculate Check&sum..."
msgstr "Bereken checksum..."
#: tfrmmain.actchecksumverify.caption
msgid "&Verify Checksum..."
msgstr "Verifieer checksum..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Maak logboekbestand leeg"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Maak logboekvenster leeg"
#: tfrmmain.actclosealltabs.caption
msgid "Close &All Tabs"
msgstr "Sluit alle tabbladen"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Sluit dubbele tabbladen"
#: tfrmmain.actclosetab.caption
msgid "&Close Tab"
msgstr "&Sluit tabblad"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Volgende opdrachtregel"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Stel opdrachtregel in op de volgende opdracht in de geschiedenis"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Vorige opdrachtregel"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Stel opdrachtregel in op de vorige opdracht in de geschiedenis"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Volledig"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Kolommenoverzicht"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Vergelijk op inhoud"
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr "Vergelijk mappen"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Vergelijk mappen"
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Instellingen van lijst met mapfavorieten"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Instelling van favoriete tabbladen"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Instellingen van maptabbladen"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Sla instellingen op"
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Werkbalk..."
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Instellingen van boomstructuurmenu"
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Instellingen van kleuren van boomstructuurmenu"
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Toon contextmenu"
#: tfrmmain.actcopy.caption
msgctxt "TFRMMAIN.ACTCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Kopieer alle tabbladen naar de andere kant"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Kopieer alle getoonde kolommen"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Kopieer bestandna(a)m(en) met volledig pad"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Kopieer bestandna(a)m(en) naar klembord"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Kopieer bestanden zonder om bevestiging te vragen"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr ""
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Kopieer volledig pad van gekozen bestand(en)"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Kopieer naar zelfde werkbalk"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "Kopiëren"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Toon in gebruik zijnde ruimte"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Knippen"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Toon parameters voor opdrachtregel"
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgid "Directory history"
msgstr "Mapgeschiedenis"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Favorietenlijst voor mappen"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Kies een opdracht en voer die uit"
#: tfrmmain.actedit.caption
msgctxt "TFRMMAIN.ACTEDIT.CAPTION"
msgid "Edit"
msgstr "Bewerken"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Bewerk commentaar..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Bewerk nieuw bestand"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Bewerk padveld boven bestandenlijst"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Wissel panelen om"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "Af&sluiten"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "Bestanden uitpakken..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Instelling van bestandassociaties..."
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "Combineer bestanden..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Toon bestandeigenschappen"
#: tfrmmain.actfilespliter.caption
msgid "Spl&it File..."
msgstr "Splits bestand..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "&Platte weergave"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Stel scherp op opdrachtregel"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Plaats aanwijzer op eerste bestand in lijst"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Plaats aanwijzer op laatste bestand in lijst"
#: tfrmmain.acthardlink.caption
msgid "Create &Hard Link..."
msgstr "Maak harde koppeling..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Inhoud"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "&Horizontale paneelmodus"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Toetsenbord"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Korte weergave op linkerpaneel"
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Kolomweergave op linkerpaneel"
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Links &= Rechts"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "Platte weergave op linkerpaneel"
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Open schijvenlijst links"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Draai volgorde op linkerpaneel om"
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Rangschik linkerpaneel op attributen"
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Rangschik linkerpaneel op datum"
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "Rangschik linkerpaneel op extensie"
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "Rangschik linkerpaneel op naam"
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Rangschik linkerpaneel op grootte"
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Miniatuurweergave op linkerpaneel"
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "Laad tabbladen van favoriete tabbladen"
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Laad selectie van klembord"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "&Laad selectie vanuit bestand..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "&Laad tabbladen vanuit bestand"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "Maak map"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Selecteer alles met dezelfde extensie"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "Draai selectie om"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "&Selecteer alles"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "Deselecteer een groep"
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "Selecteer een groep..."
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "Deselecteer alles"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimaliseer venster"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Gereedschap voor meervoudig hernoemen"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Netwerk &verbinden..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "Netwerk verbreken"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Netwerk snel verbinden..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Nieuw tabblad"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr "Laad de volgende favoriete tabbladen in de lijst"
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Spring naar volgende tabblad"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Openen"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Probeer archiefbestand te openen"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Open balkbestand"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Open map in een nieuw tabblad"
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgid "Open &VFS List"
msgstr "Open VFS-lijst"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "Bewerkingenkijker"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Opties..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "Bestanden &inpakken..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Stel splitserpositie in"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "&Plakken"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Laad de vorige favoriete tabbladen in de lijst"
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Schakel naar vorige tabblad"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Snelfilter"
#: tfrmmain.actquicksearch.caption
msgid "Quick search"
msgstr "Snel zoeken"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "&Snel overzicht-paneel"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Verversen"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Herlaad de laatst geladen favoriete tabbladen"
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Verplaatsen"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Verplaats/hernoem bestanden zonder te vragen om bevestiging"
#: tfrmmain.actrenameonly.caption
msgctxt "tfrmmain.actrenameonly.caption"
msgid "Rename"
msgstr "Hernoemen"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "&Hernoemen-tabblad"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Sla opnieuw op, op de laatst geladen favoriete tabbladen"
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Herstel selectie"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "Keer volgorde om"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Korte weergave op rechterpaneel"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Kolomweergave op rechterpaneel"
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Rechts &= Links"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "Platte weergave op rechterpaneel"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Open rechter-schijvenlijst"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "Draai volgorde op rechterpaneel om"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Rangschik rechterpaneel op attributen"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Rangschik rechterpaneel op datum"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Rangschik rechterpaneel op extensie"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Rangschik rechterpaneel op naam"
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Rangschik rechterpaneel op grootte"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Miniaturenweergave op rechterpaneel"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Start terminalvenster"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Sla huidige tabbladen op naar nieuwe favoriete tabbladen"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Sla selectie op"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Sla selectie op in bestand..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "&Sla tabbladen op in bestand"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Zoeken..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Alle tabbladen vergrendeld met map geopend in nieuwe tabbladen"
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Zet alle tabbladen terug op normaal"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Zet alle tabbladen op vergrendeld"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Alle tabbladen vergrendeld met mapwijzigingen toegestaan"
#: tfrmmain.actsetfileproperties.caption
msgid "Change &Attributes..."
msgstr "Wijzig attributen..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Vergrendeld met mappen geopend in nieuwe tabbladen"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normaal"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Vergrendeld"
#: tfrmmain.actsettaboptionpathresets.caption
msgid "Locked with &Directory Changes Allowed"
msgstr "Vergrendeld, maar mapwijzigingen zijn toegestaan"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Openen"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Open met gebruik van systeemassociaties"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Toon knoppenmenu"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Toon opdrachtregelgeschiedenis"
#: tfrmmain.actshowmainmenu.caption
msgid "Menu"
msgstr "Menu"
#: tfrmmain.actshowsysfiles.caption
msgid "Show &Hidden/System Files"
msgstr "Toon verborgen-/systeembestanden"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Rangschik op attributen"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Sorteer op datum"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Sorteer op extensie"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Sorteer op naam"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Sorteer op grootte"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Open schijvenlijst"
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "In-/uitschakelen negeer-lijstbestand (om geen bestandnamen te tonen)"
#: tfrmmain.actsymlink.caption
msgid "Create Symbolic &Link..."
msgstr "Maak symbolische koppeling..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr "Synchroniseer mappen..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Doel is bron"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Archiefbestand(en) beproeven"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Miniaturen"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Miniaturenoverzicht"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr "Schakel de schermvullende modus om voor het terminalvenster"
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Verplaats map onder aanwijzer naar linkervenster"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Verplaats map onder aanwijzer naar rechtervenster"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "Boomstructuurpaneel"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr "Rangschik op parameters"
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Deselecteer alles met dezelfde extensie"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
msgctxt "TFRMMAIN.ACTVIEW.CAPTION"
msgid "View"
msgstr "Tonen"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Toon geschiedenis van bezochte paden voor actief beeld"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Ga naar volgend element in geschiedenis"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Ga naar vorig element in geschiedenis"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Toon logboekbestand"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Bezoek de website van Double Commander"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Wissen"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr "Werk met een lijst van favoriete mappen en parameters"
#: tfrmmain.btnf10.caption
msgctxt "TFRMMAIN.BTNF10.CAPTION"
msgid "Exit"
msgstr "Afsluiten"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Map"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminalvenster"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Lijst met favoriete mappen"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Toon huidige map van rechterpaneel in linkerpaneel"
#: tfrmmain.btnlefthome.caption
msgctxt "tfrmmain.btnlefthome.caption"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Ga naar persoonlijke map"
#: tfrmmain.btnleftroot.caption
msgctxt "tfrmmain.btnleftroot.caption"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Ga naar rootmap"
#: tfrmmain.btnleftup.caption
msgctxt "tfrmmain.btnleftup.caption"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Ga naar bovenliggende map"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Lijst met favoriete mappen"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Toon huidige map van linkerpaneel in rechterpaneel"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "tfrmmain.lblcommandpath.caption"
msgid "Path"
msgstr "Pad"
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Annuleren"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Kopiëren..."
#: tfrmmain.mihardlink.caption
msgid "Create link..."
msgstr "Maak koppeling..."
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline10.caption
msgctxt "TFRMMAIN.MILINE10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline11.caption
msgctxt "TFRMMAIN.MILINE11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline21.caption
msgctxt "TFRMMAIN.MILINE21.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline23.caption
msgctxt "TFRMMAIN.MILINE23.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline26.caption
msgctxt "TFRMMAIN.MILINE26.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline33.caption
msgctxt "TFRMMAIN.MILINE33.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline37.caption
msgctxt "TFRMMAIN.MILINE37.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline38.caption
msgctxt "TFRMMAIN.MILINE38.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline39.caption
msgctxt "TFRMMAIN.MILINE39.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline40.caption
msgctxt "TFRMMAIN.MILINE40.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline50.caption
msgctxt "TFRMMAIN.MILINE50.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline55.caption
msgctxt "TFRMMAIN.MILINE55.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Leegmaken"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Verbergen"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Selecteer alles"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Verplaatsen..."
#: tfrmmain.misymlink.caption
msgid "Create symlink..."
msgstr "Maak symbolische koppeling..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Opties voor tabbladen"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "Af&sluiten"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Herstellen"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Beginnen"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Annuleren"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Opdrachten"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "&Instellingen"
#: tfrmmain.mnucontextline1.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mnucontextline2.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Favorieten"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Bestanden"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "&Hulp"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Markeren"
#: tfrmmain.mnunetwork.caption
msgctxt "tfrmmain.mnunetwork.caption"
msgid "Network"
msgstr "Netwerk"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Tonen"
#: tfrmmain.mnutaboptions.caption
msgid "Tab &Options"
msgstr "Opties voor tabbladen"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Tabbladen"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Knippen"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Bewerken"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Plakken"
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr "Kies uw interne opdracht"
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Ouderwets gerangschikt"
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
msgid "Legacy sorted"
msgstr "Ouderwets gerangschikt"
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Kies standaard alle categorieën"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Selectie:"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "Categorieën:"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "Opdrachtnaam:"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "Filter:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Wenk:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Sneltoets:"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr "cm_name"
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "Categorie"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Hulp"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Wenk"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Sneltoets"
#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Toevoegen"
#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "&Hulp"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "Definiëren..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Hoofdlettergevoelig"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr "Negeer accenten en verbindingstekens"
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Invoer masker:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "Of kies een voorgedefinieerde keuzesoort:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Maak nieuwe map"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "Geef nieuwe mapnaam:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr "Nieuwe grootte"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Hoogte:"
#: tfrmmodview.lblpath1.caption
msgctxt "tfrmmodview.lblpath1.caption"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Kwaliteit van compressie naar JPG"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Breedte:"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Hoogte"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "tfrmmodview.tewidth.text"
msgid "Width"
msgstr "Breedte"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Sluiten"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Verwijderen"
#: tfrmmultirename.btnedit.caption
msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Bewerken"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "Laden"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "Hernoemen"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Zet alles terug op standaardwaarden"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Opslaan"
#: tfrmmultirename.caption
msgid "MultiRename"
msgstr "Meervoudig hernoemen"
#: tfrmmultirename.cblog.caption
msgid "Ena&ble"
msgstr "Inschakelen"
#: tfrmmultirename.cbregexp.caption
msgid "Regular e&xpressions"
msgstr "&Reguliere uitdrukkingen"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "Gebruik vervanging"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E]xtensie"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Teller"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Zoek en vervang"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Logboek van resultaat"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Masker"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Voorinstellingen"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "Extensie"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "Zoeken..."
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "Tussenpoze"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "Bestandnaam"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "Vervangen..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "Aanvangsgetal"
#: tfrmmultirename.lbwidth.caption
msgid "&Width"
msgstr "Breedte"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[T]eller"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D]ag"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Dag (twee cijfers)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Weekdag (kort, bijv. 'ma')"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Weekdag (lang, bijv. 'maandag')"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Teken op positie x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Tekens van positie x tot y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[u] Uur"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Uur (twee cijfers)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minuut"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minuut (twee cijfers)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Maand"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Maand (twee cijfers)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Maandnaam (kort, bijv. 'jan')"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Maandnaam (lang, bijv. 'januari')"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Naam"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Teken op positie x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Tekens van positie x tot y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Tijd..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Extensie..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Naam..."
#: tfrmmultirename.miplugin.caption
msgctxt "tfrmmultirename.miplugin.caption"
msgid "Plugin"
msgstr "Invoegtoepassing"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Seconde"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Seconden (twee cijfers)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Jaar (twee cijfers)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Jaar (vier cijfers)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Bewerk namen..."
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Laad namen vanuit bestand..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgid "Old File Name"
msgstr "Oude bestandnaam"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgid "New File Name"
msgstr "Nieuwe bestandnaam"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgid "File Path"
msgstr "Bestandpad"
#: tfrmmultirenamewait.caption
msgctxt "TFRMMULTIRENAMEWAIT.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr "Klik op OK wanneer u de bewerker hebt gesloten, om de gewijzigde namen te laden."
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Kies een toepassing"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Aangepaste opdracht"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Sla associatie op"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Stel gekozen toepassingen in als standaardactie"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Bestandsoort om te openen: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Meerdere bestandnamen"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Meerdere URI's"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Enkele bestandnaam"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "Enkele URI"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgid "&Apply"
msgstr "&Toepassen"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Opties"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Kies a.u.b. een van de subpagina's, want deze pagina bevat geen instellingen."
#: tfrmoptionsarchivers.btnautoconfig.caption
msgid "A&uto Configure"
msgstr "Automatisch instellen"
#: tfrmoptionsarchivers.btnmultiarcadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
msgid "A&dd"
msgstr "Toevoegen"
#: tfrmoptionsarchivers.btnmultiarcapply.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption"
msgid "A&pply"
msgstr "Toepassen"
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption"
msgid "D&elete"
msgstr "Verwijderen"
#: tfrmoptionsarchivers.btnmultiarcrename.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
msgid "&Rename"
msgstr "Hernoemen"
#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
msgid "De&bug mode"
msgstr "Foutopsporingsmodus"
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
msgid "E&nabled"
msgstr "Ingeschakeld"
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
msgid "S&how console output"
msgstr "Toon uitvoer van terminal"
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
msgid "Options"
msgstr "Opties"
#: tfrmoptionsarchivers.lblarchiveadd.caption
msgid "Add&ing:"
msgstr "Toevoegen:"
#: tfrmoptionsarchivers.lblarchiveextension.caption
msgid "E&xtension:"
msgstr "Extensie:"
#: tfrmoptionsarchivers.lblarchiveextract.caption
msgid "Ex&tract:"
msgstr "Uitpakken:"
#: tfrmoptionsarchivers.lblarchivelist.caption
msgid "&List:"
msgstr "&Lijst:"
#: tfrmoptionsarchivers.lblarchivelistend.caption
msgid "Listing &finish (optional):"
msgstr "Lijsteinde (optioneel):"
#: tfrmoptionsarchivers.lblarchivelistformat.caption
msgid "Listing for&mat:"
msgstr "Lijstopmaak:"
#: tfrmoptionsarchivers.lblarchiveliststart.caption
msgid "Listin&g start (optional):"
msgstr "Lijstbegin (optioneel):"
#: tfrmoptionsarchivers.lblarchiver.caption
msgid "Arc&hiver:"
msgstr "Inpakker:"
#: tfrmoptionsarchivers.lbldescription.caption
msgid "De&scription:"
msgstr "Omschrijving:"
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgid "Additional"
msgstr "Extra"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr "Algemeen"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgid "When &size, date or attributes change"
msgstr "Als grootte, datum of attributen wijzigen"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "Voor de volgende paden en hun submappen:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgid "When &files are created, deleted or renamed"
msgstr "Als bestanden worden gemaakt, verwijderd of hernoemd"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgid "When application is in the &background"
msgstr "Als toepassing op de achtergrond is"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgid "Disable auto-refresh"
msgstr "Schakel automatisch verversen uit"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgid "Refresh file list"
msgstr "Ververs bestandenlijst"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgid "Al&ways show tray icon"
msgstr "Toon systeemvakpictogram altijd"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Automatisch verbergen niet-aangekoppelde apparaten"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgid "Mo&ve icon to system tray when minimized"
msgstr "Verplaats pictogram naar systeemvak indien geminimaliseerd"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgid "A&llow only one copy of DC at a time"
msgstr "Slechts één actief exemplaar van DC toestaan"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Hier kunt u een of meer schijven of koppelpunten opgeven, gescheiden door puntkomma."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Zwarte lijst voor schijven"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Kolomgrootte"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Toon bestandextensies"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "uitgelijnd (met tabblad)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "direct na bestandnaam"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Auto"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Vast aantal kolommen"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Vaste kolombreedte"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "Kap tekst af op kolombreedte"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "Horizontale regels"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "Verticale regels"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "Automatisch invullen kolommen"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Toon raster"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Auto-grootte kolommen"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Automatische grootte kolom:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "Toepassen"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "Bewerken"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "Opdrachtregelgeschiedenis"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgid "&Directory history"
msgstr "Mapgeschiedenis"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "Bestandmaskergeschiedenis"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "Instellingen opslaan"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "Geschiedenis van zoeken en vervangen"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Mappen"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Locatie van instellingbestanden"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Opslaan bij afsluiten"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Rangschikvolgorde van instellingenvolgorde in linkerboom"
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Instellen op opdrachtregel"
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "Programmamap (overdraagbare versie)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "Persoonlijke map van gebruiker"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
msgid "All"
msgstr "Alles"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
msgid "Apply modification to all columns"
msgstr "Pas wijziging toe op alle kolommen"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
msgid "&Delete"
msgstr "Ver&wijderen"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Ga naar ingestelde standaard"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
msgid "New"
msgstr "Nieuw"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "Volgende"
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "Vorige"
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
msgid "Rename"
msgstr "Hernoemen"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
msgid "Reset to default"
msgstr "Terugzetten op standaard"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
msgid "Save as"
msgstr "Opslaan als"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
msgid "Save"
msgstr "Opslaan"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Overkleur toestaan"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "Bij klikken om iets te veranderen, verander dat voor alle kolommen"
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
msgid "General"
msgstr "Algemeen"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Rand van aanwijzer"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Gebruik randaanwijzer"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Gebruik kleur voor inactieve selectie"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Gebruik omgedraaide selectie"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Gebruik aangepast lettertype en kleurtje voor deze weergave"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgid "BackGround:"
msgstr "Achtergrond:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgid "Background 2:"
msgstr "Achtergrond 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Stel kolomweergave in:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Huidige kolomnaam]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgid "Cursor Color:"
msgstr "Aanwijzerkleur:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgid "Cursor Text:"
msgstr "Aanwijzertekst:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgid "Font:"
msgstr "Lettertype:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
msgid "Size:"
msgstr "Grootte:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgid "Text Color:"
msgstr "Tekstkleur:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Inactieve aanwijzerkleur"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Inactieve markeerkleur"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgid "Mark Color:"
msgstr "Markeerkleur:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Hieronder staat een voorbeeldweergave. U kunt de aanwijzer verplaatsen en bestanden kiezen om direct een actueel beeld te krijgen van het effect van de diverse instellingen."
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Kolominstellingen:"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgid "Add column"
msgstr "Voeg kolom toe"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Plaats van omlijstingspaneel na de vergelijking:"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr "Voeg een kopie van het geselecteerde element toe"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Voeg een scheidingsteken toe"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr "Voeg map toe die ik zal intikken"
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Klap alles in"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Verwijder geselecteerd element"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr "Voeg map ertussen die ik zal intikken"
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Öpen alle takken"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Toevoegen..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Reservekopie..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Verwijderen..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Exporteren..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION"
msgid "&Help"
msgstr "Hulp"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Importeren..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Invoegen..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "Diverse..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgid "Some functions to select appropriate target"
msgstr "Enkele functies om geschikt doel te kiezen"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Rangschikken..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "Voeg ook het doel toe bij het toevoegen van een map"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Altijd boomstructuur uitklappen"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Toon alleen geldige omgevingsvariabelen"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr "Toon [ook pad] in opduikvenster"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Naam, a-z"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr "Naam, a-z"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Lijst met favoriete mappen (verander rangschikking door sleur en pleur)"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Andere opties"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr "Naam:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr "Pad:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgid "&Target:"
msgstr "Doel:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "...alleen huidige niveau van geselecteerde element(en)"
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Doorzoek pad van mapfavorieten om diegene te valideren die daadwerkelijk bestaan"
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "Doorzoek het pad en doel van de mapfavorieten om diegene te valideren die daadwerkelijk bestaan"
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "naar een mapfavorietenbestand (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "naar een 'wincmd.ini' van TC (behoud bestaande)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "naar een 'wincmd.ini' van TC (wis bestaande)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Ga naar instellen van TC-gerelateerde info"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
msgid "Go to &configure TC related info"
msgstr "Ga naar instellen van TC-gerelateerde info"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "FavMapProefMenu"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "vanuit een mapfavorietenbestand (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "van 'wincmd.ini' van TC"
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "Herstel een reservekopie van mapfavorietenlijst"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "Sla een reservekopie op van huidige mapfavorietenlijst"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Zoeken en vervangen..."
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...alles, van A tot Z."
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "...alleen een enkele elementengroep"
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "...inhoud van gekozen submenu('s), geen niveau lager"
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "...inhoud van gekozen submenu('s) en alle lagere niveaus"
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr "Probeer resulterend menu uit"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr "Toevoeging van hoofdpaneel:"
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Van alle ondersteunde bestandtypen, vraag elke keer welke te gebruiken"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Bij opslaan Unicode-tekst, sla dit op in UTF8-opmaak (anders UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Bij pleuren van tekst, genereer bestandnaam automatisch (anders vragen aan gebruiker)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "&Toon bevestigingsvenster na pleuren"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Bij sleuren en pleuren van tekst in panelen:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Plaats het meest gewenste bestandtype bovenaan de lijst (gebruik sleur en pleur):"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(als de meest gewenste niet aanwezig is, nemen we de tweede enz.)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(zal met sommige brontoepassingen niet werken. Dus probeer bij probleem uit te vinken)"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Toon bestandssysteem"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Toon vrije ruimte"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Toon etiket"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Schijvenlijst"
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Dakje voorbij einde van regel"
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Toon bijzondere tekens"
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Opties voor interne bewerker"
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Achtergrond"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "Achtergrond"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Terugzetten op standaard"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr "Opslaan"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Elementattributen"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Voorgrond"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "Voorgrond"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "&Tekstmarkering"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Gebruik (en bewerk) globale schema-instellingen"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Gebruik lokale schema-instellingen"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Vet"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Omdraaien"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Uit"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "&Aan"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Schuin"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Omdraaien"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Uit"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "&Aan"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "&Doorgestreept"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Omdraaien"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Uit"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "&Aan"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "&Onderstrepen"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "Omdraaien"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "&Uit"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "&Aan"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION"
msgid "Add..."
msgstr "Toevoegen..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION"
msgid "Delete..."
msgstr "Verwijderen..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Importeren/exporteren"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION"
msgid "Insert..."
msgstr "Invoegen..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION"
msgid "Rename"
msgstr "Hernoemen"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION"
msgid "Sort..."
msgstr "Rangschikken..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Geen"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION"
msgid "Always expand tree"
msgstr "Altijd boomstructuur uitklappen"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Nee"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Links"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Rechts"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Lijst met favoriete tabbladen (verander rangschikking door sleuren en pleuren)"
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION"
msgid "Other options"
msgstr "Andere opties"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr "Wat waar te herstellen voor het gekozen element"
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Te behouden bestaande tabbladen:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Sla mapgeschiedenis op:"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr "Links opgeslagen tabbladen zullen worden hersteld naar:"
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr "Rechts opgeslagen tabbladen zullen worden hersteld naar:"
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION"
msgid "a separator"
msgstr "een scheidingsteken"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Voeg scheidingsteken toe"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION"
msgid "sub-menu"
msgstr "submenu"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION"
msgid "Add sub-menu"
msgstr "Voeg een submenu toe"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION"
msgid "Collapse all"
msgstr "Klap alles in"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION"
msgid "...current level of item(s) selected only"
msgstr "...alleen huidige niveau van geselecteerde element(en)"
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION"
msgid "Cut"
msgstr "Knippen"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION"
msgid "delete all!"
msgstr "verwijder alles!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION"
msgid "sub-menu and all its elements"
msgstr "submenu en al zijn elementen"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION"
msgid "just sub-menu but keep elements"
msgstr "alleen submenu maar behoud de elementen"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION"
msgid "selected item"
msgstr "geselecteerd element"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION"
msgid "Delete selected item"
msgstr "Verwijder geselecteerd element"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr "Exporteer selectie naar ouderwetse .tab-bestand(en)"
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr "FavTabsProefMenu"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr "Importeer ouderwetse .tab-bestand(en) overeenkomstig de standaardinstelling"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Importeer ouderwetse .tab-bestanden op de gekozen positie"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Importeer ouderwetse .tab-bestanden op gekozen positie"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr "Importeer ouderwetse .tab-bestanden op gekozen positie in een submenu"
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Voeg scheidingsteken toe"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Voeg submenu toe"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION"
msgid "Open all branches"
msgstr "Öpen alle takken"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION"
msgid "Paste"
msgstr "Plakken"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION"
msgid "Rename"
msgstr "Hernoemen"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTEVERYTHING.CAPTION"
msgid "...everything, from A to Z!"
msgstr "...alles, van A tot Z."
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP.CAPTION"
msgid "...single group of item(s) only"
msgstr "...alleen een enkele elementengroep"
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP2.CAPTION"
msgid "Sort single group of item(s) only"
msgstr "Rangschik alleen een enkele elementengroep"
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLESUBMENU.CAPTION"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "...inhoud van gekozen submenu('s), geen niveau lager"
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSUBMENUANDSUBLEVEL.CAPTION"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "...inhoud van gekozen submenu('s) en alle lagere niveaus"
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MITESTRESULTINGFAVORITETABSMENU.CAPTION"
msgid "Test resulting menu"
msgstr "Probeer resulterend menu uit"
#: tfrmoptionsfileassoc.btnaddact.caption
msgid "Add"
msgstr "Toevoegen"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
msgid "&Add"
msgstr "Toe&voegen"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
msgid "A&dd"
msgstr "&Toevoegen"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr "Klonen"
#: tfrmoptionsfileassoc.btndownact.caption
msgid "&Down"
msgstr "Omlaag"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION"
msgid "Edit"
msgstr "Bewerken"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Invoegen"
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION"
msgid "Insert"
msgstr "Invoegen"
#: tfrmoptionsfileassoc.btnremoveact.caption
msgid "Remo&ve"
msgstr "Verwijderen"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgid "Re&move"
msgstr "Verwijderen"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
msgid "&Remove"
msgstr "Ver&wijderen"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "Hernoemen"
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
msgid "&Up"
msgstr "&Omhoog"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr "Beginpad van de opdracht. Zet deze tekenreeks nimmer tussen aanhalingstekens."
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr "Naam van de actie. Niet voor het systeem, alleen voor u"
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr "Parameter om mee te geven aan de opdracht. Let op juiste omgang met spaties in bestandnamen."
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr "Opdracht om uit te voeren. Let op juiste omgang met spaties in bestandnamen."
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr "Actiebeschrijving:"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Acties"
#: tfrmoptionsfileassoc.gbexts.caption
msgid "Extensions"
msgstr "Extensies"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Kan worden geselecteerd door sleur en pleur"
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Bestandtypes"
#: tfrmoptionsfileassoc.gbicon.caption
msgid "Icon"
msgstr "Pictogram"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Bestandtypes kunnen worden gerangschikt door sleur en pleur"
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Extensies kunnen worden gerangschikt door sleur en pleur"
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Bestandtypes kunnen worden gerangschikt door sleur en pleur"
#: tfrmoptionsfileassoc.lblaction.caption
msgid "Action name:"
msgstr "Actienaam:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgid "&Command:"
msgstr "&Opdracht:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parameters:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "&Beginpad:"
#: tfrmoptionsfileassoc.menuitem1.caption
msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Aangepast met..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Aangepast"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
msgid "Edit"
msgstr "Bewerken"
#: tfrmoptionsfileassoc.mieditor.caption
msgid "Open in Editor"
msgstr "Openen in bewerker"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Bewerken met..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgid "Get output from command"
msgstr "Verkrijg uitvoer van opdracht"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Open in interne bewerker"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Open in interne kijker"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
msgid "Open"
msgstr "Openen"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Openen met..."
#: tfrmoptionsfileassoc.miseparator.caption
msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgid "Run in terminal"
msgstr "Voer uit in terminalvenster"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
msgid "View"
msgstr "Tonen"
#: tfrmoptionsfileassoc.miviewer.caption
msgid "Open in Viewer"
msgstr "Open in kijker"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Bekijken met..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Klik op mij om pictogram te veranderen."
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "Voer uit via schil"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Uitgebreid contextmenu"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXTENDEDCONTEXTMENU.HINT"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Instelling van bestandassociatie"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "Uitvoeren via terminal en sluiten"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "Voer uit via terminal en blijf geopend"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Onderdelen voor uitgebreide opties:"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgid "Show confirmation window for:"
msgstr "Toon bevestigingsvenster voor:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Kopieerbewerking"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "&Verwijderbewerking"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Verwijder naar prullenbak (Shift keert deze instelling om)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Bewerking inzake verwijdering naar prullenbak"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgid "D&rop readonly flag"
msgstr "Laat alleen-lezen-vlag vallen"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "&Verplaatsbewerking"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "Verwerk commentaren met bestanden/mappen"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Selecteer alleen de bestandnaam met hernoemen (niet de extensie)"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Toon tabbladselectiepaneel in kopieer/verplaats-dialoogvenster"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "Sla fouten bij bestandbewerkingen over en schrijf deze in het logboekvenster"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Uitvoeren van bewerkingen"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Gebruikersschil"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "&Buffergrootte voor bestandbewerkingen (in KB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr "Buffergrootte voor hashberekening (in KB):"
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Toon voortgang van bewerkingen in het begin in"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgid "Duplicated name auto-rename style:"
msgstr "Gedupliceerde naam in 'automatisch hernoemen'-stijl:"
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "Aantal wissingen:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Zet terug op standaardinstellingen van DC"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION"
msgid "Allow Overcolor"
msgstr "Overkleur toestaan"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Gebruik vensterlijst-aanwijzer"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Gebruik hellingshoekindicator"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Gebruik kleur voor inactieve selectie"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "Gebruik omgedraaide selectie"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION"
msgid "Cursor border"
msgstr "Rand van aanwijzer"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr "Vrije schijfruimte-indicator"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "Achtergrond:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgid "Backg&round 2:"
msgstr "Achtergrond 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgid "C&ursor Color:"
msgstr "Kleur van aanwijzer:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgid "Cursor Te&xt:"
msgstr "Aanwijzer tekst:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION"
msgid "Inactive Cursor Color:"
msgstr "Inactieve aanwijzerkleur"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION"
msgid "Inactive Mark Color:"
msgstr "Inactieve markeerkleur"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "&Helderheidsniveau van inactieve paneel"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Indicator achtergrondkleur:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "&Indicator voorgrondkleur:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgid "&Mark Color:"
msgstr "Markeerkleur:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "Onderstaand is een voorbeeldweergave. U kunt alvast de aanwijzer bewegen of een bestand kiezen om te kijken of het u bevalt."
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgid "T&ext Color:"
msgstr "Tekstkleur:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "&Zoek naar deel van bestandnaam"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr "Tekstzoekopdracht in bestanden"
#: tfrmoptionsfilesearch.gbfilesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Bestandzoekopdracht"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr "Standaardzoeksjabloon:"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Gebruik geheugenmapping voor zoeken tekst in bestanden"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "Gebruik stream voor zoeken tekst in bestanden"
#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "&Toevoegen"
#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "&Hulp"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "Laad bestand niet totdat een tabblad is geactiveerd"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "Toon vierkante haakjes rond mappen"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Laat nieuwe en bijgewerkte bestanden oplichten"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Schakel hernoemen in bij twee maal klikken op een naam"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgid "Load &file list in separate thread"
msgstr "Laad bestandenlijst in aparte draad"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgid "Load icons af&ter file list"
msgstr "Laad pictogrammen na bestanden lijst"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgid "Show s&ystem and hidden files"
msgstr "Toon systeem- en verborgen bestanden"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Bij selecteren bestanden met <SPATIEBALK>, ga naar beneden naar volgend bestand (zoals bij <INSERT>)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr "Windowsachtig filter bij markeren van bestanden ('.' selecteert ook bestanden zonder extensie, enz.)"
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independant attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formatteren"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Rangschikken"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Hoofdlettergevoeligheid:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Onjuiste opmaak"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "Opmaak van datum en tijd:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Opmaak van bestandgrootte:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "Voeg nieuwe bestanden in:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Rangschikken van mappen:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "&Rangschikmethode:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "&Verplaats bijgewerkte bestanden:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "Toevoegen"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "Toepassen"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "Verwijderen"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
msgid "Template..."
msgstr "Sjabloon..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Bestandsoortkleuren (sorteer door sleur en pleur)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "Categorie-attributen:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Categoriekleur:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
msgid "Category &mask:"
msgstr "Categoriemasker:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr "Categorienaam:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNPATHEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSEARCHRESULTSFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "Lettertype voor terminalvenster"
#: tfrmoptionsfonts.lbleditorfont.caption
msgid "&Editor font"
msgstr "Lettertype voor bewerker"
#: tfrmoptionsfonts.lbllogfont.caption
msgid "&Log font"
msgstr "Logboeklettertype"
#: tfrmoptionsfonts.lblmainfont.caption
msgid "Main &font"
msgstr "Standaardlettertype"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Pad van lettertype"
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Lettertype voor zoekresultaten"
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgid "Viewer&Book Font"
msgstr "Kijkerboek-lettertype"
#: tfrmoptionsfonts.lblviewerfont.caption
msgid "&Viewer font"
msgstr "Lettertype voor kijker"
#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Voeg sneltoets toe"
#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "&Verwijder sneltoets"
#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "&Bewerk sneltoets"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Hernoemen"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
msgid "&Filter"
msgstr "&Filter"
#: tfrmoptionshotkeys.lblcategories.caption
msgid "C&ategories:"
msgstr "Categorieën:"
#: tfrmoptionshotkeys.lblcommands.caption
msgid "Co&mmands:"
msgstr "Opdrachten:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgid "&Shortcut files:"
msgstr "&Sneltoetsbestanden:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Opdracht"
#: tfrmoptionshotkeys.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Voor de volgende paden en hun submappen:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Toon pictogrammen voor acties in menu's"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgid "Show o&verlay icons, e.g. for links"
msgstr "Toon opplakpictogrammen, bijv. voor koppelingen"
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Schakel speciale pictogrammen uit"
#: tfrmoptionsicons.gbiconssize.caption
msgid " Icon size "
msgstr " Pictogramgrootte "
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgid " Show icons to the left of the filename "
msgstr "Toon pictogrammen links van de bestandnaam"
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
msgid "A&ll"
msgstr "&Alles"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgid "All associated + &EXE/LNK (slow)"
msgstr "Alle geassocieerde + &EXE/LNK (langzaam)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgid "&No icons"
msgstr "&Geen pictogrammen"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgid "Only &standard icons"
msgstr "Alleen standaardpictogrammen"
#: tfrmoptionsignorelist.btnaddsel.caption
msgid "A&dd selected names"
msgstr "Voeg geselecteerde namen toe"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgid "Add selected names with &full path"
msgstr "Voeg geselecteerde namen toe met volledig pad"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Negeer (toon niet) de volgende bestanden en mappen:"
#: tfrmoptionsignorelist.lblsavein.caption
msgid "&Save in:"
msgstr "&Opslaan in:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Linker-, rechterpijlen wijzigen map (Lynx-achtige verplaatsing)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Tikken"
#: tfrmoptionskeyboard.lblalt.caption
msgid "Alt+L&etters:"
msgstr "Al&t+Letters:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgid "Ctrl+Alt+Le&tters:"
msgstr "&Ctrl+Alt+Letters:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "&Letters:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr "Platte knoppen"
#: tfrmoptionslayout.cbflatinterface.caption
msgid "Flat i&nterface"
msgstr "Platte gebruikersschil"
#: tfrmoptionslayout.cbflattoolbar.caption
msgid "Flat b&uttons"
msgstr "Platte knoppen"
#: tfrmoptionslayout.cbfreespaceind.caption
msgid "Show fr&ee space indicator on drive label"
msgstr "Toon vrije ruimte-indicator op schijfetiket"
#: tfrmoptionslayout.cblogwindow.caption
msgid "Show lo&g window"
msgstr "Toon logboekvenster"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgid "Show panel of operation in background"
msgstr "Toon bewerkingspaneel op achtergrond"
#: tfrmoptionslayout.cbproginmenubar.caption
msgid "Show common progress in menu bar"
msgstr "Toon algemene voortgang in menubalk"
#: tfrmoptionslayout.cbshowcmdline.caption
msgid "Show command l&ine"
msgstr "Toon opdrachtregel"
#: tfrmoptionslayout.cbshowcurdir.caption
msgid "Show current director&y"
msgstr "Toon huidige map"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgid "Show &drive buttons"
msgstr "Toon &schijfknoppen"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgid "Show free s&pace label"
msgstr "Toon vrije ruimte-etiket"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Toon schijvenlijstknop"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgid "Show function &key buttons"
msgstr "Toon &functietoetsknoppen"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgid "Show &main menu"
msgstr "Toon hoofdmenu"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgid "Show tool&bar"
msgstr "Toon werkbalk"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Toon kort vrije ruimte-etiket"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgid "Show &status bar"
msgstr "Toon statusbalk"
#: tfrmoptionslayout.cbshowtabheader.caption
msgid "S&how tabstop header"
msgstr "Toon &tabstop-kop"
#: tfrmoptionslayout.cbshowtabs.caption
msgid "Sho&w folder tabs"
msgstr "Toon map-tabbladen"
#: tfrmoptionslayout.cbtermwindow.caption
msgid "Show te&rminal window"
msgstr "Toon terminalvenster"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Toon twee schijfknoppenbalken (vaste breedte, boven bestandenvensters)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgid " Screen layout "
msgstr " Schermvormgeving "
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Toon inhoud van logboekbestand"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Neem datum op in naam van logboekbestand"
#: tfrmoptionslog.cblogarcop.caption
msgid "&Pack/Unpack"
msgstr "Inpakken/uitpakken"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Externe uitvoering van opdrachtregel"
#: tfrmoptionslog.cblogcpmvln.caption
msgid "Cop&y/Move/Create link/symlink"
msgstr "Kopieer/Verplaats/Maak koppeling/symbolische koppeling"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "Verwijderen"
#: tfrmoptionslog.cblogdirop.caption
msgid "Crea&te/Delete directories"
msgstr "Maak/verwijder mappen"
#: tfrmoptionslog.cblogerrors.caption
msgid "Log &errors"
msgstr "Leg fouten vast in logboek"
#: tfrmoptionslog.cblogfile.caption
msgid "C&reate a log file:"
msgstr "Maak een logboekbestand:"
#: tfrmoptionslog.cbloginfo.caption
msgid "Log &information messages"
msgstr "Leg informatieve berichten vast in logboek"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Starten/afsluiten"
#: tfrmoptionslog.cblogsuccess.caption
msgid "Log &successful operations"
msgstr "Leg gelukte bewerkingen vast in logboek"
#: tfrmoptionslog.cblogvfs.caption
msgid "&File system plugins"
msgstr "Invoegtoepassingen voor bestandssysteem"
#: tfrmoptionslog.gblogfile.caption
msgid "File operation log file"
msgstr "Logboekbestand voor bestandbewerking"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Bewerkingen vastleggen in logboek"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Bewerkingsstatus"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "Verwijder miniaturen van niet langer bestaande bestanden"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
msgid "View log file content"
msgstr "Toon inhoud van logboekbestand"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION"
msgid "Create new with the encoding:"
msgstr "Maak nieuwe met de codering:"
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Ga altijd naar de root van een schijf bij verandering van schijven"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Toon waarschuwingen (alleen 'OK'-knop)"
#: tfrmoptionsmisc.chkthumbsave.caption
msgid "&Save thumbnails in cache"
msgstr "Sla miniaturen op in tijdelijke opslag"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Miniaturen"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr "Bestandcommentaren (beschrij.ving)"
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "Betreffende TC-export/-import:"
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION"
msgid "Default encoding:"
msgstr "Standaardcodering:"
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Instellingenbestand:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "TC-uitvoerbaar:"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Uitvoerpad van werkbalk:"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "pixels"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Miniatuurgrootte:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Selectie door muis"
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Schuiven"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Selectie"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "Modus:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "&Regel voor regel"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Regel voor regel met aanwijzerbeweging"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Pagina voor pagina"
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "Toevoegen"
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "Instellen"
#: tfrmoptionsplugins.btnenableplugin.caption
msgid "E&nable"
msgstr "Inschakelen"
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "Verwijderen"
#: tfrmoptionsplugins.btntweakplugin.caption
msgid "&Tweak"
msgstr "Aanpassen"
#: tfrmoptionsplugins.lbldsxdescription.caption
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Invoegtoepassingen voor zoeken stellen u in staat om alternatieve zoekalgorithmes of externe gereedschappen (zoals 'locate', etc.) te gebruiken."
#: tfrmoptionsplugins.lblwcxdescription.caption
msgid "Pack&er plugins are used to work with archives"
msgstr "Invoegtoepassingen voor inpakken worden gebruikt om te werken met archiefbestanden"
#: tfrmoptionsplugins.lblwdxdescription.caption
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Invoegtoepassingen voor inhoud stellen u in staat om uitgebreide bestanddetails weer te geven, zoals mp3-etiketten of afbeeldingsattributen in bestandlijsten, of gebruik ze in het zoek- en hernoemgereedschap"
#: tfrmoptionsplugins.lblwfxdescription.caption
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Bestandssysteem-invoegtoepassingen geven u toegang tot schijven die niet benaderbaar zijn door het besturingsssysteem of tot externe apparaten zoals Palm/PocketPC."
#: tfrmoptionsplugins.lblwlxdescription.caption
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Kijker-invoegtoepassingen laten bestandsoorten zoals plaatjes, rekenbladen, gegevensbanken enz. zien in Kijker (F3, Ctrl+Q)"
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Actief"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr "Invoegtoepassing"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Geregistreerd voor"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr "Bestandnaam"
#: tfrmoptionsplugins.tsdsx.caption
msgid "&Search plugins (.DSX)"
msgstr "Zoek-invoegtoepassingen (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
msgid "Pac&ker plugins (.WCX)"
msgstr "Inpak-invoegtoepassingen (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
msgid "Content pl&ugins (.WDX)"
msgstr "Inhoud-invoegtoepassingen (.WDX)"
#: tfrmoptionsplugins.tswfx.caption
msgid "F&ile system plugins (.WFX)"
msgstr "Bestandssysteem-invoegtoepassingen (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
msgid "&Viewer plugins (.WLX)"
msgstr "Kijker-invoegtoepassingen (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgid "&Beginning (name must start with first typed character)"
msgstr "Beginnend met (naam moet beginnen met eerst getypte teken)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgid "En&ding (last character before a typed dot . must match)"
msgstr "Eindigend op (laatste teken voor een getypte punt . moet overeenkomen)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Opties"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Exacte naamovereenkomst"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Zoek hoofdletters/kleine letters"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Zoek naar deze elementen"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Behoud hernoemde naam bij ontgrendelen van een tabblad"
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Activeer doelpaneel bij klikken op een van zijn tabbladen"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgid "&Show tab header also when there is only one tab"
msgstr "Toon kop van tabblad ook als er slechts één tabblad is"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Sluit dubbele tabbladen bij het sluiten van de toepassing"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgid "Con&firm close all tabs"
msgstr "Bevestig sluiten alle tabbladen"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Bevestig het sluiten van vergrendelde tabbladen"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr "Beperk de titellengte van een tabblad tot"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgid "Show locked tabs &with an asterisk *"
msgstr "Toon beveiligde tabbladen met een sterretje *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgid "&Tabs on multiple lines"
msgstr "&Tabbladen op meerdere regels"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&Up opent nieuw tabblad op de voorgrond"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgid "Open &new tabs near current tab"
msgstr "Open nieuwe tabbladen in de buurt van huidige tabblad"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Hergebruik bestaand tabblad wanneer mogelijk"
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgid "Show ta&b close button"
msgstr "Toon sluitknop voor tabblad"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Toon altijd de schijfletter in de tabbladtitel"
#: tfrmoptionstabs.gbtabs.caption
msgid "Folder tabs headers"
msgstr "Tabbladkoppen voor mappen"
#: tfrmoptionstabs.lblchar.caption
msgid "characters"
msgstr "tekens"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Actie om te doen bij het dubbelklikken op een tabblad"
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr "Positie van tabbladen"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTEXISTINGTABSTOKEEP.TEXT"
msgid "None"
msgstr "Geen"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTSAVEDIRHISTORY.TEXT"
msgid "No"
msgstr "Nee"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELLEFTSAVED.TEXT"
msgid "Left"
msgstr "Links"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELRIGHTSAVED.TEXT"
msgid "Right"
msgstr "Rechts"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr "Ga naar instellingen voor favoriete tabbladen na opslaan"
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr "Ga naar instellingen voor favoriete tabbladen na opslaan van een nieuwe"
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr "Schakel extra opties in voor favoriete tabbladen (kies doelkant bij herstellen enz.)"
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr "Standaard extra instellingen bij opslaan van nieuwe favoriete tabbladen:"
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr "Map tabbladkoppen extra"
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr "Bij herstellen van tabblad, te behouden bestaande tabbladen:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr "Links opgeslagen tabbladen zullen worden hersteld naar:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr "Rechts opgeslagen tabbladen zullen worden hersteld naar:"
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Behoud mapopslaggeschiedenis bij favoriete tabbladen:"
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr "Standaardpositie in menu bij opslaan van een nieuw favoriet tabblad:"
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Opdracht voor alleen draaien van terminalvenster:"
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Opdracht voor uitvoeren van een opdracht in de terminal en daarna sluiten:"
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Opdracht voor uitvoeren van een opdracht in de terminal en blijf geopend:"
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION"
msgid "Command:"
msgstr "Opdracht:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parameters:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION"
msgid "Command:"
msgstr "Opdracht:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parameters:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION"
msgid "Command:"
msgstr "Opdracht:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parameters:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "Kloonknop"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "Ver&wijderen"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgid "Edit hot&key"
msgstr "Bewerk sneltoets"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgid "&Insert new button"
msgstr "Voeg nieuwe knop in"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Kiezen"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Anders..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr "Verwijder sneltoets"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Suggereren"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr "Laat DC de gereedschaptip voorstellen gebaseerd op knopsoort, opdracht en parameters"
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "TFRMOPTIONSTOOLBAR.CBFLATBUTTONS.CAPTION"
msgid "&Flat buttons"
msgstr "Platte knoppen"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Rapporteer fouten bij opdrachten"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "geef opdrachtparameters, elk in een afzonderlijke regel. Tik op F1 om hulptekst bij de parameters te tonen."
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Uiterlijk"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "&Balkgrootte:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgid "Comman&d:"
msgstr "Opdracht:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parameters:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION"
msgid "Help"
msgstr "Hulp"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Sneltoets:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Pictogram:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Pictogramgrootte:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgid "Co&mmand:"
msgstr "Opdracht:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgid "&Parameters:"
msgstr "&Parameters:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLSTARTPATH.CAPTION"
msgid "Start pat&h:"
msgstr "&Beginpad:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "Gereedschaptip:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "Voeg werkbalk toe met alle DC-opdrachten"
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "voor een externe opdracht"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "voor een interne opdracht"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "voor een scheidingsteken"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "voor een sub-werkbalk"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION"
msgid "Backup..."
msgstr "Reservekopie..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION"
msgid "Export..."
msgstr "Exporteren..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Huidige werkbalk..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
msgid "to a Toolbar File (.toolbar)"
msgstr "aan een werkbalkbestand (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
msgid "to a TC .BAR file (keep existing)"
msgstr "aan een TC .BAR-bestand (behoud bestaande)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
msgid "to a TC .BAR file (erase existing)"
msgstr "aan een TC .BAR-bestand (wis bestaande)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "naar een 'wincmd.ini' van TC (behoud bestaande)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "naar een 'wincmd.ini' van TC (wis bestaande)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Bovenste werkbalk..."
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Sla een reservekopie op van de werkbalk"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "aan een werkbalkbestand (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "aan een TC .BAR-bestand (behoud bestaande)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "aan een TC .BAR-bestand (wis bestaande)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "naar een 'wincmd.ini' van TC (behoud bestaande)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "naar een 'wincmd.ini' van TC (wis bestaande)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "net na huidige selectie"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "als eerste element"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "als laatste element"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "net voor huidige selectie"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION"
msgid "Import..."
msgstr "Importeren..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Herstel een reservekopie van werkbalk"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "Voeg toe aan huidige werkbalk"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "toe te voegen aan nieuwe werkbalk aan huidige werkbalk"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "toe te voegen aan nieuwe werkbalk aan bovenste werkbalk"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "toe te voegen aan bovenste werkbalk"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "om bovenste werkbalk te vervangen"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "van een werkbalkbestand (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "toe te voegen aan huidige werkbalk"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "toe te voegen aan nieuwe werkbalk aan huidige werkbalk"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
#, fuzzy
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "toe te voegen aan nieuwe werkbalk aan bovenste werkbalk"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "toe te voegen aan bovenste werkbalk"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "om bovenste werkbalk te vervangen"
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "van een enkel TC .BAR-bestand"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "toe te voegen aan huidige werkbalk"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "toe te voegen aan nieuwe werkbalk aan huidige werkbalk"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "toe te voegen aan nieuwe werkbalk aan bovenste werkbalk"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "toe te voegen aan bovenste werkbalk"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "om bovenste werkbalk te vervangen"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "van 'wincmd.ini' van TC..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "Voeg toe aan huidige werkbalk"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "toe te voegen aan nieuwe werkbalk aan huidige werkbalk"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "toe te voegen aan nieuwe werkbalk aan bovenste werkbalk"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "toe te voegen aan bovenste werkbalk"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "om bovenste werkbalk te vervangen"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "net na huidige selectie"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "als eerste element"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "als laatste element"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "net voor huidige selectie"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION"
msgid "Search and replace..."
msgstr "Zoeken en vervangen..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "net na huidige selectie"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "als eerste element"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "als laatste element"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "net voor huidige selectie"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "in alle bovenstaande..."
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "in alle opdrachten..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "in alle pictogramnamen..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "in alle parameters..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "in alle beginpaden..."
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "net na huidige selectie"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "als eerste element"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "als laatste element"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "net voor huidige selectie"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Knopsoort"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "&Houd terminalvenster open na uitvoering programma"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "&Uitvoeren in terminal"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "&Gebruik extern programma"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "Extra parameters"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "&Pad naar uit te voeren programma"
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "Toevoegen"
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "Toepassen"
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "Verwijderen"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Sjabloon..."
#: tfrmoptionstooltips.chkshowtooltip.caption
msgid "&Show tooltip for files in the file panel"
msgstr "Toon gereedschaptip voor bestanden in het bestandenpaneel"
#: tfrmoptionstooltips.gbcustomfields.caption
msgid "Custom fields by file type"
msgstr "Aangepaste velden per bestandsoort"
#: tfrmoptionstooltips.lblfieldslist.caption
msgid "Category &hint:"
msgstr "Categoriewenk:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Categoriemasker:"
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "Categorienaam:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "Met het menu en interne opdracht"
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION"
msgid "With the menu and internal command"
msgstr "Met het menu en interne opdracht"
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr "Gebruik het voor opdrachtregelgeschiedenis"
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr "Gebruik het voor de mapgeschiedenis"
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr "Gebruik het voor de bezichtigingsgeschiedenis (bezochte paden voor actief beeld)"
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr "Gedrag inzake selectie:"
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr "Opties inzake boomstructuurmenu:"
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr "Waar boomstructuurmenu's te gebruiken:"
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr "Bij lijst met favoriete mappen: "
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr "Bij favoriete tabbladen:"
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr "Bij geschiedenis:"
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr "Gebruik en toon sneltoets voor kiezen van elementen"
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr "Opties voor vormgeving en kleuren:"
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Achtergrond 2:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Aanwijzerkleur:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Tekstkleur zoekresultaat:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Gevonden tekst onder aanwijzer:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Normale tekstkleur:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Normale tekst onder aanwijzer:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Voorbeeldweergave van boomstructuurmenu:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr "Secundaire tekstkleur:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr "Secundaire tekst onder aanwijzer:"
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Kleur van sneltoets:"
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr "Sneltoets onder aanwijzer:"
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr "Kleur van niet-selecteerbare tekst:"
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr "Niet-selecteerbaar onder aanwijzer:"
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr "Verander kleur links en u ziet hier een vooruitblik van hoe uw boomstructuurmenu's er uit zullen gaan zien."
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Kijker boekmodus"
#: tfrmoptionsviewer.gbviewerexample.caption
msgid "Example"
msgstr "Voorbeeld"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "&Achtergrond in boekkijker"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "Lettertypekleur in boekkijker"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "&Aantal kolommen in boekkijker"
#: tfrmpackdlg.btnconfig.caption
msgctxt "tfrmpackdlg.btnconfig.caption"
msgid "Con&figure"
msgstr "Instellen"
#: tfrmpackdlg.caption
msgid "Pack files"
msgstr "Bestanden inpakken"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Maak aparte archiefbestanden, één per geselecteerd bestand/map"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Maak zelfuitpakkend archiefbestand"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "Versleutelen"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Verplaatsen naar archiefbestand"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Meerdere schijven archiefbestand"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "Plaats eerst in TAR-archiefbestand"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Ook padnamen toevoegen (alleen recursief)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Inpakken bestand(en) naar bestand:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Inpakker"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Sluiten"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Alles uitpakken en uitvoeren"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "Uitpakken en uitvoeren"
#: tfrmpackinfodlg.caption
msgid "Properties of packed file"
msgstr "Eigenschappen van ingepakt bestand"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Attributen:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Compressiefactor:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Datum:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Methode:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Oorspronkelijke grootte:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Bestand:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Ingepakte grootte:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Inpakker:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Tijd:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Sluit filterpaneel"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Geef zoektekst of filter op"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Hoofdlettergevoelig"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "D"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "TFRMQUICKSEARCH.SBDIRECTORIES.HINT"
msgid "Directories"
msgstr "Mappen"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "TFRMQUICKSEARCH.SBFILES.HINT"
msgid "Files"
msgstr "Bestanden"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Overeenkomend met begin"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Overeenkomend met einde"
#: tfrmquicksearch.tglfilter.caption
msgid "Filter"
msgstr "Filter"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Schakel tussen zoeken of filteren"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "Meer regels"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "Minder regels"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Gebruik inhoud-invoegtoepassingen, combineer met:"
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
msgid "Plugin"
msgstr "Invoegtoepassing"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Veld"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Uitvoerder"
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Waarde"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&EN (alle overeenkomsten)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&OF (elke overeenkomst)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Annuleren"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "Sluiten"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "&Hulp"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "&Selecteer de in te voegen tekens:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsetfileproperties.caption
msgid "Change attributes"
msgstr "Wijzig attributen"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Klevend"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgid "Archive"
msgstr "Archiefbestand"
#: tfrmsetfileproperties.chkcreationtime.caption
msgid "Created:"
msgstr "Gemaakt:"
#: tfrmsetfileproperties.chkhidden.caption
msgid "Hidden"
msgstr "Verborgen"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Benaderd:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Gewijzigd:"
#: tfrmsetfileproperties.chkreadonly.caption
msgid "Read only"
msgstr "Alleen-lezen"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Inclusief submappen"
#: tfrmsetfileproperties.chksystem.caption
msgid "System"
msgstr "Systeem"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Tijdstempel-eigenschappen"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attributen"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attributen"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Groep"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(grijs veld betekent ongewijzigde waarde)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Overig"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Eigenaar"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Tekst:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Uitvoeren"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION"
msgid "(gray field means unchanged value)"
msgstr "(grijs veld betekent ongewijzigde waarde)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Octaal:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lezen"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Schrijven"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Enkele functies om geschikt pad te selecteren"
#: tfrmsplitter.caption
msgid "Splitter"
msgstr "Splitser"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Vereis een CRC32-verificatiebestand"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Bestandnaam"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Bestandgrootte"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "Mapdoel"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Bestandbron"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "Aantal onderdelen"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Bytes"
#: tfrmsplitter.rbtngigab.caption
msgid "&Gigabytes"
msgstr "&Gigabytes"
#: tfrmsplitter.rbtnkilob.caption
msgid "&Kilobytes"
msgstr "&Kilobytes"
#: tfrmsplitter.rbtnmegab.caption
msgid "&Megabytes"
msgstr "&Megabytes"
#: tfrmstartingsplash.caption
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
msgid "Build"
msgstr "Bouwsel"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Besturingssysteem"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Platform"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revisie"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr "Versie"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr "WidgetsetVer"
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Annuleren"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Maak symbolische koppeling"
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Bestemming waar de koppeling naar zal verwijzen"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Koppelingsnaam"
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr "Sluiten"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr "Vergelijken"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Synchroniseren"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Synchroniseer mappen"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "asymmetrisch"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "op inhoud"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "negeer datum"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "alleen geselecteerde"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Submappen"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Toon:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
msgid "Name"
msgstr "Naam"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
msgid "Size"
msgstr "Grootte"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
msgid "Date"
msgstr "Datum"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
msgid "Date"
msgstr "Datum"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
msgid "Size"
msgstr "Grootte"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
msgid "Name"
msgstr "Naam"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(in hoofdvenster)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
msgid "Compare"
msgstr "Vergelijken"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Toon links"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Toon rechts"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "duplicaten"
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "enkelen"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Druk a.u.b. op 'Vergelijken' om te beginnen"
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr "Synchroniseren"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Bevestig overschrijven"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Boomstructuurmenu"
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr "Kies uw favoriete map:"
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr "Zoekopdracht is hoofdlettergevoelig"
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr "Volledig inklappen"
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr "Volledig uitklappen"
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr "Negeer accenten en verbindingstekens bij doorzoeking"
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr "Zoekopdracht is niet hoofdlettergevoelig"
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr "Zoekopdracht is strikt inzake accenten en verbindingstekens"
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr "Sluit boomstructuurmenu"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT"
msgid "Configuration of Tree View Menu"
msgstr "Instellingen van boomstructuurmenu"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT"
msgid "Configuration of Tree View Menu Colors"
msgstr "Instellingen van de kleuren van boomstructuurmenu"
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "Voeg nieuw toe"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annuleren"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "Wijzigen"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Standaard"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "&Verwijderen"
#: tfrmtweakplugin.caption
msgid "Tweak plugin"
msgstr "Pas invoegtoepassing aan"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Bespeur archieftype door inhoud"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Kan bestanden verwijderen"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Ondersteunt versleuteling"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Toon als normale bestanden (verberg inpakpictogram)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Ondersteunt inpakken in geheugen"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Kan bestaande archiefbestanden aanpassen"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "Archiefbestand kan meerdere bestanden bevatten"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Kan nieuwe archiefbestanden aanmaken"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "Ondersteunt het opties-dialoogvenster"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Tekst zoeken in archiefbestanden toestaan"
#: tfrmtweakplugin.lbldescription.caption
msgid "&Description:"
msgstr "Omschrijving:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "Detecteer tekenreeks:"
#: tfrmtweakplugin.lblextension.caption
msgid "&Extension:"
msgstr "Extensie:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Vlaggen:"
#: tfrmtweakplugin.lblname.caption
msgctxt "tfrmtweakplugin.lblname.caption"
msgid "&Name:"
msgstr "Naam:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "tfrmtweakplugin.lblplugin.caption"
msgid "&Plugin:"
msgstr "Invoegtoepassing:"
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "Invoegtoepassing:"
#: tfrmviewer.actabout.caption
msgid "About Viewer..."
msgstr "Over Kijker..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Toont het Over-bericht"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "tfrmviewer.actcopyfile.caption"
msgid "Copy File"
msgstr "Kopieer bestand"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Kopieer bestand"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "TFRMVIEWER.ACTCOPYTOCLIPBOARD.CAPTION"
msgid "Copy To Clipboard"
msgstr "Kopieer naar klembord"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr "Kopieer geformatteerd naar klembord"
#: tfrmviewer.actdeletefile.caption
msgctxt "tfrmviewer.actdeletefile.caption"
msgid "Delete File"
msgstr "Verwijder bestand"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Verwijder bestand"
#: tfrmviewer.actexitviewer.caption
msgctxt "TFRMVIEWER.ACTEXITVIEWER.CAPTION"
msgid "E&xit"
msgstr "Af&sluiten"
#: tfrmviewer.actfind.caption
msgctxt "TFRMVIEWER.ACTFIND.CAPTION"
msgid "Find"
msgstr "Zoeken"
#: tfrmviewer.actfindnext.caption
msgctxt "TFRMVIEWER.ACTFINDNEXT.CAPTION"
msgid "Find next"
msgstr "Zoek volgende"
#: tfrmviewer.actfindprev.caption
msgctxt "TFRMVIEWER.ACTFINDPREV.CAPTION"
msgid "Find previous"
msgstr "Zoek vorige"
#: tfrmviewer.actfullscreen.caption
msgctxt "TFRMVIEWER.ACTFULLSCREEN.CAPTION"
msgid "Full Screen"
msgstr "Volledig scherm"
#: tfrmviewer.actimagecenter.caption
msgid "Center"
msgstr "Centreren"
#: tfrmviewer.actloadnextfile.caption
msgid "&Next"
msgstr "Volgende"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Laad volgende bestand"
#: tfrmviewer.actloadprevfile.caption
msgid "&Previous"
msgstr "Vorige"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Laad vorige bestand"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr "Spiegel horizontaal"
#: tfrmviewer.actmirrorhorz.hint
msgid "Mirror"
msgstr "Spiegelen"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr "Spiegel verticaal"
#: tfrmviewer.actmovefile.caption
msgctxt "tfrmviewer.actmovefile.caption"
msgid "Move File"
msgstr "Verplaats bestand"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Verplaats bestand"
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Voorbeeldweergave"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Herladen"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Herlaad huidige bestand"
#: tfrmviewer.actrotate180.caption
msgid "+ 180"
msgstr "+ 180"
#: tfrmviewer.actrotate180.hint
msgid "Rotate 180 degrees"
msgstr "Draai 180 graden"
#: tfrmviewer.actrotate270.caption
msgid "- 90"
msgstr "- 90"
#: tfrmviewer.actrotate270.hint
msgid "Rotate -90 degrees"
msgstr "Draai -90 graden"
#: tfrmviewer.actrotate90.caption
msgid "+ 90"
msgstr "+ 90"
#: tfrmviewer.actrotate90.hint
msgid "Rotate +90 degrees"
msgstr "Draai +90 graden"
#: tfrmviewer.actsave.caption
msgctxt "TFRMVIEWER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Opslaan"
#: tfrmviewer.actsaveas.caption
msgid "Save As..."
msgstr "Opslaan als..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Sla bestand op als..."
#: tfrmviewer.actscreenshot.caption
msgctxt "TFRMVIEWER.ACTSCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Schermafdruk"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "Vertraging 3 sec"
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "vertraging 5 sec"
#: tfrmviewer.actselectall.caption
msgctxt "TFRMVIEWER.ACTSELECTALL.CAPTION"
msgid "Select All"
msgstr "Selecteer alles"
#: tfrmviewer.actshowasbin.caption
msgid "Show as &Bin"
msgstr "Toon als &binair"
#: tfrmviewer.actshowasbook.caption
msgid "Show as B&ook"
msgstr "Toon als boek"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr "Toon als dec"
#: tfrmviewer.actshowashex.caption
msgid "Show as &Hex"
msgstr "Toon als &hex"
#: tfrmviewer.actshowastext.caption
msgid "Show as &Text"
msgstr "Toon als &tekst"
#: tfrmviewer.actshowaswraptext.caption
msgid "Show as &Wrap text"
msgstr "Toon als inpaktekst"
#: tfrmviewer.actshowgraphics.caption
msgid "Graphics"
msgstr "Afbeeldingen"
#: tfrmviewer.actshowplugins.caption
msgctxt "TFRMVIEWER.ACTSHOWPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Invoegtoepassingen"
#: tfrmviewer.actstretchimage.caption
msgid "Stretch"
msgstr "Uitrekken"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Rek afbeelding uit"
#: tfrmviewer.actstretchonlylarge.caption
msgid "Stretch only large"
msgstr "Rek alleen grote uit"
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Zoomen"
#: tfrmviewer.actzoomin.caption
msgid "Zoom In"
msgstr "Inzoomen"
#: tfrmviewer.actzoomout.caption
msgid "Zoom Out"
msgstr "Uitzoomen"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Kopiëren"
#: tfrmviewer.btncuttuimage.hint
msgid "Crop"
msgstr "Bijsnijden"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Verwijderen"
#: tfrmviewer.btnfullscreen.hint
msgctxt "tfrmviewer.btnfullscreen.hint"
msgid "Full Screen"
msgstr "Volledig scherm"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Oplichten"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Verplaatsen"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Verplaatsen"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Schilderen"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Rode ogen"
#: tfrmviewer.btnresize.hint
msgid "Resize"
msgstr "Herschalen"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Ongedaan maken"
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Kijker"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Diavoorstelling"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Pen"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "tfrmviewer.gboxhightlight.caption"
msgid "Highlight"
msgstr "Oplichten"
#: tfrmviewer.gboxpaint.caption
msgctxt "tfrmviewer.gboxpaint.caption"
msgid "Paint"
msgstr "Paint"
#: tfrmviewer.gboxslideshow.caption
msgctxt "tfrmviewer.gboxslideshow.caption"
msgid "Slide Show"
msgstr "Diavoorstelling"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Tonen"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "Over"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Bewerken"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Codering"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "Bestand"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "Afbeelding"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Afdrukken..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Draaien"
#: tfrmviewer.miscreenshot.caption
msgctxt "tfrmviewer.miscreenshot.caption"
msgid "Screenshot"
msgstr "Schermafdruk"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Tonen"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Selecteer alles"
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Als bestand bestaat"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Als bestand bestaat"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION"
msgid "Copy d&ate/time"
msgstr "Kopieer datum/tijd"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Werk op de achtergrond (aparte verbinding)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Als bestand bestaat"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Hoogte"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Breedte"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Annuleer snelfilter"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Annuleer huidige bewerking"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Geef bestandnaam in, met extensie, voor gepleurde tekst"
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Te importeren tekstsoort"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Kapot:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Algemeen:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Onbrekend:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Leesfout:"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Geslaagd:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Geef checksum in en kies algoritme:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Verifieer checksum"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Totaal:"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Plakbord bevat geen geldige werkbalkgegevens."
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr ""
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr "Ouderwets gerangschikt;A-Z gerangschikt"
#: ulng.rscolattr
msgid "Attr"
msgstr "Attr"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Datum"
#: ulng.rscolext
msgid "Ext"
msgstr "Ext"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Naam"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Grootte"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Uitlijnen"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Titel"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Verwijderen"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Veldinhoud"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Verplaatsen"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Breedte"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Aanpassen kolom"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Stel bestandassociatie in"
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "Opdrachtregel en parameters bevestigen"
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Kopieer (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Geïmporteerde DC-werkbalk"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Geïmporteerde DC-werkbalk"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "GepleurdeTekst"
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "GepleurdeHTMLtekst"
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "GepleurdeRichText"
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "GepleurdeSimpleText"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "GepleurdeUnicodeUTF16tekst"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "GepleurdeUnicodeUTF8tekst"
#: ulng.rsdiffadds
msgid " Adds: "
msgstr " Voegt toe: "
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr " Verwijdert: "
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "De twee bestanden zijn hetzelfde."
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr " Overeenkomend: "
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr " wijzigt: "
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Afbreken"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "Alles"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "Vasthaken"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "Auto-hernoem bronbestanden"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Annuleren"
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "Doorgaan"
#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "Kopieer in"
#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "Kopieer in alles"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "Beëindig programma"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr "Negeren"
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Negeer alles"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Nee"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "Geen"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&OK"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "Overige"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "Overschrijven"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Overschrijf &alles"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Overschrijf alle grotere"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Overschrijf alle oudere"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Overschrijf alle kleinere"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Hernoemen"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Hervatten"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Opnieuw"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "Overslaan"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Alles overslaan"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Ja"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Kopieer bestand(en)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Verplaats bestand(en)"
#: ulng.rsdlgoppause
msgid "Pau&se"
msgstr "Pauzeren"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&Starten"
#: ulng.rsdlgqueue
msgid "Queue"
msgstr "Wachtrij"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Snelheid %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Snelheid %s/s, tijd te gaan %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<geen etiket>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<geen media>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Interne bewerker van Double Commander."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Ga naar regel:"
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr "Ga naar regel"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "nieuwe.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Bestandnaam:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Open bestand"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "Achterwaarts"
#: ulng.rseditsearchcaption
msgid "Search"
msgstr "Zoeken"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "Voorwaarts"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Vervangen"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "met externe bewerker"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "met interne bewerker"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Uitvoeren via schil"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Uitvoeren via terminal en sluiten"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Uitvoeren via terminal en blijf open"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Links;Rechts;Actief;Inactief;Beide;Geen"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Nee;Ja"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Geëxporteerd vanuit DC"
#: ulng.rsfileopdirectoryexistsoptions
#, fuzzy
#| msgid "Ask;Overwrite;Copy into;Skip"
msgid "Ask;Merge;Skip"
msgstr "Vraag;Overschrijf;Kopieer naar;Overslaan"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Vraag;Overschrijf;Overschrijf oudere;Overslaan"
#: ulng.rsfileopsetpropertyerroroptions
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Vraag;Niet meer instellen;Negeer fouten"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "FILTER"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Bepaal sjabloon"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s niveau(s)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "alles (onbeperkte diepte)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "alleen huidige map"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Map %s bestaat niet."
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Gevonden: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Opslaan zoeksjabloon"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Sjabloonnaam:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Doorzocht: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Doorzoeken"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Zoek bestanden"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Tijd van doorzoeking: "
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Begin op"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Vrij %s van %s bytes"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s bytes vrij"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Toegang datum/tijd"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Attributen"
#: ulng.rsfunccomment
msgid "Comment"
msgstr "Commentaar"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Gecomprimeerde grootte"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Aanmaak datum/tijd"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Extensie"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Groep"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Verander datum/tijd"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Koppel naar"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Wijziging datum/tijd"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Naam"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Naam zonder extensie"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Eigenaar"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Pad"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Grootte"
#: ulng.rsfunctype
msgid "Type"
msgstr "Soort"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Fout bij maken harde koppeling."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "geen;Naam, a-z;Naam, z-a;Ext, a-z;Ext, z-a;Grootte 9-0;Grootte 0-9;Datum 9-0;Datum 0-9"
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"Waarschuwing: bij het herstellen van een .hotlist reservekopiebestand, zal de bestaande lijst worden vervangen door de geïmporteerde.\n"
"\n"
"Weet u zeker dat u wil doorgaan?\n"
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Kopieer/Verplaats-dialoog"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Verschil"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Bewerk commentaardialoog"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Bewerker"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Zoek bestanden"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Hoofd"
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Kijker"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "Kan verwijzing naar standaardbalkbestand niet vinden"
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Deselectie masker"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Selectie masker"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Invoer masker:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Er bestaat reeds een kolomweergave met die naam."
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr ""
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Configureer aangepaste kolommen"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Geef nieuwe aangepaste kolommennaam"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Acties"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Verbreek verbinding met netwerkschijf..."
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Bewerken"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Uitwerpen"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Pak hier uit..."
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Breng netwerkschijf in kaart..."
#: ulng.rsmnumount
msgid "Mount"
msgstr "Aankoppelen"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Nieuw"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Geen media beschikbaar"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Openen"
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Open met"
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Overig..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Pak hier in..."
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Rangschik op"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Ontkoppelen"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Overzicht"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Account:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Extra parameters voor inpakker-opdrachtregel:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"Slechte CRC32 voor resulterend bestand:\n"
"\"%s\"\n"
"\n"
"Wilt u het corrupte resulterende bestand toch behouden?\n"
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "U kunt bestand '%s' niet kopiëren of verplaatsen naar zichzelf."
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Kan directory %s niet verwijderen"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Wijzigen dir naar [%s] mislukt."
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Alle niet-actieve tabbladen verwijderen?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Dit tabblad (%s) is vergrendeld. Toch sluiten?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Weet u zeker dat u wilt afsluiten?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "Het bestand %s is veranderd. Wilt u het achterwaarts kopiëren?"
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "Kon niet achterwaarts kopiëren - wilt u het gewijzigde bestand behouden?"
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Kopieer %d geselecteerde bestanden/mappen?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Kopieer geselecteerde '%s'?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Maak een nieuwe bestandsoort'%s bestanden' >"
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Geef locatie en bestandnaam in waar een DC-werkbalkbestand op te slaan"
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Aangepaste actie"
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Verwijder het gedeeltelijk gekopieerde bestand?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Verwijder %d geselecteerde bestanden/mappen?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Verwijder %d geselecteerde bestanden/mappen naar prullenbak?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Verwijder geselecteerde '%s'?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Verwijder geselecteerde '%s' naar prullenbak?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Kan '%s' niet verwijderen naar prullenbak. Onherstelbaar verwijderen?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Schijf is niet beschikbaar"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr "Geef naam van aangepaste actie:"
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Geef bestandextensie:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Geef naam:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Geef naam van nieuwe bestandsoort om te maken voor extensie '%s'"
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "CRC-fout in archiefbestandgegevens"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Gegevens zijn niet goed"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Kan niet verbinden met server: '%s'"
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Kan bestand %s niet kopiëren naar %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Er is al een map genaamd '%s'."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Datum %s wordt niet ondersteund"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Map %s bestaat al."
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Functie afgebroken door gebruiker"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Fout bij sluiten bestand"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Kan bestand niet aanmaken"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Geen bestanden meer in archiefbestand"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Kan bestaand bestand niet openen"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Fout bij lezen van bestand"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Fout bij schrijven naar bestand"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Kan map %s niet aanmaken."
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Ongeldige koppeling"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Geen bestanden gevonden"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Niet genoeg geheugen"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Functie niet ondersteund."
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Fout in contextmenu opdracht"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Fout bij laden instellingen"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Zinsbouwfout in reguliere uitdrukking."
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Kan bestand %s niet hernoemen in %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Kan associatie niet opslaan."
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Kan bestand niet opslaan"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Kan attributen voor '%s' niet instellen"
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Kan datum/tijd voor '%s' niet instellen"
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Kan eigenaar/groep voor '%s' niet instellen"
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "Kan rechten voor '%s'niet instellen"
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Buffer te klein"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Te veel bestanden om in te pakken"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Archiefbestandsoort onbekend"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "Weet u zeker dat u alle elementen wilt verwijderen uit uw favoriete tabbladen? Dit kan niet ongedaan worden gemaakt."
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Sleep andere elementen hierheen"
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr "Geef een naam voor dit element in favoriete tabbladen"
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "Een nieuw element voor favoriete tabbladen opslaan"
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Aantal met succes geëxporteerde favoriete tabbladen: %d op %d"
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Aantal met succes geïmporteerde bestanden: %d op %d"
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Geïmporteerde ouderwetse tabbladen"
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr "Kies .tab-bestand(en) om te importeren (kunnen er meer dan één zijn)"
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr "De laatste wijzigingen van de favoriete tabbladen zijn nog niet opgeslagen. Wilt u die opslaan alvorens door te gaan?"
#: ulng.rsmsgfavoritetabssimplemode
#, fuzzy
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Behoud mapopslaggeschiedenis bij favoriete tabbladen:"
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Submenunaam"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "Dit zal de favoriete tabbladen laden: '%s'"
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Bestand %s gewijzigd, opslaan?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s bytes, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Overschrijven:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Bestand %s bestaat reeds, overschrijven?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Met bestand:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Bestand '%s' niet gevonden."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Bestandbewerkingen actief"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Sommige bestandbewerkingen zijn nog niet voltooid. Afsluiten van Double Commander kan gegevensverlies veroorzaken."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Bestand %s is gemarkeerd als alleen-lezen/verborgen/systeem. Verwijderen?"
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "De bestandgrootte van '%s' is te groot voor doelbestandssysteem."
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "Map %s bestaat al, overschrijven?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Volg symbolische koppeling '%s'?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Selecteer de te importeren tekstsoort"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Voeg %d geselecteerde mappen toe"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Voeg geselecteerde map toe: "
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Voeg huidige map toe: "
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Doe opdracht"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_iets"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Instellingen van lijst van favoriete mappen"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Weet u zeker dat u alle elementen in uw lijst van favoriete mappen wil verwijderen? Dit is onherroepelijk."
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Dit zal de volgende opdracht uitvoeren:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "Dit is favoriete map genaamd "
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Dit zal het actieve venster wijzigen naar het volgende pad:"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "En inactieve venster wilde wijzigen naar het volgende pad:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Fout bij reservekopie maken van elementen..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Fout bij exporteren elementen..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Exporteer alles."
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Exporteer lijst van favoriete mappen - Selecteer de te exporteren elementen"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Exporteer geselecteerde"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Importeer alles."
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Importeer lijst van favoriete mappen - Selecteer de te importeren elementen"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Importeer geselecteerde"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Pad"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Localiseer te importeren '.hotlist'-bestand"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Naam van favoriete map"
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Aantal nieuwe elementen: %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "Niets gekozen om te exporteren."
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Pad van favoriete map"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Opnieuw toevoegen geselecteerde map: "
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Opnieuw toevoegen huidige map: "
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Geef locatie en bestand van lijst met favoriete mappen om te herstellen"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Opdracht"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(einde submenu)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Menunaam:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Naam:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(scheidingsteken)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Submenunaam"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Doel van favoriete map"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Bepaal of u wilt dat het actieve venster gesorteerd wordt op een opgegeven manier na wijziging map"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Bepaal of u wilt dat het niet-actieve venster gesorteerd wordt op een opgegeven manier na wijziging map"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Enkele functies om geschikte pad te selecteren, relatief, absoluut, vensters speciale mappen, etc."
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Aantal alle opgeslagen elementen: %d\n"
"\n"
"Naam reservekopie: %s\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Totaal elementen geëxporteerd: "
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Geef locatie en bestandnaam in waar een lijstbestand met favoriete mappen op te slaan"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Onjuist resultaat bestandlengte voor bestand: '%s'"
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Voer a.u.b. volgende schijf (of vergelijkbaar) in.\n"
"Opdat dit bestand kan worden geschreven:\n"
"'%s'\n"
"\n"
"Aantal nog te schrijven bytes: %d\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Fout in opdrachtregel"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Ongeldige bestandnaam"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Ongeldige bestandsoort van configuratiebestand"
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Ongeldig pad"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Pad %s bevat verboden tekens."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Dit is geen geldige invoegtoepassing."
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Deze invoegtoepassing is gemaakt voor Double Commander voor %s.Het werkt niet met Double Commander voor %s."
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Ongeldig gebruik van aanhalingstekens"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Ongeldige selectie"
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Laden bestandenlijst..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr "Lokaliseer TC-configuratiebestand (wincmd.ini)"
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "Lokaliseer TC-uitvoerbaar bestand (totalcmd.exe of totalcmd64.exe)"
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Kopieer bestand %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Verwijder bestand %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Fout: "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr "Start extern"
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr "Resultaat extern"
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Uitpakken bestand %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Info: "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Maak koppeling %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Maak map %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Verplaats bestand %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Inpakken naar bestand %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Verwijder map %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Klaar: "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Maak symbolische koppeling %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Beproef bestandsintegriteit %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Wis bestand %s"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Wis map %s"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Hoofdwachtwoord"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Geef a.u.b. het hoofdwachtwoord in:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Nieuw bestand"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "De volgende schijf zal worden uitgepakt"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Geen bestanden"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Geen bestanden geselecteerd"
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Niet genoeg vrije ruimte op doelschijf, doorgaan?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Niet genoeg vrije ruimte op doelschijf, opnieuw proberen?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Kan bestand %s niet verwijderen"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Niet verwezenlijkt."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Onderstaand is een voorbeeldweergave. U kunt de aanwijzer bewegen en bestanden kiezen om direct een idee te krijgen van hoe het werkt en eruit ziet."
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Wachtwoord:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Wachtwoorden zijn verschillend."
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Geef a.u.b. het wachtwoord in:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Wachtwoord (firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Geef a.u.b. het wachtwoord opnieuw in voor verificatie:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Verwijder %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Voorinstelling '%s' bestaat reeds. Overschrijven?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Probleem bij uitvoeren van opdracht (%s)"
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Bestandnaam voor gepleurde tekst:"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Maak dit bestand a.u.b. beschikbaar. Opnieuw proberen?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Geef nieuwe vriendelijke naam voor deze favoriete tabbladen"
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Geef nieuwe naam voor dit menu"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Verplaats/hernoem %d geselecteerde bestanden/mappen?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Verplaats/hernoem geselecteerde '%s'?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Herstart a.u.b. Double Commander om wijzigingen door te voeren"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Kies de bestandsoort om de extensie '%s' aan toe te voegen"
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Geselecteerd: %s van %s, bestanden: %d van %d, mappen: %d van %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Kies uitvoerbaar bestand voor"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Kies a.u.b. alleen checksumbestanden."
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Kies a.u.b. locatie van volgende schijf"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Stel schijfetiket in"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Speciale mappen"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Voeg pad van actieve omlijsting toe"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Voeg pad van actieve omlijsting toe"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Verken en gebruik geselecteerde pad"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Gebruik omgevingsvariabele..."
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Ga naar speciaal pad van Double Commander..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Ga naar omgevingsvariabele..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Ga naar andere speciale map van Windows..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Ga naar speciale map van Windows (TC)..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Maak relatief t.o.v. pad van favoriete mappen"
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Maak pad absoluut"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Maak relatief naar speciaal pad van Double Commander..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Maak relatief naar omgevingsvariabele..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Maak relatief naar speciale map van Windows (TC)..."
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Maak relatief naar andere speciale map van Windows..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Gebruik speciaal pad van Double Commander..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr "Gebruik pad van favoriete mappen"
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Gebruik andere speciale map van Windows..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Gebruik speciale map van Windows (TC)..."
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr "Dit tabblad is vergrendeld. Map openen in ander tabblad?"
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Hernoem tabblad"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Nieuwe tabbladnaam:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Doelpad:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Fout! Kan het TC-configuratiebestand niet vinden:\n"
"%s\n"
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Fout! Kan het uitvoerbare TC-configuratiebestand niet vinden:\n"
"%s\n"
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Fout! TC draait nog maar moet gesloten worden voor deze bewerking.\n"
"Sluit TC en druk op OK of op Annuleren om af te breken.\n"
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Fout! Kan de gewenste TC-werkbalkdoelmap %s niet vinden.\n"
"\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Geef locatie en bestandnaam in waar een TC-werkbalkbestand op te slaan"
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr "'%s' staat nu op het klembord"
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr "Extensie of gekozen bestand is geen herkende bestandsoort"
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Localiseer '.toolbar'-bestand om te importeren"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Localiseer '.BAR'-bestand om te importeren"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Geef locatie en bestandnaam in van te herstellen werkbalk"
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Opgeslagen.\n"
"Werkbalkbestandnaam: %s\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Teveel bestanden geselecteerd"
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Onbepaald"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr "Fout: onverwacht gebruik van boomstructuurmenu."
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "<GEEN EXT>"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr "<GEEN NAAM>"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Gebruikersnaam:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Gebruikersnaam (Firewall):"
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Schijfetiket:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Geef a.u.b. schijfgrootte op:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Wis %d geselecteerde bestanden/mappen?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Wis geselecteerde '%s'?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "met"
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Geen wijziging;HOOFDLETTERS;kleine letters;Eerste letter hoofdletter;Ieder Woord Begint Met Hoofdletter;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Afgebroken"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Berekenen checksum"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Bezig met berekenen checksum in '%s'"
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "Bezig met berekenen checksum van '%s'"
#: ulng.rsopercalculatingstatictics
msgid "Calculating"
msgstr "Berekenen"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Bezig met berekenen '%s'"
#: ulng.rsopercombining
msgid "Joining"
msgstr "Samenvoegen"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Bezig met samenvoegen bestanden in '%s' naar '%s'"
#: ulng.rsopercopying
msgid "Copying"
msgstr "Kopiëren"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Bezig met kopiëren van '%s' naar '%s'"
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Bezig met kopiëren '%s' naar '%s'"
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Bezig met maken van map"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Bezig met maken van map '%s'"
#: ulng.rsoperdeleting
msgid "Deleting"
msgstr "Verwijderen"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Bezig met verwijderen in '%s'"
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Bezig met verwijderen van '%s'"
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Uitvoeren"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Bezig met uitvoeren '%s'"
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Uitpakken"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Bezig met uitpakken van '%s' naar '%s'"
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Klaar"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Lijst maken"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Bezig met lijst maken van '%s'"
#: ulng.rsopermoving
msgid "Moving"
msgstr "Verplaatsen"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Bezig met verplaatsen van '%s' naar '%s'"
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Bezig met verplaatsen van '%s' naar '%s'"
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Niet gestart"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Inpakken"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Bezig met inpakken van '%s' naar '%s'"
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Bezig met inpakken van '%s' naar '%s'"
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Gepauzeerd"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Pauzeren"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Bezig"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Instelling eigenschappen"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Instellen eigenschappen in '%s'"
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Instellen eigenschappen van '%s'"
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Splitsen"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "'%s' splitsen in '%s'"
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Starten"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Gestopt"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Stoppen"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Beproeven"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Bezig met uitproberen in '%s'"
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Bezig met uitproberen van '%s'"
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Verifiëren van checksum"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Bezig met verifiëren checksum in '%s'"
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "Bezig met verifiëren checksum van '%s'"
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Wachtend op toegang tot bestandsbron"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Wachtend op reactie van gebruiker"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Wissen"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Bezig met wissen in '%s'"
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Bezig met wissen van '%s'"
#: ulng.rsoperworking
msgid "Working"
msgstr "Bezig"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Voeg toe aan begin;Voeg toe aan einde;Slim toevoegen"
#: ulng.rsoptarchivedelete
msgid "Delete:"
msgstr "Verwijderen:"
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Uitpakken zonder pad:"
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr "Soortbepalingsmodus:"
#: ulng.rsoptarchiveid
msgid "ID:"
msgstr "ID:"
#: ulng.rsoptarchiveidpos
msgid "ID Position:"
msgstr "ID-positie:"
#: ulng.rsoptarchiveidseekrange
msgid "ID Seek Range:"
msgstr "ID-zoekbereik:"
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr "Parameter"
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr "Wachtwoordvraag tekenreeks:"
#: ulng.rsoptarchiveselfextract
msgid "Create self extracting archive:"
msgstr "Maak zelfuitpakkend archiefbestand:"
#: ulng.rsoptarchivetest
msgid "Test:"
msgstr "Proef:"
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Archiefbestandtype naam:"
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Waarde"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Associeer invoegtoepassing '%s' met:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Eerst;Laatst;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Klassiek;Ouderwetse volgorde;Alfabetische volgorde (maar taal toch eerst)"
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Actieve omlijstingspaneel op links, inactieve op rechts (ouderwets);Linker omlijstingspaneel op links, rechter op rechts"
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Uitschakelen"
#: ulng.rsoptenable
msgid "Enable"
msgstr "Inschakelen"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Geef extensie"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "Voeg toe bij begin;Voeg toe aan einde;Alfabetisch rangschikken"
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "apart venster;geminimaliseerd apart venster;bewerkingenpaneel"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "drijvend;B;K;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Sneltoets voor cm_Delete zal geregistreerd worden, zodat het gebruikt kan worden om deze instelling om te keren."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Voeg toe sneltoets voor %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Voeg sneltoets toe"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Kan sneltoets niet instellen"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Wijzig sneltoets"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Opdracht"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Sneltoets %s voor cm_Delete heeft een parameter die deze instelling passeert. Wilt u deze parameter wijzigen en de globale instelling gebruiken?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Sneltoets %s voor cm_Delete heeft een gewijzigde parameter nodig om met sneltoets %s overeen te komen. Wilt u dit wijzigen?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Beschrijving"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Bewerk sneltoets voor %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Repareer parameter"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Sneltoets"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Sneltoetsen"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<geen>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parameters"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Instellen sneltoets om bestand te verwijderen"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Om met deze instelling te werken, moet deze toegewezen worden aan cm_Delete, maar die is reeds toegewezen aan %s. Wilt u dit wijzigen? "
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Sneltoets %s voor cm_Delete is een volgordesneltoets waarvoor een sneltoets met omkeer Shift niet toegewezen kan worden. Deze instelling zal misschien niet werken."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Sneltoets is in gebruik"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "Sneltoets %s wordt reeds gebruikt"
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Dit wijzigen naar %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "gebruikt voor %s in %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "gebruikt voor deze opdrachtregel maar met verschillende parameters"
#: ulng.rsoptionseditorarchivers
msgid "Archivers"
msgstr "Inpakkers"
#: ulng.rsoptionseditorautorefresh
msgid "Auto refresh"
msgstr "Auto-ververs"
#: ulng.rsoptionseditorbehavior
msgid "Behaviors"
msgstr "Gedrag"
#: ulng.rsoptionseditorbriefview
msgid "Brief"
msgstr "Kort"
#: ulng.rsoptionseditorcolors
msgid "Colors"
msgstr "Kleuren"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Kolommen"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Instellingen"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Aangepaste kolommen"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Lijst met favoriete mappen"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Sleur en pleur"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Schijflijstknop"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Favoriete tabbladen"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Bestandassociaties extra"
#: ulng.rsoptionseditorfileassoc
msgid "File associations"
msgstr "Bestandassociaties"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Nieuw"
#: ulng.rsoptionseditorfileoperations
msgid "File operations"
msgstr "Bestandbewerkingen"
#: ulng.rsoptionseditorfilepanels
msgid "File panels"
msgstr "Bestandpanelen"
#: ulng.rsoptionseditorfilesearch
#, fuzzy
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Bestandzoekopdracht"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Bestandvoorbeeldweergaven"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Bestandsoorten"
#: ulng.rsoptionseditorfoldertabs
msgid "Folder tabs"
msgstr "Maptabbladen"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Maptabbladen extra"
#: ulng.rsoptionseditorfonts
msgid "Fonts"
msgstr "Lettertypes"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Markeerders"
#: ulng.rsoptionseditorhotkeys
msgid "Hot keys"
msgstr "Sneltoetsen"
#: ulng.rsoptionseditoricons
msgid "Icons"
msgstr "Pictogrammen"
#: ulng.rsoptionseditorignorelist
msgid "Ignore list"
msgstr "Negeerlijst"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Sleutels"
#: ulng.rsoptionseditorlanguage
msgid "Language"
msgstr "Taal"
#: ulng.rsoptionseditorlayout
msgid "Layout"
msgstr "Vormgeving"
#: ulng.rsoptionseditorlog
msgid "Log"
msgstr "Logboek"
#: ulng.rsoptionseditormiscellaneous
msgid "Miscellaneous"
msgstr "Allerlei"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Muis"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
"Er zijn opties veranderd in '%s'.\n"
"\n"
"Wilt u de wijzigingen opslaan?\n"
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Invoegtoepassingen"
#: ulng.rsoptionseditorquicksearch
msgid "Quick search/filter"
msgstr "Snelzoeken/filter"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminalvenster"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Werkbalk"
#: ulng.rsoptionseditortools
msgid "Tools"
msgstr "Gereedschappen"
#: ulng.rsoptionseditortooltips
msgid "Tooltips"
msgstr "Gereedschaptips"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Boomstructuurmenu"
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr "Kleuren van boomstructuurmenu"
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Geen;Opdrachtregel;Snelzoeken;Snelfilter"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Linkerknop;Rechterknop;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "bovenaan bestandslijst;na onderverdeling (indien mappen zijn gesorteerd voor bestanden;op gesorteerde positie;onderaan bestandslijst"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Invoegtoepassing %s is reeds toegewezen aan de volgende extensies:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Actief"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Bestandnaam"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Naam"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Geregistreerd voor"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Gevoelig;&Ongevoelig"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Bestanden;Mappen;Bestanden en mappen"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr ""
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "niet hoofdlettergevoelig;overeenkomstig lokale instellingen (aAbBcC);eerst hoofdletters dan kleine letters (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "sorteer op naam en toon eerste;rangschik als bestanden en toon eerste;rangschik als bestanden"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Alfabetisch, met inachtneming van accenten;Natuurlijke rangschikking: alfabetisch en cijfers"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Boven;Onder;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "Scheidingsteken;Interne opdracht;Externe opdracht;Menu"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "DC ouderwets - Kopieer (x) bestandnaam.ext;Windows - bestandnaam (x).ext;Ander - bestandnaam (x).ext"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "wijzig plaats niet;gebruik dezelfde instelling als voor nieuwe bestanden;op gerangschikte plaats"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Bestanden: %d, mappen: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Kan toegangsrechten voor '%s' niet wijzigen"
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Kan eigenaar van '%s' niet wijzigen"
#: ulng.rspropsfile
msgid "File"
msgstr "Bestand"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Map"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr ""
#: ulng.rspropssocket
msgid "Socket"
msgstr ""
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Speciaal blokapparaat"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Speciaal tekenapparaat"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Symbolische koppeling"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Onbekend type"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Zoekresultaat"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "ZOEKEN"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<naamloze sjabloon>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Kies een map"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "&Toon hulp voor %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Alles"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Categorie"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Kolom"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Opdracht"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Bestandnaam"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "bestanden"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Param"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Result"
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "WerkMap"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bytes"
#: ulng.rssizeunitgbytes
msgid "Gigabytes"
msgstr "Gigabytes"
#: ulng.rssizeunitkbytes
msgid "Kilobytes"
msgstr "Kilobytes"
#: ulng.rssizeunitmbytes
msgid "Megabytes"
msgstr "Megabytes"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabytes"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Bestanden: %d, Mappen: %d, Grootte: %s (%s, bytes)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Kan doelmap niet maken."
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Onjuist bestandsgrootte formaat."
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Kan bestand niet opsplitsen."
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Het aantal delen is meer dan 100. Doorgaan?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Kies map:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr "Alleen voorbeeldweergave"
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr "Overige"
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr "OU"
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr "Kanttekening"
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr "Plat"
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr "Beperkt"
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr "Eenvoudig"
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr "Geweldig"
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr "Wonderbaarlijk"
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr "Supergeweldig"
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr "Kies uw map vanuit de mapgeschiedenis"
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr "Kies uw favoriete tabbladen:"
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr "Kies uw opdracht vanuit de opdrachtregelgeschiedenis"
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr "Kies uw actie vanuit het hoofdmenu"
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr "Kies uw actie vanuit de hoofdwerkbalk"
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr "Kies uw map vanuit de mapfavorieten:"
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr "Kies uw map vanuit de bestandbezichtigingsgeschiedenis"
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr "Kies uw bestand of map"
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Fout bij maken symbolische koppeling."
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr "Standaardtekst"
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr "Platte tekst"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "Doe niets;Sluit tabblad;Benader favoriete tabbladen;Opduikmenu voor tabbladen"
#: ulng.rstimeunitday
msgid "Day(s)"
msgstr "Dag(en)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "U(u)r(en)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minu(u)t(en)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Maand(en)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Seconde(n)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "We(e)k(en)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Ja(a)r(en)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Hernoem favoriete tabbladen"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Hernoem het submenu van de favoriete tabbladen"
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Verschil"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Bewerker"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Fout bij openen verschil"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Fout bij openen bewerker"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Fout bij openen terminalvenster"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Fout bij openen kijker"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminalvenster"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Kijker"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Rapporteer deze fout a.u.b. aan de bugtracker met een omschrijving van wat u aan het doen was en het volgende bestand: %s Druk op %s om door te gaan of op %s om het programma af te breken."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "Beide panelen, van actief naar inactief"
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "Beide panelen, van links naar rechts"
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Pad van paneel"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "Zet elke naam tussen haakjes, of wat u wilt"
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Alleen bestandnaam, geen extensie"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "Volledige bestandnaam (pad+bestandnaam)"
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr "Hulp met '%s' variabelen"
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr "Zal gebruiker vragen om een parameter in te voeren met een voorgestelde standaardwaarde"
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Linkerpaneel"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "Tijdelijke bestandnaam van lijst met bestandnamen"
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "Tijdelijke bestandnaam van lijst van volledige bestandnamen (pad+bestandnaam)"
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "Tijdelijke bestandnaam van lijst van bestandnamen met relatief pad"
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Aleen bestandextensie"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Alleen bestandnaam"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Ander voorbeeld want wat er mogelijk is"
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr ""
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr ""
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "Geef elke naam het voorvoegsel '-a' (of wat u wilt)"
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "%[Vraag gebruiker om param;Standaardwaarde voorgesteld]"
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "Bestandnaam met relatief pad"
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Rechterpaneel"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "Volledige pad van tweede gekozen bestand in rechterpaneel"
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "Toon opdracht voor uitvoering"
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "%[Simpele boodschap]"
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "Zal een eenvoudige boodschap tonen"
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Actief paneel (bron)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Inactief paneel (doel)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr "Vanaf hier zullen bestandnamen tussen aanhalingstekens worden gezet (standaard)"
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "Opdracht zal worden uitgevoerd in de terminal, die daarna open zal blijven"
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr ""
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "Vanaf hier zullen bestandnamen niet tussen aanhalingstekens worden gezet"
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "Opdracht zal worden uitgevoerd in de terminal, die daarna gesloten zal worden"
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr ""
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Netwerk"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Interne kijker van Double Commander"
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Slechte kwaliteit"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Codering"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Afbeeldingsoort"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Nieuwe grootte"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s niet gevonden."
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "met externe kijker"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "met interne kijker"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Nummer van vervanging: %d"
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "Er vond geen vervanging plaats."