mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-21 09:58:13 +00:00
12310 lines
342 KiB
Text
12310 lines
342 KiB
Text
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: Double Commander 0.8.0 alpha Rev. 6885\n"
|
|
"Report-Msgid-Bugs-To: \n"
|
|
"POT-Creation-Date: 2009-12-20 12:40+0300\n"
|
|
"PO-Revision-Date: 2016-08-12 12:00+0200\n"
|
|
"Last-Translator: Claudio <linuxbastler@users.sourceforge.net>\n"
|
|
"Language-Team: Deutsch <linuxbastler@users.sourceforge.net>\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=utf-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"X-Native-Language: Deutsch\n"
|
|
"Language: de\n"
|
|
"X-Generator: Poedit 1.8.7.1\n"
|
|
|
|
#: fsyncdirsdlg.rscomparingpercent
|
|
msgid "Comparing... %d%% (ESC to cancel)"
|
|
msgstr "Vergleiche... %d%% (ESC zum Abbrechen)"
|
|
|
|
#: fsyncdirsdlg.rsdeleteright
|
|
msgid "Right: Delete %d file(s)"
|
|
msgstr "Lösche Datei(en) %d"
|
|
|
|
#: fsyncdirsdlg.rsfilesfound
|
|
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
|
msgstr "Dateien gefunden: %d (Identisch: %d, Unterschiedlich: %d, nur links: %d, nur rechts: %d)"
|
|
|
|
#: fsyncdirsdlg.rslefttorightcopy
|
|
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
|
msgstr "Links nach rechts: Kopiere %d Dateien, Gesamtgröße: %d Bytes"
|
|
|
|
#: fsyncdirsdlg.rsrighttoleftcopy
|
|
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
|
msgstr "Rechts nach links: Kopiere %d Dateien, Gesamtgröße: %d Bytes"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
|
msgid "Choose template..."
|
|
msgstr "Vorlage wählen..."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
|
msgid "C&heck free space"
|
|
msgstr "Prüfe freien Speic&her"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
|
msgid "Cop&y attributes"
|
|
msgstr "Attribute ko&pieren"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
|
msgid "Copy o&wnership"
|
|
msgstr "Besitzer k&opieren"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
|
msgid "Copy &permissions"
|
|
msgstr "Berechtigungen ko&pieren"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
|
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
|
msgid "Copy d&ate/time"
|
|
msgstr "D&atum/Zeit kopieren"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
|
msgid "Correct lin&ks"
|
|
msgstr "&Korrigiere Verknüpfungen"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
|
msgid "Drop readonly fla&g"
|
|
msgstr "Sch&reibschutz-Attribut entfernen"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
|
msgid "E&xclude empty directories"
|
|
msgstr "Leere &Verzeichnisse ignorieren"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
|
msgid "Fo&llow links"
|
|
msgstr "Fo&lge Verknüpfungen"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
|
msgid "&Reserve space"
|
|
msgstr "Speicherplatz &reservieren"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
|
msgid "&Verify"
|
|
msgstr ""
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
|
msgid "What to do when cannot set file time, attributes, etc."
|
|
msgstr "Was soll getan werden, wenn Dateieigenschaften nicht übernommen werden können"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
|
msgid "Use file template"
|
|
msgstr "Vorlage aus Datei übernehmen"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
|
msgid "When dir&ectory exists"
|
|
msgstr "W&enn das Verzeichnis vorhanden ist"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
|
msgid "When &file exists"
|
|
msgstr "&Wenn die Datei vorhanden ist"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
|
msgid "When ca&nnot set property"
|
|
msgstr "We&nn Eigenschaften nicht übernommen werden können"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
|
msgid "<no template>"
|
|
msgstr "<Keine Vorlage>"
|
|
|
|
#: tfrmabout.btnclose.caption
|
|
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmabout.btncopytoclipboard.caption
|
|
msgid "Copy to clipboard"
|
|
msgstr "In die Zwischenablage kopieren"
|
|
|
|
#: tfrmabout.caption
|
|
msgctxt "TFRMABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "Über"
|
|
|
|
#: tfrmabout.lblbuild.caption
|
|
msgctxt "tfrmabout.lblbuild.caption"
|
|
msgid "Build"
|
|
msgstr "Build"
|
|
|
|
#: tfrmabout.lblfreepascalver.caption
|
|
msgctxt "tfrmabout.lblfreepascalver.caption"
|
|
msgid "Free Pascal"
|
|
msgstr "Free Pascal"
|
|
|
|
#: tfrmabout.lblhomepage.caption
|
|
msgid "Home Page:"
|
|
msgstr "Homepage"
|
|
|
|
#: tfrmabout.lblhomepageaddress.caption
|
|
msgid "http://doublecmd.sourceforge.net"
|
|
msgstr "http://doublecmd.sourceforge.net"
|
|
|
|
#: tfrmabout.lbllazarusver.caption
|
|
msgctxt "tfrmabout.lbllazarusver.caption"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: tfrmabout.lblrevision.caption
|
|
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
|
|
msgid "Revision"
|
|
msgstr "Revision"
|
|
|
|
#: tfrmabout.lbltitle.caption
|
|
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmabout.lblversion.caption
|
|
msgctxt "tfrmabout.lblversion.caption"
|
|
msgid "Version"
|
|
msgstr "Version"
|
|
|
|
#: tfrmattributesedit.btncancel.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "Abbru&ch"
|
|
|
|
#: tfrmattributesedit.btnok.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmattributesedit.btnreset.caption
|
|
msgid "&Reset"
|
|
msgstr "&Zurücksetzen"
|
|
|
|
#: tfrmattributesedit.caption
|
|
msgid "Choose attributes"
|
|
msgstr "Attribute wählen"
|
|
|
|
#: tfrmattributesedit.cbarchive.caption
|
|
msgid "&Archive"
|
|
msgstr "&Archiv"
|
|
|
|
#: tfrmattributesedit.cbcompressed.caption
|
|
msgid "Co&mpressed"
|
|
msgstr "Ko&mprimiert"
|
|
|
|
#: tfrmattributesedit.cbdirectory.caption
|
|
msgid "&Directory"
|
|
msgstr "Ver&zeichnis"
|
|
|
|
#: tfrmattributesedit.cbencrypted.caption
|
|
msgid "&Encrypted"
|
|
msgstr "V&erschlüsselt"
|
|
|
|
#: tfrmattributesedit.cbhidden.caption
|
|
msgid "&Hidden"
|
|
msgstr "&Versteckt"
|
|
|
|
#: tfrmattributesedit.cbreadonly.caption
|
|
msgid "Read o&nly"
|
|
msgstr "&Schreibgeschützt"
|
|
|
|
#: tfrmattributesedit.cbsgid.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmattributesedit.cbsparse.caption
|
|
msgid "S&parse"
|
|
msgstr "&Kaum"
|
|
|
|
#: tfrmattributesedit.cbsticky.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Dauerhaft"
|
|
|
|
#: tfrmattributesedit.cbsuid.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmattributesedit.cbsymlink.caption
|
|
msgid "&Symlink"
|
|
msgstr "&Symbolischer Link"
|
|
|
|
#: tfrmattributesedit.cbsystem.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
|
|
msgid "S&ystem"
|
|
msgstr "S&ystem"
|
|
|
|
#: tfrmattributesedit.cbtemporary.caption
|
|
msgid "&Temporary"
|
|
msgstr "&Temporär"
|
|
|
|
#: tfrmattributesedit.gbntfsattributes.caption
|
|
msgid "NTFS attributes"
|
|
msgstr "NTFS-Attribute"
|
|
|
|
#: tfrmattributesedit.gbwingeneral.caption
|
|
msgid "General attributes"
|
|
msgstr "Allgemeine Attribute"
|
|
|
|
#: tfrmattributesedit.lblattrbitsstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bits:"
|
|
|
|
#: tfrmattributesedit.lblattrgroupstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Gruppe"
|
|
|
|
#: tfrmattributesedit.lblattrotherstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Andere"
|
|
|
|
#: tfrmattributesedit.lblattrownerstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Besitzer"
|
|
|
|
#: tfrmattributesedit.lblexec.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Ausführen"
|
|
|
|
#: tfrmattributesedit.lblread.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Lesen"
|
|
|
|
#: tfrmattributesedit.lbltextattrs.caption
|
|
msgid "As te&xt:"
|
|
msgstr "Als Te&xt:"
|
|
|
|
#: tfrmattributesedit.lblwrite.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Schreiben"
|
|
|
|
#: tfrmchecksumcalc.caption
|
|
msgctxt "tfrmchecksumcalc.caption"
|
|
msgid "Calculate checksum..."
|
|
msgstr "Berechne Prüfsumme..."
|
|
|
|
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
|
msgid "Open checksum file after job is completed"
|
|
msgstr "Prüfsummen-Datei öffnen nachdem der Job beendet ist"
|
|
|
|
#: tfrmchecksumcalc.cbseparatefile.caption
|
|
msgid "C&reate separate checksum file for each file"
|
|
msgstr "Fü&r jede Datei eigene Prüfdatei erstellen"
|
|
|
|
#: tfrmchecksumcalc.lblsaveto.caption
|
|
msgid "&Save checksum file(s) to:"
|
|
msgstr "Prüf&summen-Datei speichern unter:"
|
|
|
|
#: tfrmchecksumverify.btnclose.caption
|
|
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmchecksumverify.caption
|
|
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
|
|
msgid "Verify checksum..."
|
|
msgstr "Verifiziere Prüfsumme..."
|
|
|
|
#: tfrmconnectionmanager.btnadd.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmconnectionmanager.btncancel.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmconnectionmanager.btnconnect.caption
|
|
msgid "C&onnect"
|
|
msgstr "Ve&rbinden"
|
|
|
|
#: tfrmconnectionmanager.btndelete.caption
|
|
msgctxt "tfrmconnectionmanager.btndelete.caption"
|
|
msgid "&Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmconnectionmanager.btnedit.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "Bearb&eiten"
|
|
|
|
#: tfrmconnectionmanager.caption
|
|
msgid "Connection manager"
|
|
msgstr "Verbindungsmanager"
|
|
|
|
#: tfrmconnectionmanager.gbconnectto.caption
|
|
msgid "Connect to:"
|
|
msgstr "Verbinde mit:"
|
|
|
|
#: tfrmcopydlg.btnaddtoqueue.caption
|
|
msgid "A&dd To Queue"
|
|
msgstr "&Zur Warteschlange hinzufügen"
|
|
|
|
#: tfrmcopydlg.btncancel.caption
|
|
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmcopydlg.btnoptions.caption
|
|
msgid "O&ptions"
|
|
msgstr "O&ptionen"
|
|
|
|
#: tfrmcopydlg.btnsaveoptions.caption
|
|
msgid "Sa&ve these options as default"
|
|
msgstr "Diese &Optionen als Standard speichern"
|
|
|
|
#: tfrmcopydlg.caption
|
|
msgctxt "TFRMCOPYDLG.CAPTION"
|
|
msgid "Copy file(s)"
|
|
msgstr "Datei(en) kopieren"
|
|
|
|
#: tfrmcopydlg.mnunewqueue.caption
|
|
msgid "New queue"
|
|
msgstr "Neue Warteschlange"
|
|
|
|
#: tfrmcopydlg.mnuqueue1.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue1.caption"
|
|
msgid "Queue 1"
|
|
msgstr "Warteschlange 1"
|
|
|
|
#: tfrmcopydlg.mnuqueue2.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue2.caption"
|
|
msgid "Queue 2"
|
|
msgstr "Warteschlange 2"
|
|
|
|
#: tfrmcopydlg.mnuqueue3.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue3.caption"
|
|
msgid "Queue 3"
|
|
msgstr "Warteschlange 3"
|
|
|
|
#: tfrmcopydlg.mnuqueue4.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue4.caption"
|
|
msgid "Queue 4"
|
|
msgstr "Warteschlange 4"
|
|
|
|
#: tfrmcopydlg.mnuqueue5.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue5.caption"
|
|
msgid "Queue 5"
|
|
msgstr "Warteschlange 5"
|
|
|
|
#: tfrmdescredit.actsavedescription.caption
|
|
msgid "Save Description"
|
|
msgstr "Beschreibung speichern"
|
|
|
|
#: tfrmdescredit.btncancel.caption
|
|
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmdescredit.btnok.caption
|
|
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmdescredit.caption
|
|
msgid "File/folder comment"
|
|
msgstr "Datei- / Ordnerkommentar"
|
|
|
|
#: tfrmdescredit.lbleditcommentfor.caption
|
|
msgid "E&dit comment for:"
|
|
msgstr "&Bearbeite Kommentar für:"
|
|
|
|
#: tfrmdescredit.lblencoding.caption
|
|
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
|
|
msgid "&Encoding:"
|
|
msgstr "&Kodierung:"
|
|
|
|
#: tfrmdescredit.lblfilename.caption
|
|
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmdiffer.actabout.caption
|
|
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "&Über"
|
|
|
|
#: tfrmdiffer.actautocompare.caption
|
|
msgid "Auto Compare"
|
|
msgstr "Automatisch vergleichen"
|
|
|
|
#: tfrmdiffer.actbinarycompare.caption
|
|
msgid "Binary Mode"
|
|
msgstr "Binärer Modus"
|
|
|
|
#: tfrmdiffer.actcancelcompare.caption
|
|
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Abbrechen"
|
|
|
|
#: tfrmdiffer.actcancelcompare.hint
|
|
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
|
msgid "Cancel"
|
|
msgstr "Abbrechen"
|
|
|
|
#: tfrmdiffer.actcopylefttoright.caption
|
|
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
|
|
msgid "Copy Block Right"
|
|
msgstr "Block nach rechts kopieren"
|
|
|
|
#: tfrmdiffer.actcopylefttoright.hint
|
|
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
|
msgid "Copy Block Right"
|
|
msgstr "Block nach rechts kopieren"
|
|
|
|
#: tfrmdiffer.actcopyrighttoleft.caption
|
|
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
|
|
msgid "Copy Block Left"
|
|
msgstr "Block nach links kopieren"
|
|
|
|
#: tfrmdiffer.actcopyrighttoleft.hint
|
|
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
|
msgid "Copy Block Left"
|
|
msgstr "Block nach links kopieren"
|
|
|
|
#: tfrmdiffer.acteditcopy.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmdiffer.acteditcut.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Ausschneiden"
|
|
|
|
#: tfrmdiffer.acteditdelete.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmdiffer.acteditpaste.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Einfügen"
|
|
|
|
#: tfrmdiffer.acteditredo.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
|
|
msgid "Redo"
|
|
msgstr "Wiederholen"
|
|
|
|
#: tfrmdiffer.acteditselectall.caption
|
|
msgid "Select &All"
|
|
msgstr "&Alles markieren"
|
|
|
|
#: tfrmdiffer.acteditundo.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
|
|
msgid "Undo"
|
|
msgstr "Rückgängig machen"
|
|
|
|
#: tfrmdiffer.actexit.caption
|
|
msgctxt "tfrmdiffer.actexit.caption"
|
|
msgid "E&xit"
|
|
msgstr "&Beenden"
|
|
|
|
#: tfrmdiffer.actfirstdifference.caption
|
|
msgctxt "tfrmdiffer.actfirstdifference.caption"
|
|
msgid "First Difference"
|
|
msgstr "Erster Unterschied"
|
|
|
|
#: tfrmdiffer.actfirstdifference.hint
|
|
msgctxt "tfrmdiffer.actfirstdifference.hint"
|
|
msgid "First Difference"
|
|
msgstr "Erster Unterschied"
|
|
|
|
#: tfrmdiffer.actignorecase.caption
|
|
msgid "Ignore Case"
|
|
msgstr "Groß-/Kleinschreibung ignorieren"
|
|
|
|
#: tfrmdiffer.actignorewhitespace.caption
|
|
msgid "Ignore Blanks"
|
|
msgstr "Leerzeichen ignorieren"
|
|
|
|
#: tfrmdiffer.actkeepscrolling.caption
|
|
msgid "Keep Scrolling"
|
|
msgstr "Bildlauf fortsetzen"
|
|
|
|
#: tfrmdiffer.actlastdifference.caption
|
|
msgctxt "tfrmdiffer.actlastdifference.caption"
|
|
msgid "Last Difference"
|
|
msgstr "Letzter Unterschied"
|
|
|
|
#: tfrmdiffer.actlastdifference.hint
|
|
msgctxt "tfrmdiffer.actlastdifference.hint"
|
|
msgid "Last Difference"
|
|
msgstr "Letzter Unterschied"
|
|
|
|
#: tfrmdiffer.actlinedifferences.caption
|
|
msgid "Line Differences"
|
|
msgstr "Zeilenunterschied"
|
|
|
|
#: tfrmdiffer.actnextdifference.caption
|
|
msgctxt "tfrmdiffer.actnextdifference.caption"
|
|
msgid "Next Difference"
|
|
msgstr "Nächster Unterschied"
|
|
|
|
#: tfrmdiffer.actnextdifference.hint
|
|
msgctxt "tfrmdiffer.actnextdifference.hint"
|
|
msgid "Next Difference"
|
|
msgstr "Nächster Unterschied"
|
|
|
|
#: tfrmdiffer.actopenleft.caption
|
|
msgid "Open Left..."
|
|
msgstr "Öffne links..."
|
|
|
|
#: tfrmdiffer.actopenright.caption
|
|
msgid "Open Right..."
|
|
msgstr "Öffne rechts..."
|
|
|
|
#: tfrmdiffer.actpaintbackground.caption
|
|
msgid "Paint Background"
|
|
msgstr "Hintergrund zeichnen"
|
|
|
|
#: tfrmdiffer.actprevdifference.caption
|
|
msgctxt "tfrmdiffer.actprevdifference.caption"
|
|
msgid "Previous Difference"
|
|
msgstr "Vorheriger Unterschied"
|
|
|
|
#: tfrmdiffer.actprevdifference.hint
|
|
msgctxt "tfrmdiffer.actprevdifference.hint"
|
|
msgid "Previous Difference"
|
|
msgstr "Vorheriger Unterschied"
|
|
|
|
#: tfrmdiffer.actreload.caption
|
|
msgid "&Reload"
|
|
msgstr "&Neu laden"
|
|
|
|
#: tfrmdiffer.actreload.hint
|
|
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
|
|
msgid "Reload"
|
|
msgstr "Neu laden"
|
|
|
|
#: tfrmdiffer.actsave.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
|
|
msgid "Save"
|
|
msgstr "Speichern"
|
|
|
|
#: tfrmdiffer.actsave.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
|
msgid "Save"
|
|
msgstr "Speichern"
|
|
|
|
#: tfrmdiffer.actsaveas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
|
|
msgid "Save as..."
|
|
msgstr "Speichern unter..."
|
|
|
|
#: tfrmdiffer.actsaveas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
|
msgid "Save as..."
|
|
msgstr "Speichern unter..."
|
|
|
|
#: tfrmdiffer.actsaveleft.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
|
|
msgid "Save Left"
|
|
msgstr "Speichere links"
|
|
|
|
#: tfrmdiffer.actsaveleft.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
|
msgid "Save Left"
|
|
msgstr "Speichere links"
|
|
|
|
#: tfrmdiffer.actsaveleftas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
|
|
msgid "Save Left As..."
|
|
msgstr "Speichere links unter..."
|
|
|
|
#: tfrmdiffer.actsaveleftas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
|
msgid "Save Left As..."
|
|
msgstr "Speichere links unter..."
|
|
|
|
#: tfrmdiffer.actsaveright.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
|
|
msgid "Save Right"
|
|
msgstr "Speichere rechts"
|
|
|
|
#: tfrmdiffer.actsaveright.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
|
msgid "Save Right"
|
|
msgstr "Speichere rechts"
|
|
|
|
#: tfrmdiffer.actsaverightas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
|
|
msgid "Save Right As..."
|
|
msgstr "Speichere rechts unter..."
|
|
|
|
#: tfrmdiffer.actsaverightas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
|
msgid "Save Right As..."
|
|
msgstr "Speichere rechts unter..."
|
|
|
|
#: tfrmdiffer.actstartcompare.caption
|
|
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
|
|
msgid "Compare"
|
|
msgstr "Vergleiche"
|
|
|
|
#: tfrmdiffer.actstartcompare.hint
|
|
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
|
msgid "Compare"
|
|
msgstr "Vergleiche"
|
|
|
|
#: tfrmdiffer.btnleftencoding.hint
|
|
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
|
|
msgid "Encoding"
|
|
msgstr "Kodierung"
|
|
|
|
#: tfrmdiffer.btnrightencoding.hint
|
|
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
|
msgid "Encoding"
|
|
msgstr "Kodierung"
|
|
|
|
#: tfrmdiffer.caption
|
|
msgctxt "TFRMDIFFER.CAPTION"
|
|
msgid "Compare files"
|
|
msgstr "Vergleiche Dateien"
|
|
|
|
#: tfrmdiffer.midivider1.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider10.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider2.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider3.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider4.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider5.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider6.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider7.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider8.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider9.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.miencodingleft.caption
|
|
msgid "&Left"
|
|
msgstr "&Links"
|
|
|
|
#: tfrmdiffer.miencodingright.caption
|
|
msgid "&Right"
|
|
msgstr "&Rechts"
|
|
|
|
#: tfrmdiffer.miseparator1.caption
|
|
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.miseparator2.caption
|
|
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.mnuactions.caption
|
|
msgid "&Actions"
|
|
msgstr "&Aktionen"
|
|
|
|
#: tfrmdiffer.mnuedit.caption
|
|
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "Bea&rbeiten"
|
|
|
|
#: tfrmdiffer.mnuencoding.caption
|
|
msgctxt "tfrmdiffer.mnuencoding.caption"
|
|
msgid "En&coding"
|
|
msgstr "&Kodierung"
|
|
|
|
#: tfrmdiffer.mnufile.caption
|
|
msgctxt "tfrmdiffer.mnufile.caption"
|
|
msgid "&File"
|
|
msgstr "&Datei"
|
|
|
|
#: tfrmdiffer.mnuoptions.caption
|
|
msgid "&Options"
|
|
msgstr "&Optionen"
|
|
|
|
#: tfrmedithotkey.btnaddshortcut.hint
|
|
msgid "Add new shortcut to sequence"
|
|
msgstr "Neue Verknüpfung zur Sequenz hinzufügen"
|
|
|
|
#: tfrmedithotkey.btncancel.caption
|
|
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "Abbru&ch"
|
|
|
|
#: tfrmedithotkey.btnok.caption
|
|
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmedithotkey.btnremoveshortcut.hint
|
|
msgid "Remove last shortcut from sequence"
|
|
msgstr "Letzte Verknüpfung aus der Sequenz entfernen"
|
|
|
|
#: tfrmedithotkey.btnselectfromlist.hint
|
|
msgid "Select shortcut from list of remaining free available keys"
|
|
msgstr ""
|
|
|
|
#: tfrmedithotkey.cghkcontrols.caption
|
|
msgctxt "tfrmedithotkey.cghkcontrols.caption"
|
|
msgid "Only for these controls"
|
|
msgstr "Nur für diese Steuerungselemente"
|
|
|
|
#: tfrmedithotkey.lblparameters.caption
|
|
msgid "&Parameters (each in a separate line):"
|
|
msgstr "&Parameter (jeder in einer eigenen Zeile):"
|
|
|
|
#: tfrmedithotkey.lblshortcuts.caption
|
|
msgid "Shortcuts:"
|
|
msgstr "Verknüpfungen:"
|
|
|
|
#: tfrmeditor.actabout.caption
|
|
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "&Über"
|
|
|
|
#: tfrmeditor.actabout.hint
|
|
msgctxt "tfrmeditor.actabout.hint"
|
|
msgid "About"
|
|
msgstr "&Über"
|
|
|
|
#: tfrmeditor.actconfhigh.caption
|
|
msgid "&Configuration"
|
|
msgstr "&Einstellungen"
|
|
|
|
#: tfrmeditor.actconfhigh.hint
|
|
msgctxt "tfrmeditor.actconfhigh.hint"
|
|
msgid "Configuration"
|
|
msgstr "Einstellungen"
|
|
|
|
#: tfrmeditor.acteditcopy.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmeditor.acteditcopy.hint
|
|
msgctxt "tfrmeditor.acteditcopy.hint"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmeditor.acteditcut.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Ausschneiden"
|
|
|
|
#: tfrmeditor.acteditcut.hint
|
|
msgctxt "tfrmeditor.acteditcut.hint"
|
|
msgid "Cut"
|
|
msgstr "Ausschneiden"
|
|
|
|
#: tfrmeditor.acteditdelete.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmeditor.acteditdelete.hint
|
|
msgctxt "tfrmeditor.acteditdelete.hint"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmeditor.acteditfind.caption
|
|
msgctxt "tfrmeditor.acteditfind.caption"
|
|
msgid "&Find"
|
|
msgstr "&Suchen"
|
|
|
|
#: tfrmeditor.acteditfind.hint
|
|
msgctxt "tfrmeditor.acteditfind.hint"
|
|
msgid "Find"
|
|
msgstr "Suchen"
|
|
|
|
#: tfrmeditor.acteditfindnext.caption
|
|
msgctxt "tfrmeditor.acteditfindnext.caption"
|
|
msgid "Find next"
|
|
msgstr "Finde nächste"
|
|
|
|
#: tfrmeditor.acteditfindnext.hint
|
|
msgctxt "tfrmeditor.acteditfindnext.hint"
|
|
msgid "Find next"
|
|
msgstr "Finde nächste"
|
|
|
|
#: tfrmeditor.acteditfindprevious.caption
|
|
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
|
msgid "Find previous"
|
|
msgstr "Finde vorherige"
|
|
|
|
#: tfrmeditor.acteditgotoline.caption
|
|
msgctxt "tfrmeditor.acteditgotoline.caption"
|
|
msgid "Goto Line..."
|
|
msgstr "Gehe zu Zeile..."
|
|
|
|
#: tfrmeditor.acteditlineendcr.caption
|
|
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
|
msgid "Mac (CR)"
|
|
msgstr "Mac (CR)"
|
|
|
|
#: tfrmeditor.acteditlineendcr.hint
|
|
msgctxt "tfrmeditor.acteditlineendcr.hint"
|
|
msgid "Mac (CR)"
|
|
msgstr "Mac (CR)"
|
|
|
|
#: tfrmeditor.acteditlineendcrlf.caption
|
|
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
|
msgid "Windows (CRLF)"
|
|
msgstr "Windows (CRLF)"
|
|
|
|
#: tfrmeditor.acteditlineendcrlf.hint
|
|
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
|
|
msgid "Windows (CRLF)"
|
|
msgstr "Windows (CRLF)"
|
|
|
|
#: tfrmeditor.acteditlineendlf.caption
|
|
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
|
msgid "Unix (LF)"
|
|
msgstr "Unix (LF)"
|
|
|
|
#: tfrmeditor.acteditlineendlf.hint
|
|
msgctxt "tfrmeditor.acteditlineendlf.hint"
|
|
msgid "Unix (LF)"
|
|
msgstr "Unix (LF)"
|
|
|
|
#: tfrmeditor.acteditpaste.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Einfügen"
|
|
|
|
#: tfrmeditor.acteditpaste.hint
|
|
msgctxt "tfrmeditor.acteditpaste.hint"
|
|
msgid "Paste"
|
|
msgstr "Einfügen"
|
|
|
|
#: tfrmeditor.acteditredo.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
|
msgid "Redo"
|
|
msgstr "Wiederholen"
|
|
|
|
#: tfrmeditor.acteditredo.hint
|
|
msgctxt "tfrmeditor.acteditredo.hint"
|
|
msgid "Redo"
|
|
msgstr "Wiederholen"
|
|
|
|
#: tfrmeditor.acteditrplc.caption
|
|
msgid "&Replace"
|
|
msgstr "E&rsetzen"
|
|
|
|
#: tfrmeditor.acteditrplc.hint
|
|
msgctxt "tfrmeditor.acteditrplc.hint"
|
|
msgid "Replace"
|
|
msgstr "Ersetzen"
|
|
|
|
#: tfrmeditor.acteditselectall.caption
|
|
msgid "Select&All"
|
|
msgstr "&Alle markieren"
|
|
|
|
#: tfrmeditor.acteditselectall.hint
|
|
msgctxt "tfrmeditor.acteditselectall.hint"
|
|
msgid "Select All"
|
|
msgstr "Alle mar&kieren"
|
|
|
|
#: tfrmeditor.acteditundo.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
|
msgid "Undo"
|
|
msgstr "Rückgängig machen"
|
|
|
|
#: tfrmeditor.acteditundo.hint
|
|
msgctxt "tfrmeditor.acteditundo.hint"
|
|
msgid "Undo"
|
|
msgstr "Rückgängig machen"
|
|
|
|
#: tfrmeditor.actfileclose.caption
|
|
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmeditor.actfileclose.hint
|
|
msgctxt "tfrmeditor.actfileclose.hint"
|
|
msgid "Close"
|
|
msgstr "Schließen"
|
|
|
|
#: tfrmeditor.actfileexit.caption
|
|
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Beenden"
|
|
|
|
#: tfrmeditor.actfileexit.hint
|
|
msgctxt "tfrmeditor.actfileexit.hint"
|
|
msgid "Exit"
|
|
msgstr "Programm beenden"
|
|
|
|
#: tfrmeditor.actfilenew.caption
|
|
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
|
|
msgid "&New"
|
|
msgstr "&Neu"
|
|
|
|
#: tfrmeditor.actfilenew.hint
|
|
msgctxt "tfrmeditor.actfilenew.hint"
|
|
msgid "New"
|
|
msgstr "Neu"
|
|
|
|
#: tfrmeditor.actfileopen.caption
|
|
msgid "&Open"
|
|
msgstr "&Öffnen"
|
|
|
|
#: tfrmeditor.actfileopen.hint
|
|
msgctxt "tfrmeditor.actfileopen.hint"
|
|
msgid "Open"
|
|
msgstr "Öffnen"
|
|
|
|
#: tfrmeditor.actfilesave.caption
|
|
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
|
|
msgid "&Save"
|
|
msgstr "&Speichern"
|
|
|
|
#: tfrmeditor.actfilesave.hint
|
|
msgctxt "tfrmeditor.actfilesave.hint"
|
|
msgid "Save"
|
|
msgstr "Speichern"
|
|
|
|
#: tfrmeditor.actfilesaveas.caption
|
|
msgid "Save &As..."
|
|
msgstr "Speichern &unter..."
|
|
|
|
#: tfrmeditor.actfilesaveas.hint
|
|
msgid "Save As"
|
|
msgstr "Speichern unter..."
|
|
|
|
#: tfrmeditor.actsaveall.caption
|
|
msgid "Sa&ve All"
|
|
msgstr "Alles &speichern"
|
|
|
|
#: tfrmeditor.actsaveall.hint
|
|
msgid "Save All"
|
|
msgstr "Alle speichern"
|
|
|
|
#: tfrmeditor.caption
|
|
msgctxt "tfrmeditor.caption"
|
|
msgid "Editor"
|
|
msgstr "Text-Editor"
|
|
|
|
#: tfrmeditor.help1.caption
|
|
msgctxt "TFRMEDITOR.HELP1.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "&Hilfe"
|
|
|
|
#: tfrmeditor.menuitem1.caption
|
|
msgctxt "tfrmeditor.menuitem1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmeditor.midiv.caption
|
|
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmeditor.miedit.caption
|
|
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Bearbeiten"
|
|
|
|
#: tfrmeditor.miencoding.caption
|
|
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
|
msgid "En&coding"
|
|
msgstr "&Kodierung"
|
|
|
|
#: tfrmeditor.miencodingin.caption
|
|
msgid "Open as"
|
|
msgstr "Öffnen als..."
|
|
|
|
#: tfrmeditor.miencodingout.caption
|
|
msgctxt "tfrmeditor.miencodingout.caption"
|
|
msgid "Save as"
|
|
msgstr "Speichern unter..."
|
|
|
|
#: tfrmeditor.mifile.caption
|
|
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
|
msgid "&File"
|
|
msgstr "&Datei"
|
|
|
|
#: tfrmeditor.mihighlight.caption
|
|
msgid "Syntax highlight"
|
|
msgstr "S&yntaxhervorhebung"
|
|
|
|
#: tfrmeditor.milineendtype.caption
|
|
msgid "End Of Line"
|
|
msgstr "Zeilenende"
|
|
|
|
#: tfrmeditor.miseparator1.caption
|
|
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmeditor.miseparator2.caption
|
|
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmeditor.n1.caption
|
|
msgctxt "TFRMEDITOR.N1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmeditor.n3.caption
|
|
msgctxt "TFRMEDITOR.N3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmeditor.n4.caption
|
|
msgctxt "TFRMEDITOR.N4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmeditor.n5.caption
|
|
msgctxt "TFRMEDITOR.N5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
|
|
msgid "&Cancel"
|
|
msgstr "&Ende"
|
|
|
|
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
|
msgid "C&ase sensitivity"
|
|
msgstr "Groß/Kleins&chreibung"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
|
msgid "S&earch from caret"
|
|
msgstr "Suche von &Cursor"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
|
|
msgid "&Regular expressions"
|
|
msgstr "&Reguläre Ausdrücke"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
|
msgid "Selected &text only"
|
|
msgstr "Nur den markierten &Text"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
|
msgid "&Whole words only"
|
|
msgstr "Nur ganze &Wörter"
|
|
|
|
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
|
msgid "Option"
|
|
msgstr "Optionen"
|
|
|
|
#: tfrmeditsearchreplace.lblreplacewith.caption
|
|
msgid "&Replace with:"
|
|
msgstr "&Ersetzen mit:"
|
|
|
|
#: tfrmeditsearchreplace.lblsearchfor.caption
|
|
msgid "&Search for:"
|
|
msgstr "&Suche nach:"
|
|
|
|
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
|
msgid "Direction"
|
|
msgstr "Richtung"
|
|
|
|
#: tfrmextractdlg.caption
|
|
msgctxt "TFRMEXTRACTDLG.CAPTION"
|
|
msgid "Unpack files"
|
|
msgstr "Entpacke Dateien"
|
|
|
|
#: tfrmextractdlg.cbextractpath.caption
|
|
msgid "&Unpack path names if stored with files"
|
|
msgstr "&Pfad mit entpacken (falls gespeichert)"
|
|
|
|
#: tfrmextractdlg.cbfilemask.text
|
|
msgctxt "tfrmextractdlg.cbfilemask.text"
|
|
msgid "*.*"
|
|
msgstr "*.*"
|
|
|
|
#: tfrmextractdlg.cbinseparatefolder.caption
|
|
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
|
msgstr "Jedes Archiv in &separaten Ordner entpacken (mit Namen des Archivs)"
|
|
|
|
#: tfrmextractdlg.cboverwrite.caption
|
|
msgid "O&verwrite existing files"
|
|
msgstr "&Vorhandene Dateien überschreiben"
|
|
|
|
#: tfrmextractdlg.lblextractto.caption
|
|
msgid "To the &directory:"
|
|
msgstr "Entpacke Dateien &nach"
|
|
|
|
#: tfrmextractdlg.lblfilemask.caption
|
|
msgid "&Extract files matching file mask:"
|
|
msgstr "Entpacke &Dateien anhand Auswahl"
|
|
|
|
#: tfrmextractdlg.lblpassword.caption
|
|
msgid "&Password for encrypted files:"
|
|
msgstr "&Passwort für verschlüsselte Dateien"
|
|
|
|
#: tfrmfileexecuteyourself.btnclose.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmfileexecuteyourself.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
|
|
msgid "Wait..."
|
|
msgstr "Warte..."
|
|
|
|
#: tfrmfileexecuteyourself.lblfilename.caption
|
|
msgid "File name:"
|
|
msgstr "Dateiname:"
|
|
|
|
#: tfrmfileexecuteyourself.lblfrompath.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
|
|
msgid "From:"
|
|
msgstr "Von:"
|
|
|
|
#: tfrmfileexecuteyourself.lblprompt.caption
|
|
msgid "Click on Close when the temporary file can be deleted!"
|
|
msgstr "Auf [Schließen] klicken, wenn die temporären Daten gelöscht werden können!"
|
|
|
|
#: tfrmfileop.btncancel.caption
|
|
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmfileop.btnminimizetopanel.caption
|
|
msgid "&To panel"
|
|
msgstr "&In Panel:"
|
|
|
|
#: tfrmfileop.btnviewoperations.caption
|
|
msgid "&View all"
|
|
msgstr "&Alle betrachten"
|
|
|
|
#: tfrmfileop.lblcurrentoperation.caption
|
|
msgid "Current operation:"
|
|
msgstr "Aktuelle Operation:"
|
|
|
|
#: tfrmfileop.lblfrom.caption
|
|
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
|
msgid "From:"
|
|
msgstr "Von:"
|
|
|
|
#: tfrmfileop.lblto.caption
|
|
msgid "To:"
|
|
msgstr "Nach:"
|
|
|
|
#: tfrmfileproperties.btnclose.caption
|
|
msgctxt "tfrmfileproperties.btnclose.caption"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmfileproperties.btnsetproperties.caption
|
|
msgid "&Set properties"
|
|
msgstr "Eigen&schaften einstellen"
|
|
|
|
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
|
msgid "Set to &all selected files"
|
|
msgstr "&Auf alle ausgewählten Dateien anwenden"
|
|
|
|
#: tfrmfileproperties.btnskipfile.caption
|
|
msgid "Ski&p this file"
|
|
msgstr "Diese Datei übers&pringen"
|
|
|
|
#: tfrmfileproperties.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CAPTION"
|
|
msgid "Properties"
|
|
msgstr "Eigenschaften"
|
|
|
|
#: tfrmfileproperties.cbsgid.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmfileproperties.cbsticky.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Dauerhaft"
|
|
|
|
#: tfrmfileproperties.cbsuid.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmfileproperties.chkexecutable.caption
|
|
msgid "Allow &executing file as program"
|
|
msgstr ""
|
|
|
|
#: tfrmfileproperties.gbowner.caption
|
|
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Besitzer"
|
|
|
|
#: tfrmfileproperties.lblattrbitsstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bits:"
|
|
|
|
#: tfrmfileproperties.lblattrgroupstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Gruppe"
|
|
|
|
#: tfrmfileproperties.lblattrotherstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Andere"
|
|
|
|
#: tfrmfileproperties.lblattrownerstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Besitzer"
|
|
|
|
#: tfrmfileproperties.lblattrtext.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
|
msgid "-----------"
|
|
msgstr "-----------"
|
|
|
|
#: tfrmfileproperties.lblattrtextstr.caption
|
|
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
|
|
msgid "Text:"
|
|
msgstr "Text:"
|
|
|
|
#: tfrmfileproperties.lblcontains.caption
|
|
msgctxt "tfrmfileproperties.lblcontains.caption"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblcontainsstr.caption
|
|
msgid "Contains:"
|
|
msgstr "Enthält:"
|
|
|
|
#: tfrmfileproperties.lblexec.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Ausführen"
|
|
|
|
#: tfrmfileproperties.lblexecutable.caption
|
|
msgid "Execute:"
|
|
msgstr ""
|
|
|
|
#: tfrmfileproperties.lblfile.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Dateiname"
|
|
|
|
#: tfrmfileproperties.lblfilename.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblfilestr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Dateiname"
|
|
|
|
#: tfrmfileproperties.lblfolder.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblfolderstr.caption
|
|
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
|
msgid "Path:"
|
|
msgstr "Pfad:"
|
|
|
|
#: tfrmfileproperties.lblgroupstr.caption
|
|
msgid "&Group"
|
|
msgstr "&Gruppe"
|
|
|
|
#: tfrmfileproperties.lbllastaccess.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllastaccessstr.caption
|
|
msgid "Last access:"
|
|
msgstr "Letzter Zugriff"
|
|
|
|
#: tfrmfileproperties.lbllastmodif.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllastmodifstr.caption
|
|
msgid "Last modification:"
|
|
msgstr "Letzte Änderung:"
|
|
|
|
#: tfrmfileproperties.lbllaststchange.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllaststchangestr.caption
|
|
msgid "Last status change:"
|
|
msgstr "Letzte Änderung des Status:"
|
|
|
|
#: tfrmfileproperties.lbloctal.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
|
|
msgid "Octal:"
|
|
msgstr "Oktal:"
|
|
|
|
#: tfrmfileproperties.lblownerstr.caption
|
|
msgid "O&wner"
|
|
msgstr "Besit&zer"
|
|
|
|
#: tfrmfileproperties.lblread.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Lesen"
|
|
|
|
#: tfrmfileproperties.lblsize.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblsizestr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
|
|
msgid "Size:"
|
|
msgstr "Größe:"
|
|
|
|
#: tfrmfileproperties.lblsymlink.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblsymlinkstr.caption
|
|
msgid "Symlink to:"
|
|
msgstr "Symb. Link:"
|
|
|
|
#: tfrmfileproperties.lbltype.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbltypestr.caption
|
|
msgid "Type:"
|
|
msgstr "Typ:"
|
|
|
|
#: tfrmfileproperties.lblwrite.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Schreiben"
|
|
|
|
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
|
msgid "Name"
|
|
msgstr "Name"
|
|
|
|
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
|
msgid "Value"
|
|
msgstr "Wert"
|
|
|
|
#: tfrmfileproperties.tsattributes.caption
|
|
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Attribute"
|
|
|
|
#: tfrmfileproperties.tsplugins.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.tsplugins.caption"
|
|
msgid "Plugins"
|
|
msgstr "Plugins"
|
|
|
|
#: tfrmfileproperties.tsproperties.caption
|
|
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
|
msgid "Properties"
|
|
msgstr "Eigenschaften"
|
|
|
|
#: tfrmfinddlg.actcancel.caption
|
|
msgctxt "tfrmfinddlg.actcancel.caption"
|
|
msgid "C&ancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmfinddlg.actcancelclose.caption
|
|
msgid "Cancel search and close window"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmfinddlg.actclose.caption
|
|
msgctxt "tfrmfinddlg.actclose.caption"
|
|
msgid "&Close"
|
|
msgstr "Schließen"
|
|
|
|
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
|
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
|
|
msgid "Configuration of hot keys"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actedit.caption
|
|
msgctxt "tfrmfinddlg.actedit.caption"
|
|
msgid "&Edit"
|
|
msgstr "Bea&rbeiten"
|
|
|
|
#: tfrmfinddlg.actfeedtolistbox.caption
|
|
msgid "Feed to &listbox"
|
|
msgstr "Füge in &Listbox ein"
|
|
|
|
#: tfrmfinddlg.actfreefrommem.caption
|
|
msgid "Cancel search, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actfreefrommemallothers.caption
|
|
msgid "For all other \"Find files\", cancel, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actgotofile.caption
|
|
msgid "&Go to file"
|
|
msgstr "&Gehe zu Datei"
|
|
|
|
#: tfrmfinddlg.actintellifocus.caption
|
|
msgctxt "tfrmfinddlg.actintellifocus.caption"
|
|
msgid "Find Data"
|
|
msgstr "Finde Daten"
|
|
|
|
#: tfrmfinddlg.actlastsearch.caption
|
|
msgid "&Last search"
|
|
msgstr "&Letzte Suche"
|
|
|
|
#: tfrmfinddlg.actnewsearch.caption
|
|
msgid "&New search"
|
|
msgstr "&Neue Suche"
|
|
|
|
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
|
msgid "New search (clear filters)"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageadvanced.caption
|
|
msgid "Go to page \"Advanced\""
|
|
msgstr "Gehe zu Seite \"Fortgeschritten\""
|
|
|
|
#: tfrmfinddlg.actpageloadsave.caption
|
|
msgid "Go to page \"Load/Save\""
|
|
msgstr "Gehe zu Seite \"Laden/Speichern\""
|
|
|
|
#: tfrmfinddlg.actpagenext.caption
|
|
msgid "Switch to Nex&t Page"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageplugins.caption
|
|
msgid "Go to page \"Plugins\""
|
|
msgstr "Gehe zu Seite \"Plugins\""
|
|
|
|
#: tfrmfinddlg.actpageprev.caption
|
|
msgid "Switch to &Previous Page"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageresults.caption
|
|
msgid "Go to page \"Results\""
|
|
msgstr "Gehe zu Seite \"Ergebnisse\""
|
|
|
|
#: tfrmfinddlg.actpagestandard.caption
|
|
msgid "Go to page \"Standard\""
|
|
msgstr "Gehe zu Seite \"Standard\""
|
|
|
|
#: tfrmfinddlg.actstart.caption
|
|
msgctxt "tfrmfinddlg.actstart.caption"
|
|
msgid "&Start"
|
|
msgstr "&Starten"
|
|
|
|
#: tfrmfinddlg.actview.caption
|
|
msgctxt "tfrmfinddlg.actview.caption"
|
|
msgid "&View"
|
|
msgstr "&Betrachten"
|
|
|
|
#: tfrmfinddlg.btnaddattribute.caption
|
|
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmfinddlg.btnattrshelp.caption
|
|
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "&Hilfe"
|
|
|
|
#: tfrmfinddlg.btnsavetemplate.caption
|
|
msgctxt "tfrmfinddlg.btnsavetemplate.caption"
|
|
msgid "&Save"
|
|
msgstr "&Speichern"
|
|
|
|
#: tfrmfinddlg.btnsearchdelete.caption
|
|
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "L&öschen"
|
|
|
|
#: tfrmfinddlg.btnsearchload.caption
|
|
msgid "L&oad"
|
|
msgstr "&Laden"
|
|
|
|
#: tfrmfinddlg.btnsearchsave.caption
|
|
msgid "S&ave"
|
|
msgstr "&Speichern"
|
|
|
|
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
|
msgid "Sa&ve with \"Start in directory\""
|
|
msgstr "S&peichern mit Start-Pfad"
|
|
|
|
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
|
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
|
msgstr "Wenn der Start-Pfad mitgepeichert wird, wird er wiederhergestellt, wenn die Vorlage geladen wird. Nützlich, wenn eine Suche immer im gleichen Verzeichnis gestartet werden soll."
|
|
|
|
#: tfrmfinddlg.btnusetemplate.caption
|
|
msgid "Use template"
|
|
msgstr "Vorlage benutzen"
|
|
|
|
#: tfrmfinddlg.caption
|
|
msgctxt "tfrmfinddlg.caption"
|
|
msgid "Find files"
|
|
msgstr "Dateien suchen"
|
|
|
|
#: tfrmfinddlg.cbcasesens.caption
|
|
msgid "Case sens&itive"
|
|
msgstr "Groß-/Kle&inschreibung beachten"
|
|
|
|
#: tfrmfinddlg.cbdatefrom.caption
|
|
msgid "&Date from:"
|
|
msgstr "Ab &Datum:"
|
|
|
|
#: tfrmfinddlg.cbdateto.caption
|
|
msgid "Dat&e to:"
|
|
msgstr "&Vor Datum:"
|
|
|
|
#: tfrmfinddlg.cbfilesizefrom.caption
|
|
msgid "S&ize from:"
|
|
msgstr "Date&igröße ab:"
|
|
|
|
#: tfrmfinddlg.cbfilesizeto.caption
|
|
msgid "Si&ze to:"
|
|
msgstr "Bis Dateigr&öße"
|
|
|
|
#: tfrmfinddlg.cbfindinarchive.caption
|
|
msgid "Search in &archives"
|
|
msgstr "In &Archiv(en) suchen"
|
|
|
|
#: tfrmfinddlg.cbfindtext.caption
|
|
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
|
|
msgid "Find &text in file"
|
|
msgstr "&Text suchen"
|
|
|
|
#: tfrmfinddlg.cbfollowsymlinks.caption
|
|
msgid "Follow s&ymlinks"
|
|
msgstr "S&ymlinks folgen"
|
|
|
|
#: tfrmfinddlg.cbnotcontainingtext.caption
|
|
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
|
|
msgid "Find files N&OT containing the text"
|
|
msgstr "Suche Datei die &NICHT den Text enthalten"
|
|
|
|
#: tfrmfinddlg.cbnotolderthan.caption
|
|
msgid "N&ot older than:"
|
|
msgstr "Nicht &älter als:"
|
|
|
|
#: tfrmfinddlg.cbopenedtabs.caption
|
|
msgid "Opened tabs"
|
|
msgstr "Geöffnete Tabs"
|
|
|
|
#: tfrmfinddlg.cbpartialnamesearch.caption
|
|
msgid "Searc&h for part of file name"
|
|
msgstr "Suc&he nach einem Teil des Dateinamens"
|
|
|
|
#: tfrmfinddlg.cbregexp.caption
|
|
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
|
|
msgid "&Regular expression"
|
|
msgstr "&Reguläre Ausdrücke"
|
|
|
|
#: tfrmfinddlg.cbreplacetext.caption
|
|
msgid "Re&place by"
|
|
msgstr "E&rsetze mit"
|
|
|
|
#: tfrmfinddlg.cbselectedfiles.caption
|
|
msgid "Selected directories and &files"
|
|
msgstr "Ausgew&ählte Verzeichnisse und Dateien"
|
|
|
|
#: tfrmfinddlg.cbtextregexp.caption
|
|
msgid "Regular &expression"
|
|
msgstr "R&egulärer Ausdruck"
|
|
|
|
#: tfrmfinddlg.cbtimefrom.caption
|
|
msgid "&Time from:"
|
|
msgstr "Zeit &von:"
|
|
|
|
#: tfrmfinddlg.cbtimeto.caption
|
|
msgid "Ti&me to:"
|
|
msgstr "Zeit &bis:"
|
|
|
|
#: tfrmfinddlg.cbuseplugin.caption
|
|
msgid "&Use search plugin:"
|
|
msgstr "Nutze Such-PlugIn"
|
|
|
|
#: tfrmfinddlg.cmbexcludedirectories.hint
|
|
msgid "Enter directories names that should be excluded from search separated with \";\""
|
|
msgstr "Verzeichnisnamen eingeben, die von der Suche ausgeschlossen werden sollen (Namen mit \";\" trennen)"
|
|
|
|
#: tfrmfinddlg.cmbexcludefiles.hint
|
|
msgid "Enter files names that should be excluded from search separated with \";\""
|
|
msgstr "Dateinamen eingeben, die von der Suche ausgeschlossen werden sollen (Namen mit \";\" trennen)"
|
|
|
|
#: tfrmfinddlg.cmbfindfilemask.hint
|
|
msgid "Enter files names separated with \";\""
|
|
msgstr "Dateinamen durch \";\" getrennt eingeben"
|
|
|
|
#: tfrmfinddlg.gbdirectories.caption
|
|
msgctxt "tfrmfinddlg.gbdirectories.caption"
|
|
msgid "Directories"
|
|
msgstr "Verzeichnisse"
|
|
|
|
#: tfrmfinddlg.gbfiles.caption
|
|
msgctxt "tfrmfinddlg.gbfiles.caption"
|
|
msgid "Files"
|
|
msgstr "Dateien"
|
|
|
|
#: tfrmfinddlg.gbfinddata.caption
|
|
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
|
msgid "Find Data"
|
|
msgstr "Suche Daten"
|
|
|
|
#: tfrmfinddlg.lblattributes.caption
|
|
msgid "Attri&butes"
|
|
msgstr "Attri&bute"
|
|
|
|
#: tfrmfinddlg.lblencoding.caption
|
|
msgid "Encodin&g:"
|
|
msgstr "&Kodierung:"
|
|
|
|
#: tfrmfinddlg.lblexcludedirectories.caption
|
|
msgid "E&xclude subdirectories"
|
|
msgstr "Unterverzeichnisse &ausschließen"
|
|
|
|
#: tfrmfinddlg.lblexcludefiles.caption
|
|
msgid "&Exclude files"
|
|
msgstr "Dateien a&usschließen"
|
|
|
|
#: tfrmfinddlg.lblfindfilemask.caption
|
|
msgid "&File mask"
|
|
msgstr "&Dateimaske"
|
|
|
|
#: tfrmfinddlg.lblfindpathstart.caption
|
|
msgid "Start in &directory"
|
|
msgstr "Verzeichnis in dem &Double Commander suchen soll"
|
|
|
|
#: tfrmfinddlg.lblsearchdepth.caption
|
|
msgid "Search su&bdirectories:"
|
|
msgstr "Unter&verzeichnisse durchsuchen:"
|
|
|
|
#: tfrmfinddlg.lbltemplateheader.caption
|
|
msgid "&Previous searches:"
|
|
msgstr "&Vorherige Suche(n)"
|
|
|
|
#: tfrmfinddlg.miaction.caption
|
|
msgid "&Action"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.mifreefrommemallothers.caption
|
|
msgid "For all others, cancel, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.miopeninnewtab.caption
|
|
msgid "Open In New Tab(s)"
|
|
msgstr "In (einem) neuen Tab(s) öffnen"
|
|
|
|
#: tfrmfinddlg.mioptions.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfinddlg.mioptions.caption"
|
|
msgid "Options"
|
|
msgstr "Optionen"
|
|
|
|
#: tfrmfinddlg.miremovefromllist.caption
|
|
msgid "Remove from list"
|
|
msgstr "Von der Liste entfernen"
|
|
|
|
#: tfrmfinddlg.miresult.caption
|
|
msgid "&Result"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.miseparator1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfinddlg.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmfinddlg.miseparator2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfinddlg.miseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmfinddlg.mishowallfound.caption
|
|
msgid "Show all found items"
|
|
msgstr "Alle gefundenen Einträge anzeigen"
|
|
|
|
#: tfrmfinddlg.mishowineditor.caption
|
|
msgid "Show In Editor"
|
|
msgstr "In Editor öffnen"
|
|
|
|
#: tfrmfinddlg.mishowinviewer.caption
|
|
msgid "Show In Viewer"
|
|
msgstr "Zeige in Betrachter"
|
|
|
|
#: tfrmfinddlg.miviewtab.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfinddlg.miviewtab.caption"
|
|
msgid "&View"
|
|
msgstr "&Anzeigen"
|
|
|
|
#: tfrmfinddlg.tsadvanced.caption
|
|
msgid "Advanced"
|
|
msgstr "Erweitert"
|
|
|
|
#: tfrmfinddlg.tsloadsave.caption
|
|
msgid "Load/Save"
|
|
msgstr "Laden/Speichern"
|
|
|
|
#: tfrmfinddlg.tsplugins.caption
|
|
msgctxt "tfrmfinddlg.tsplugins.caption"
|
|
msgid "Plugins"
|
|
msgstr "Plugins"
|
|
|
|
#: tfrmfinddlg.tsresults.caption
|
|
msgid "Results"
|
|
msgstr "Ergebnisse"
|
|
|
|
#: tfrmfinddlg.tsstandard.caption
|
|
msgid "Standard"
|
|
msgstr "Standard"
|
|
|
|
#: tfrmfindview.btnclose.caption
|
|
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmfindview.btnfind.caption
|
|
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
|
msgid "&Find"
|
|
msgstr "&Suchen"
|
|
|
|
#: tfrmfindview.caption
|
|
msgctxt "TFRMFINDVIEW.CAPTION"
|
|
msgid "Find"
|
|
msgstr "Suchen"
|
|
|
|
#: tfrmfindview.cbcasesens.caption
|
|
msgid "C&ase sensitive"
|
|
msgstr "Schreibweise be&achten"
|
|
|
|
#: tfrmhardlink.btncancel.caption
|
|
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmhardlink.btnok.caption
|
|
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmhardlink.caption
|
|
msgid "Create hard link"
|
|
msgstr "Erstelle Hardlink"
|
|
|
|
#: tfrmhardlink.lblexistingfile.caption
|
|
msgctxt "tfrmhardlink.lblexistingfile.caption"
|
|
msgid "&Destination that the link will point to"
|
|
msgstr "Bestehen&des Ziel (auf das der Hardlink zeigt)"
|
|
|
|
#: tfrmhardlink.lbllinktocreate.caption
|
|
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
|
|
msgid "&Link name"
|
|
msgstr "Hard&link-Name"
|
|
|
|
#: tfrmhotdirexportimport.btnselectall.caption
|
|
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
|
|
msgid "Import all!"
|
|
msgstr "Alle importieren!"
|
|
|
|
#: tfrmhotdirexportimport.btnselectiondone.caption
|
|
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
|
|
msgid "Import selected"
|
|
msgstr "Ausgewählte importieren"
|
|
|
|
#: tfrmhotdirexportimport.caption
|
|
msgctxt "tfrmhotdirexportimport.caption"
|
|
msgid "Select the entries your want to import"
|
|
msgstr "Einträge auswählen, die importiert werden sollen"
|
|
|
|
#: tfrmhotdirexportimport.lbhint.caption
|
|
msgctxt "tfrmhotdirexportimport.lbhint.caption"
|
|
msgid "When clicking a sub-menu, it will select the whole menu"
|
|
msgstr "Wird ein Untermenü ausgewählt, wird das ganze Menü ausgewählt"
|
|
|
|
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
|
msgid "Hold CTRL and click entries to select multiple ones"
|
|
msgstr "Strg halten und Einträge anklicken um mehrere auszuwählen"
|
|
|
|
#: tfrmlinker.btnsave.caption
|
|
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmlinker.caption
|
|
msgctxt "TFRMLINKER.CAPTION"
|
|
msgid "Linker"
|
|
msgstr "Verschmelzer"
|
|
|
|
#: tfrmlinker.gbsaveto.caption
|
|
msgid "Save to..."
|
|
msgstr "Speichern unter..."
|
|
|
|
#: tfrmlinker.grbxcontrol.caption
|
|
msgid "Item"
|
|
msgstr "Eintrag"
|
|
|
|
#: tfrmlinker.lblfilename.caption
|
|
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
|
|
msgid "&File name"
|
|
msgstr "&Dateiname"
|
|
|
|
#: tfrmlinker.spbtndown.caption
|
|
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
|
|
msgid "Do&wn"
|
|
msgstr "A&bwärts"
|
|
|
|
#: tfrmlinker.spbtndown.hint
|
|
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
|
|
msgid "Down"
|
|
msgstr "A&bwärts"
|
|
|
|
#: tfrmlinker.spbtnrem.caption
|
|
msgctxt "tfrmlinker.spbtnrem.caption"
|
|
msgid "&Remove"
|
|
msgstr "Entfe&rnen"
|
|
|
|
#: tfrmlinker.spbtnrem.hint
|
|
msgctxt "tfrmlinker.spbtnrem.hint"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmlinker.spbtnup.caption
|
|
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
|
|
msgid "&Up"
|
|
msgstr "Aufw&ärts"
|
|
|
|
#: tfrmlinker.spbtnup.hint
|
|
msgctxt "TFRMLINKER.SPBTNUP.HINT"
|
|
msgid "Up"
|
|
msgstr "Aufw&ärts"
|
|
|
|
#: tfrmmain.actabout.caption
|
|
msgid "&About"
|
|
msgstr "&Über..."
|
|
|
|
#: tfrmmain.actaddfilenametocmdline.caption
|
|
msgid "Add file name to command line"
|
|
msgstr "Dateiname in die Befehlszeile kopieren"
|
|
|
|
#: tfrmmain.actaddnewsearch.caption
|
|
msgid "New search instance..."
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
|
msgid "Add path and file name to command line"
|
|
msgstr "Pfad und Dateiname in die Befehlszeile kopieren"
|
|
|
|
#: tfrmmain.actaddpathtocmdline.caption
|
|
msgid "Copy path to command line"
|
|
msgstr "&Pfad in die Befehlszeile eintragen"
|
|
|
|
#: tfrmmain.actbriefview.caption
|
|
msgctxt "tfrmmain.actbriefview.caption"
|
|
msgid "Brief view"
|
|
msgstr "Verkürzt"
|
|
|
|
#: tfrmmain.actbriefview.hint
|
|
msgid "Brief View"
|
|
msgstr "Verkürzte Ansicht"
|
|
|
|
#: tfrmmain.actcalculatespace.caption
|
|
msgid "Calculate &Occupied Space"
|
|
msgstr "Berechne belegten &Speicherplatz..."
|
|
|
|
#: tfrmmain.actchangedir.caption
|
|
msgid "Change directory"
|
|
msgstr "Verzeichnis wechseln"
|
|
|
|
#: tfrmmain.actchangedirtohome.caption
|
|
msgid "Change directory to home"
|
|
msgstr "Wechsel zum Home-Verzeichnis (Nutzer)"
|
|
|
|
#: tfrmmain.actchangedirtoparent.caption
|
|
msgid "Change Directory To Parent"
|
|
msgstr "In das übergeordnete Verzeichnis wechseln"
|
|
|
|
#: tfrmmain.actchangedirtoroot.caption
|
|
msgid "Change directory to root"
|
|
msgstr "Verzeichnis zu Root wechseln"
|
|
|
|
#: tfrmmain.actchecksumcalc.caption
|
|
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
|
|
msgid "Calculate Check&sum..."
|
|
msgstr "Berechne Prüf&summe..."
|
|
|
|
#: tfrmmain.actchecksumverify.caption
|
|
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
|
|
msgid "&Verify Checksum..."
|
|
msgstr "&Verifiziere Prüfsumme..."
|
|
|
|
#: tfrmmain.actclearlogfile.caption
|
|
msgid "Clear log file"
|
|
msgstr "Log-Datei leeren"
|
|
|
|
#: tfrmmain.actclearlogwindow.caption
|
|
msgid "Clear log window"
|
|
msgstr "Log-Fenster leeren"
|
|
|
|
#: tfrmmain.actclosealltabs.caption
|
|
msgctxt "tfrmmain.actclosealltabs.caption"
|
|
msgid "Close &All Tabs"
|
|
msgstr "&Alle Tabs schließen"
|
|
|
|
#: tfrmmain.actcloseduplicatetabs.caption
|
|
msgid "Close Duplicate Tabs"
|
|
msgstr "Doppelte Tabs schließen"
|
|
|
|
#: tfrmmain.actclosetab.caption
|
|
msgid "&Close Tab"
|
|
msgstr "Tab &schließen"
|
|
|
|
#: tfrmmain.actcmdlinenext.caption
|
|
msgid "Next Command Line"
|
|
msgstr "Nächste Befehlszeile"
|
|
|
|
#: tfrmmain.actcmdlinenext.hint
|
|
msgid "Set command line to next command in history"
|
|
msgstr "Stelle Befehlszeile auf den nächsten Befehl im Verlauf"
|
|
|
|
#: tfrmmain.actcmdlineprev.caption
|
|
msgid "Previous Command Line"
|
|
msgstr "Vorher eingegebener Befehl"
|
|
|
|
#: tfrmmain.actcmdlineprev.hint
|
|
msgid "Set command line to previous command in history"
|
|
msgstr "Nutze die Befehlszeile mit dem zuletzt eingegebenen Befehl"
|
|
|
|
#: tfrmmain.actcolumnsview.caption
|
|
msgid "Full"
|
|
msgstr "Vollständig"
|
|
|
|
#: tfrmmain.actcolumnsview.hint
|
|
msgid "Columns View"
|
|
msgstr "Spaltenansicht"
|
|
|
|
#: tfrmmain.actcomparecontents.caption
|
|
msgid "Compare by &Contents"
|
|
msgstr "Anhand des &Inhalts vergleichen"
|
|
|
|
#: tfrmmain.actcomparedirectories.caption
|
|
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
|
|
msgid "Compare Directories"
|
|
msgstr "Vergleiche Ordner/Verzeichnisse"
|
|
|
|
#: tfrmmain.actcomparedirectories.hint
|
|
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
|
msgid "Compare Directories"
|
|
msgstr "Vergleiche Ordner/Verzeichnisse"
|
|
|
|
#: tfrmmain.actconfigdirhotlist.caption
|
|
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
|
msgid "Configuration of Directory Hotlist"
|
|
msgstr "Konfiguration der Verzeichnis-Hotlist"
|
|
|
|
#: tfrmmain.actconfigfavoritetabs.caption
|
|
msgid "Configuration of Favorite Tabs"
|
|
msgstr "Konfiguration der Favoriten-Tabs"
|
|
|
|
#: tfrmmain.actconfigfoldertabs.caption
|
|
msgid "Configuration of folder tabs"
|
|
msgstr "Konfiguration der Verzeichnis-Tabs"
|
|
|
|
#: tfrmmain.actconfighotkeys.caption
|
|
msgctxt "tfrmmain.actconfighotkeys.caption"
|
|
msgid "Configuration of hot keys"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigsavesettings.caption
|
|
msgid "Save Settings"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigsearches.caption
|
|
msgid "Configuration of searches"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigtoolbars.caption
|
|
msgid "Toolbar..."
|
|
msgstr "Toolbar..."
|
|
|
|
#: tfrmmain.actconfigtreeviewmenus.caption
|
|
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
|
msgid "Configuration of Tree View Menu"
|
|
msgstr "Konfiguration Baumansicht Menü"
|
|
|
|
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
|
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
|
msgid "Configuration of Tree View Menu Colors"
|
|
msgstr "Konfiguration Baumansicht Menü Farben"
|
|
|
|
#: tfrmmain.actcontextmenu.caption
|
|
msgid "Show context menu"
|
|
msgstr "&Zeige Kontextmenü"
|
|
|
|
#: tfrmmain.actcopy.caption
|
|
msgctxt "tfrmmain.actcopy.caption"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmmain.actcopyalltabstoopposite.caption
|
|
msgid "Copy all tabs to opposite side"
|
|
msgstr "Alle Tabs auf die gegenüberliegende Seite kopieren"
|
|
|
|
#: tfrmmain.actcopyfiledetailstoclip.caption
|
|
msgid "Copy all shown &columns"
|
|
msgstr "Kopiere alle ange&zeigten Spalten"
|
|
|
|
#: tfrmmain.actcopyfullnamestoclip.caption
|
|
msgid "Copy Filename(s) with Full &Path"
|
|
msgstr "Kopiere Dateinamen mit komplettem &Pfad"
|
|
|
|
#: tfrmmain.actcopynamestoclip.caption
|
|
msgid "Copy &Filename(s) to Clipboard"
|
|
msgstr "Kopiere Datei&namen in die Zwischenablage"
|
|
|
|
#: tfrmmain.actcopynoask.caption
|
|
msgid "Copy files without asking for confirmation"
|
|
msgstr "Datei(en) ohne Nachfrage kopieren"
|
|
|
|
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
|
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
|
msgstr "Kopiere den kompletten Pfad der markierten Datei(en) ohne Verzeichnis-Trennzeichen am Ende (/)"
|
|
|
|
#: tfrmmain.actcopypathoffilestoclip.caption
|
|
msgid "Copy Full Path of selected file(s)"
|
|
msgstr "Kopiere den kompletten Pfad der markierten Datei(en)"
|
|
|
|
#: tfrmmain.actcopysamepanel.caption
|
|
msgid "Copy to same panel"
|
|
msgstr "Kopiere in gleichen Ordner"
|
|
|
|
#: tfrmmain.actcopytoclipboard.caption
|
|
msgid "&Copy"
|
|
msgstr "&Kopieren"
|
|
|
|
#: tfrmmain.actcountdircontent.caption
|
|
msgid "Sho&w Occupied Space"
|
|
msgstr "&Belegten Speicherplatz anzeigen"
|
|
|
|
#: tfrmmain.actcuttoclipboard.caption
|
|
msgid "Cu&t"
|
|
msgstr "A&usschneiden"
|
|
|
|
#: tfrmmain.actdebugshowcommandparameters.caption
|
|
msgid "Show Command Parameters"
|
|
msgstr "Zeige Befehlsparameter"
|
|
|
|
#: tfrmmain.actdelete.caption
|
|
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Löschen"
|
|
|
|
#: tfrmmain.actdeletesearches.caption
|
|
msgid "For all searches, cancel, close and free memory"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actdirhistory.caption
|
|
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
|
|
msgid "Directory history"
|
|
msgstr "Verzeichnisverlauf"
|
|
|
|
#: tfrmmain.actdirhotlist.caption
|
|
msgid "Directory &Hotlist"
|
|
msgstr "Verzeic&hnis-Favoriten"
|
|
|
|
#: tfrmmain.actdoanycmcommand.caption
|
|
msgid "Select any command and execute it"
|
|
msgstr "Einen Befehl wählen und ausführen"
|
|
|
|
#: tfrmmain.actedit.caption
|
|
msgctxt "tfrmmain.actedit.caption"
|
|
msgid "Edit"
|
|
msgstr "Bearbeiten"
|
|
|
|
#: tfrmmain.acteditcomment.caption
|
|
msgid "Edit Co&mment..."
|
|
msgstr "Ko&mmentar bearbeiten..."
|
|
|
|
#: tfrmmain.acteditnew.caption
|
|
msgid "Edit new file"
|
|
msgstr "Datei erstellen und bearbeiten"
|
|
|
|
#: tfrmmain.acteditpath.caption
|
|
msgid "Edit path field above file list"
|
|
msgstr "Pfad-Zeile über der Dateiliste bearbeiten"
|
|
|
|
#: tfrmmain.actexchange.caption
|
|
msgid "Swap &Panels"
|
|
msgstr "&Panels tauschen"
|
|
|
|
#: tfrmmain.actexecutescript.caption
|
|
msgid "Execute Script"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actexit.caption
|
|
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Beenden"
|
|
|
|
#: tfrmmain.actextractfiles.caption
|
|
msgid "&Extract Files..."
|
|
msgstr "E&ntpacke Dateien..."
|
|
|
|
#: tfrmmain.actfileassoc.caption
|
|
msgid "Configuration of File &Associations"
|
|
msgstr "Konfiguration von Dateiverkn&üpfungen"
|
|
|
|
#: tfrmmain.actfilelinker.caption
|
|
msgid "Com&bine Files..."
|
|
msgstr "&Verbinde Dateien..."
|
|
|
|
#: tfrmmain.actfileproperties.caption
|
|
msgid "Show &File Properties"
|
|
msgstr "Dateiei&genschaften anzeigen..."
|
|
|
|
#: tfrmmain.actfilespliter.caption
|
|
msgid "Spl&it File..."
|
|
msgstr "&Teile Datei..."
|
|
|
|
#: tfrmmain.actflatview.caption
|
|
msgid "&Flat view"
|
|
msgstr "\"&Flache\" Ansicht"
|
|
|
|
#: tfrmmain.actfocuscmdline.caption
|
|
msgid "Focus command line"
|
|
msgstr "Fokus auf die Befehlsze&ile"
|
|
|
|
#: tfrmmain.actfocusswap.caption
|
|
msgid "Swap focus"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actfocusswap.hint
|
|
msgid "Switch between left and right file list"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actgotofirstfile.caption
|
|
msgid "Place cursor on first file in list"
|
|
msgstr "Setze die Einfügemarke auf den ersten Eintrag der Liste"
|
|
|
|
#: tfrmmain.actgotolastfile.caption
|
|
msgid "Place cursor on last file in list"
|
|
msgstr "Setze die Einfügemarke auf den letzten Eintrag der Liste"
|
|
|
|
#: tfrmmain.acthardlink.caption
|
|
msgid "Create &Hard Link..."
|
|
msgstr "Erstelle &Hardlink..."
|
|
|
|
#: tfrmmain.acthelpindex.caption
|
|
msgid "&Contents"
|
|
msgstr "Hilfe &Index"
|
|
|
|
#: tfrmmain.acthorizontalfilepanels.caption
|
|
msgid "&Horizontal Panels Mode"
|
|
msgstr "&Horizontale Datei-Panel"
|
|
|
|
#: tfrmmain.actkeyboard.caption
|
|
msgid "&Keyboard"
|
|
msgstr "&Tastaturkürzel Index"
|
|
|
|
#: tfrmmain.actleftbriefview.caption
|
|
msgid "Brief view on left panel"
|
|
msgstr "Verkürzte Ansicht im linken Panel"
|
|
|
|
#: tfrmmain.actleftcolumnsview.caption
|
|
msgid "Columns view on left panel"
|
|
msgstr "Spaltenansicht im linken Panel"
|
|
|
|
#: tfrmmain.actleftequalright.caption
|
|
msgid "Left &= Right"
|
|
msgstr "Links &= Rechts"
|
|
|
|
#: tfrmmain.actleftflatview.caption
|
|
msgid "&Flat view on left panel"
|
|
msgstr "&Flache Ansicht im linken Panel"
|
|
|
|
#: tfrmmain.actleftopendrives.caption
|
|
msgid "Open left drive list"
|
|
msgstr "Öffne &linke Laufwerksliste"
|
|
|
|
#: tfrmmain.actleftreverseorder.caption
|
|
msgid "Re&verse order on left panel"
|
|
msgstr "Umgekehrte Reihenfolge im linken Panel"
|
|
|
|
#: tfrmmain.actleftsortbyattr.caption
|
|
msgid "Sort left panel by &Attributes"
|
|
msgstr "Linkes Panel nach &Attributen sortieren"
|
|
|
|
#: tfrmmain.actleftsortbydate.caption
|
|
msgid "Sort left panel by &Date"
|
|
msgstr "Linkes Panel nach &Datum sortieren"
|
|
|
|
#: tfrmmain.actleftsortbyext.caption
|
|
msgid "Sort left panel by &Extension"
|
|
msgstr "Linkes Panel nach &Dateiendung sortieren"
|
|
|
|
#: tfrmmain.actleftsortbyname.caption
|
|
msgid "Sort left panel by &Name"
|
|
msgstr "Linkes Panel nach &Namen sortieren"
|
|
|
|
#: tfrmmain.actleftsortbysize.caption
|
|
msgid "Sort left panel by &Size"
|
|
msgstr "Linkes Panel nach &Größe sortieren"
|
|
|
|
#: tfrmmain.actleftthumbview.caption
|
|
msgid "Thumbnails view on left panel"
|
|
msgstr "Thumbnails-Ansicht im linken Panel"
|
|
|
|
#: tfrmmain.actloadfavoritetabs.caption
|
|
msgid "Load tabs from Favorite Tabs"
|
|
msgstr "Tabs aus den Favoriten-Tabs laden"
|
|
|
|
#: tfrmmain.actloadselectionfromclip.caption
|
|
msgid "Load Selection from Clip&board"
|
|
msgstr "Auswahl aus der &Zwischenablage laden"
|
|
|
|
#: tfrmmain.actloadselectionfromfile.caption
|
|
msgid "&Load Selection from File..."
|
|
msgstr "Auswah&l aus Datei laden..."
|
|
|
|
#: tfrmmain.actloadtabs.caption
|
|
msgid "&Load Tabs from File"
|
|
msgstr "&Lade Tabs aus Datei"
|
|
|
|
#: tfrmmain.actmakedir.caption
|
|
msgid "Create &Directory"
|
|
msgstr "&Verzeichnis erstellen..."
|
|
|
|
#: tfrmmain.actmarkcurrentextension.caption
|
|
msgid "Select All with the Same E&xtension"
|
|
msgstr "Alle mit gleicher &Endung markieren"
|
|
|
|
#: tfrmmain.actmarkcurrentname.caption
|
|
msgid "Select all files with same name"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkcurrentnameext.caption
|
|
msgid "Select all files with same name and extension"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkcurrentpath.caption
|
|
msgid "Select all in same path"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkinvert.caption
|
|
msgid "&Invert Selection"
|
|
msgstr "Auswahl um&kehren"
|
|
|
|
#: tfrmmain.actmarkmarkall.caption
|
|
msgid "&Select All"
|
|
msgstr "Alle&s markieren"
|
|
|
|
#: tfrmmain.actmarkminus.caption
|
|
msgid "Unselect a Gro&up..."
|
|
msgstr "Gru&ppe abwählen..."
|
|
|
|
#: tfrmmain.actmarkplus.caption
|
|
msgid "Select a &Group..."
|
|
msgstr "&Gruppe markieren..."
|
|
|
|
#: tfrmmain.actmarkunmarkall.caption
|
|
msgid "&Unselect All"
|
|
msgstr "Alles a&bwählen"
|
|
|
|
#: tfrmmain.actminimize.caption
|
|
msgid "Minimize window"
|
|
msgstr "Fenster minimieren"
|
|
|
|
#: tfrmmain.actmultirename.caption
|
|
msgid "Multi &Rename Tool"
|
|
msgstr "Meh&rfaches umbenennen"
|
|
|
|
#: tfrmmain.actnetworkconnect.caption
|
|
msgid "Network &Connect..."
|
|
msgstr "Net&zwerk verbinden..."
|
|
|
|
#: tfrmmain.actnetworkdisconnect.caption
|
|
msgid "Network &Disconnect"
|
|
msgstr "Netzwerk &trennen"
|
|
|
|
#: tfrmmain.actnetworkquickconnect.caption
|
|
msgid "Network &Quick Connect..."
|
|
msgstr "Netzwerk schnell &verbinden..."
|
|
|
|
#: tfrmmain.actnewtab.caption
|
|
msgid "&New Tab"
|
|
msgstr "Ne&uer Tab"
|
|
|
|
#: tfrmmain.actnextfavoritetabs.caption
|
|
msgid "Load the Next Favorite Tabs in the list"
|
|
msgstr "Nächsten Tab aus der Liste laden"
|
|
|
|
#: tfrmmain.actnexttab.caption
|
|
msgid "Switch to Nex&t Tab"
|
|
msgstr "Zum n&ächsten Tab wechseln"
|
|
|
|
#: tfrmmain.actopen.caption
|
|
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
|
msgid "Open"
|
|
msgstr "Öffnen"
|
|
|
|
#: tfrmmain.actopenarchive.caption
|
|
msgid "Try open archive"
|
|
msgstr "Versuche Archiv zu öffnen"
|
|
|
|
#: tfrmmain.actopenbar.caption
|
|
msgid "Open bar file"
|
|
msgstr "Leisten-Datei öffnen"
|
|
|
|
#: tfrmmain.actopendirinnewtab.caption
|
|
msgid "Open &Folder in a New Tab"
|
|
msgstr "Verzeichnis in neue&m Tab öffnen"
|
|
|
|
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
|
msgid "Open &VFS List"
|
|
msgstr "Öffne &VFS-Liste"
|
|
|
|
#: tfrmmain.actoperationsviewer.caption
|
|
msgid "Operations &Viewer"
|
|
msgstr "Ablauf-&Betrachter"
|
|
|
|
#: tfrmmain.actoptions.caption
|
|
msgid "&Options..."
|
|
msgstr "&Optionen..."
|
|
|
|
#: tfrmmain.actpackfiles.caption
|
|
msgid "&Pack Files..."
|
|
msgstr "&Packe Dateien..."
|
|
|
|
#: tfrmmain.actpanelssplitterperpos.caption
|
|
msgid "Set splitter position"
|
|
msgstr "Position des Fenster-Teilers festlegen"
|
|
|
|
#: tfrmmain.actpastefromclipboard.caption
|
|
msgid "&Paste"
|
|
msgstr "Einf&ügen"
|
|
|
|
#: tfrmmain.actpreviousfavoritetabs.caption
|
|
msgid "Load the Previous Favorite Tabs in the list"
|
|
msgstr "Vorherigen Tab aus der Liste laden"
|
|
|
|
#: tfrmmain.actprevtab.caption
|
|
msgid "Switch to &Previous Tab"
|
|
msgstr "Zum v&orherigen Tab wechseln"
|
|
|
|
#: tfrmmain.actquickfilter.caption
|
|
msgid "Quick filter"
|
|
msgstr "Schneller Filter"
|
|
|
|
#: tfrmmain.actquicksearch.caption
|
|
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
|
|
msgid "Quick search"
|
|
msgstr "Schnelle Suche"
|
|
|
|
#: tfrmmain.actquickview.caption
|
|
msgid "&Quick View Panel"
|
|
msgstr "S&chnellansicht"
|
|
|
|
#: tfrmmain.actrefresh.caption
|
|
msgid "&Refresh"
|
|
msgstr "A&ktualisieren"
|
|
|
|
#: tfrmmain.actreloadfavoritetabs.caption
|
|
msgid "Reload the last Favorite Tabs loaded"
|
|
msgstr "Zuletzt geladenen Tab erneut öffnen"
|
|
|
|
#: tfrmmain.actrename.caption
|
|
msgctxt "tfrmmain.actrename.caption"
|
|
msgid "Move"
|
|
msgstr "Verschieben"
|
|
|
|
#: tfrmmain.actrenamenoask.caption
|
|
msgid "Move/Rename files without asking for confirmation"
|
|
msgstr "Verschieben / Umbenennen von Datei(en) ohne Nachfrage"
|
|
|
|
#: tfrmmain.actrenameonly.caption
|
|
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
|
|
msgid "Rename"
|
|
msgstr "Umbenennen"
|
|
|
|
#: tfrmmain.actrenametab.caption
|
|
msgid "&Rename Tab"
|
|
msgstr "&Tab umbenennen"
|
|
|
|
#: tfrmmain.actresavefavoritetabs.caption
|
|
msgid "Resave on the last Favorite Tabs loaded"
|
|
msgstr "Neu im letzten geladenen Favoriten-Tab speichern"
|
|
|
|
#: tfrmmain.actrestoreselection.caption
|
|
msgid "&Restore Selection"
|
|
msgstr "Auswahl w&iederherstellen"
|
|
|
|
#: tfrmmain.actreverseorder.caption
|
|
msgid "Re&verse Order"
|
|
msgstr "&Umgekehrt anordnen"
|
|
|
|
#: tfrmmain.actrightbriefview.caption
|
|
msgid "Brief view on right panel"
|
|
msgstr "Verkürzte Ansicht im rechten Panel"
|
|
|
|
#: tfrmmain.actrightcolumnsview.caption
|
|
msgid "Columns view on right panel"
|
|
msgstr "Spaltenansicht im rechten Panel"
|
|
|
|
#: tfrmmain.actrightequalleft.caption
|
|
msgid "Right &= Left"
|
|
msgstr "Rechts = L&inks"
|
|
|
|
#: tfrmmain.actrightflatview.caption
|
|
msgid "&Flat view on right panel"
|
|
msgstr "&Flache Ansicht im rechten Panel"
|
|
|
|
#: tfrmmain.actrightopendrives.caption
|
|
msgid "Open right drive list"
|
|
msgstr "Öffne rechte Laufwerksliste"
|
|
|
|
#: tfrmmain.actrightreverseorder.caption
|
|
msgid "Re&verse order on right panel"
|
|
msgstr "Umgekehrte Anordnung im rechten Panel"
|
|
|
|
#: tfrmmain.actrightsortbyattr.caption
|
|
msgid "Sort right panel by &Attributes"
|
|
msgstr "Rechtes Panel nach &Attributen sortieren"
|
|
|
|
#: tfrmmain.actrightsortbydate.caption
|
|
msgid "Sort right panel by &Date"
|
|
msgstr "Rechtes Panel nach &Datum sortieren"
|
|
|
|
#: tfrmmain.actrightsortbyext.caption
|
|
msgid "Sort right panel by &Extension"
|
|
msgstr "Rechtes Panel nach &Dateiendung sortieren"
|
|
|
|
#: tfrmmain.actrightsortbyname.caption
|
|
msgid "Sort right panel by &Name"
|
|
msgstr "Rechtes Panel nach &Namen sortieren"
|
|
|
|
#: tfrmmain.actrightsortbysize.caption
|
|
msgid "Sort right panel by &Size"
|
|
msgstr "Rechtes Panel nach &Größe sortieren "
|
|
|
|
#: tfrmmain.actrightthumbview.caption
|
|
msgid "Thumbnails view on right panel"
|
|
msgstr "Thumbnail-Ansicht im rechten Panel"
|
|
|
|
#: tfrmmain.actrunterm.caption
|
|
msgid "Run &Terminal"
|
|
msgstr "Konsolen-Fens&ter öffnen"
|
|
|
|
#: tfrmmain.actsavefavoritetabs.caption
|
|
msgid "Save current tabs to a New Favorite Tabs"
|
|
msgstr "Aktuellen Tab in neuen Favoriten-Tab speichern"
|
|
|
|
#: tfrmmain.actsaveselection.caption
|
|
msgid "Sa&ve Selection"
|
|
msgstr "Auswahl speiche&rn"
|
|
|
|
#: tfrmmain.actsaveselectiontofile.caption
|
|
msgid "Save S&election to File..."
|
|
msgstr "Auswa&hl in Datei speichern..."
|
|
|
|
#: tfrmmain.actsavetabs.caption
|
|
msgid "&Save Tabs to File"
|
|
msgstr "&Speichere Tabs in Datei"
|
|
|
|
#: tfrmmain.actsearch.caption
|
|
msgid "&Search..."
|
|
msgstr "&Suchen..."
|
|
|
|
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
|
msgid "All tabs Locked with Dir Opened in New Tabs"
|
|
msgstr "Alle gesperrten Tabs, in denen Verzeichnisse in neuen Tabs geöffnet werden"
|
|
|
|
#: tfrmmain.actsetalltabsoptionnormal.caption
|
|
msgid "Set all tabs to Normal"
|
|
msgstr "Alle Tabs in 'Normal' umwandeln"
|
|
|
|
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
|
msgid "Set all tabs to Locked"
|
|
msgstr "Alle Tabs in 'Gesperrt' umwandeln"
|
|
|
|
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
|
msgid "All tabs Locked with Dir Changes Allowed"
|
|
msgstr "Alle gesperrten Tabs, in denen Verzeichniswechsel erlaubt sind"
|
|
|
|
#: tfrmmain.actsetfileproperties.caption
|
|
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
|
|
msgid "Change &Attributes..."
|
|
msgstr "Eigensch&aften ändern..."
|
|
|
|
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
|
msgid "Locked with Directories Opened in New &Tabs"
|
|
msgstr "Gesperrt und Verzeichnisse in neuem Rei&ter öffnen"
|
|
|
|
#: tfrmmain.actsettaboptionnormal.caption
|
|
msgid "&Normal"
|
|
msgstr "&Normal"
|
|
|
|
#: tfrmmain.actsettaboptionpathlocked.caption
|
|
msgid "&Locked"
|
|
msgstr "&Gesperrt"
|
|
|
|
#: tfrmmain.actsettaboptionpathresets.caption
|
|
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
|
|
msgid "Locked with &Directory Changes Allowed"
|
|
msgstr "Gesperrt, aber &Verzeichniswechsel erlaubt"
|
|
|
|
#: tfrmmain.actshellexecute.caption
|
|
msgctxt "tfrmmain.actshellexecute.caption"
|
|
msgid "Open"
|
|
msgstr "Öffnen"
|
|
|
|
#: tfrmmain.actshellexecute.hint
|
|
msgid "Open using system associations"
|
|
msgstr "Öffnen anhand der System-eigenen Dateiverknüpfungen (außerhalb von Double Commander)"
|
|
|
|
#: tfrmmain.actshowbuttonmenu.caption
|
|
msgid "Show button menu"
|
|
msgstr "Button-Leiste anzeigen"
|
|
|
|
#: tfrmmain.actshowcmdlinehistory.caption
|
|
msgid "Show command line history"
|
|
msgstr "Befehlszeilenverlauf anzeigen"
|
|
|
|
#: tfrmmain.actshowmainmenu.caption
|
|
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
|
|
msgid "Menu"
|
|
msgstr "Menü"
|
|
|
|
#: tfrmmain.actshowsysfiles.caption
|
|
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
|
|
msgid "Show &Hidden/System Files"
|
|
msgstr "&Zeige versteckte und Systemdateien"
|
|
|
|
#: tfrmmain.actsortbyattr.caption
|
|
msgid "Sort by &Attributes"
|
|
msgstr "Nach &Attributen sortieren"
|
|
|
|
#: tfrmmain.actsortbydate.caption
|
|
msgid "Sort by &Date"
|
|
msgstr "Nach &Datum sortieren"
|
|
|
|
#: tfrmmain.actsortbyext.caption
|
|
msgid "Sort by &Extension"
|
|
msgstr "Nach &Endung sortieren"
|
|
|
|
#: tfrmmain.actsortbyname.caption
|
|
msgid "Sort by &Name"
|
|
msgstr "Nach &Name sortieren"
|
|
|
|
#: tfrmmain.actsortbysize.caption
|
|
msgid "Sort by &Size"
|
|
msgstr "Nach &Größe sortieren"
|
|
|
|
#: tfrmmain.actsrcopendrives.caption
|
|
msgid "Open drive list"
|
|
msgstr "Liste der Laufwerke öffnen"
|
|
|
|
#: tfrmmain.actswitchignorelist.caption
|
|
msgid "Enable/disable ignore list file to not show file names"
|
|
msgstr "De-/Aktivieren der Dateiliste um Dateinamen nicht anzuzeigen"
|
|
|
|
#: tfrmmain.actsymlink.caption
|
|
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
|
|
msgid "Create Symbolic &Link..."
|
|
msgstr "Erstelle symbolischen &Link..."
|
|
|
|
#: tfrmmain.actsyncdirs.caption
|
|
msgid "Synchronize dirs..."
|
|
msgstr "Sychronisiere Verzeichnisse..."
|
|
|
|
#: tfrmmain.acttargetequalsource.caption
|
|
msgid "Target &= Source"
|
|
msgstr "Ziel = &Quelle"
|
|
|
|
#: tfrmmain.acttestarchive.caption
|
|
msgid "&Test Archive(s)"
|
|
msgstr "Archiv(e) &testen"
|
|
|
|
#: tfrmmain.actthumbnailsview.caption
|
|
msgctxt "tfrmmain.actthumbnailsview.caption"
|
|
msgid "Thumbnails"
|
|
msgstr "Vorschaubilder"
|
|
|
|
#: tfrmmain.actthumbnailsview.hint
|
|
msgid "Thumbnails View"
|
|
msgstr "Vorschaubilder Ansicht"
|
|
|
|
#: tfrmmain.acttogglefullscreenconsole.caption
|
|
msgid "Toggle fullscreen mode console"
|
|
msgstr "Vollbild-Modus der Konsole umschalten"
|
|
|
|
#: tfrmmain.acttransferleft.caption
|
|
msgid "Transfer dir under cursor to left window"
|
|
msgstr "Bewege markierten &Ordner in das linke Fenster"
|
|
|
|
#: tfrmmain.acttransferright.caption
|
|
msgid "Transfer dir under cursor to right window"
|
|
msgstr "Bewege &markierten Ordner in das rechte Fenster"
|
|
|
|
#: tfrmmain.acttreeview.caption
|
|
msgid "&Tree View Panel"
|
|
msgstr "Baumansich&t-Panel"
|
|
|
|
#: tfrmmain.actuniversalsingledirectsort.caption
|
|
msgid "Sort according to parameters"
|
|
msgstr "Anhand von Parametern sortieren"
|
|
|
|
#: tfrmmain.actunmarkcurrentextension.caption
|
|
msgid "Unselect All with the Same Ex&tension"
|
|
msgstr "Alle mit der gleichen E&ndung abwählen"
|
|
|
|
#: tfrmmain.actunmarkcurrentname.caption
|
|
msgid "Unselect all files with same name"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actunmarkcurrentnameext.caption
|
|
msgid "Unselect all files with same name and extension"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actunmarkcurrentpath.caption
|
|
msgid "Unselect all in same path"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actview.caption
|
|
msgctxt "tfrmmain.actview.caption"
|
|
msgid "View"
|
|
msgstr "Betrachten"
|
|
|
|
#: tfrmmain.actviewhistory.caption
|
|
msgid "Show history of visited paths for active view"
|
|
msgstr "Zeige den Verlauf der geöffneten Verzeichnisse des aktiven Panels"
|
|
|
|
#: tfrmmain.actviewhistorynext.caption
|
|
msgid "Go to next entry in history"
|
|
msgstr "Gehe zum nächsten Eintrag in der Verlaufsliste"
|
|
|
|
#: tfrmmain.actviewhistoryprev.caption
|
|
msgid "Go to previous entry in history"
|
|
msgstr "Gehe zum vorherigen Eintrag in der Verlaufsliste"
|
|
|
|
#: tfrmmain.actviewlogfile.caption
|
|
msgid "View log file"
|
|
msgstr "Log-Datei betrachten"
|
|
|
|
#: tfrmmain.actviewsearches.caption
|
|
msgid "View current search instances"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actvisithomepage.caption
|
|
msgid "&Visit Double Commander Website"
|
|
msgstr "&Homepage von Double Commander öffnen"
|
|
|
|
#: tfrmmain.actwipe.caption
|
|
msgid "Wipe"
|
|
msgstr "Endgültig löschen"
|
|
|
|
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
|
msgid "Work with Directory Hotlist and parameters"
|
|
msgstr "Mit der Verzeichnis-Hotlist und Parametern arbeiten"
|
|
|
|
#: tfrmmain.btnf10.caption
|
|
msgctxt "tfrmmain.btnf10.caption"
|
|
msgid "Exit"
|
|
msgstr "Beenden"
|
|
|
|
#: tfrmmain.btnf7.caption
|
|
msgctxt "tfrmmain.btnf7.caption"
|
|
msgid "Directory"
|
|
msgstr "Verzeichnis"
|
|
|
|
#: tfrmmain.btnf8.caption
|
|
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Löschen"
|
|
|
|
#: tfrmmain.btnf9.caption
|
|
msgctxt "tfrmmain.btnf9.caption"
|
|
msgid "Terminal"
|
|
msgstr "Terminal"
|
|
|
|
#: tfrmmain.btnleftdirectoryhotlist.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
|
msgid "*"
|
|
msgstr "*"
|
|
|
|
#: tfrmmain.btnleftdirectoryhotlist.hint
|
|
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Favoriten für Verzeichnisse"
|
|
|
|
#: tfrmmain.btnleftequalright.caption
|
|
msgctxt "tfrmmain.btnleftequalright.caption"
|
|
msgid "<"
|
|
msgstr "<"
|
|
|
|
#: tfrmmain.btnleftequalright.hint
|
|
msgid "Show current directory of the right panel in the left panel"
|
|
msgstr "Aktuelles Verzeichnis der rechten Seite auch auf der linken Seite anzeigen"
|
|
|
|
#: tfrmmain.btnlefthome.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
|
|
msgid "~"
|
|
msgstr "~"
|
|
|
|
#: tfrmmain.btnlefthome.hint
|
|
msgid "Go to home directory"
|
|
msgstr "zu Benutzerverzeichnis wechseln"
|
|
|
|
#: tfrmmain.btnleftroot.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
|
|
msgid "/"
|
|
msgstr "/"
|
|
|
|
#: tfrmmain.btnleftroot.hint
|
|
msgid "Go to root directory"
|
|
msgstr "Zum Root-Verzeichnis wechseln"
|
|
|
|
#: tfrmmain.btnleftup.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
|
|
msgid ".."
|
|
msgstr ".."
|
|
|
|
#: tfrmmain.btnleftup.hint
|
|
msgid "Go to parent directory"
|
|
msgstr "Zum übergeordneten Verzeichnis wechseln"
|
|
|
|
#: tfrmmain.btnrightdirectoryhotlist.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
|
msgid "*"
|
|
msgstr "*"
|
|
|
|
#: tfrmmain.btnrightdirectoryhotlist.hint
|
|
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Verzeichnis-Hotlist"
|
|
|
|
#: tfrmmain.btnrightequalleft.caption
|
|
msgctxt "tfrmmain.btnrightequalleft.caption"
|
|
msgid ">"
|
|
msgstr ">"
|
|
|
|
#: tfrmmain.btnrightequalleft.hint
|
|
msgid "Show current directory of the left panel in the right panel"
|
|
msgstr "Aktuelles Verzeichnis der linken Seite auch auf der rechten Seite anzeigen"
|
|
|
|
#: tfrmmain.btnrighthome.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
|
msgid "~"
|
|
msgstr "~"
|
|
|
|
#: tfrmmain.btnrightroot.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
|
msgid "/"
|
|
msgstr "/"
|
|
|
|
#: tfrmmain.btnrightup.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
|
msgid ".."
|
|
msgstr ".."
|
|
|
|
#: tfrmmain.caption
|
|
msgctxt "tfrmmain.caption"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmmain.lblcommandpath.caption
|
|
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
|
|
msgid "Path"
|
|
msgstr "Pfad"
|
|
|
|
#: tfrmmain.menuitem2.caption
|
|
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.mi2080.caption
|
|
msgid "&20/80"
|
|
msgstr "&20/80"
|
|
|
|
#: tfrmmain.mi3070.caption
|
|
msgid "&30/70"
|
|
msgstr "&30/70"
|
|
|
|
#: tfrmmain.mi4060.caption
|
|
msgid "&40/60"
|
|
msgstr "&40/60"
|
|
|
|
#: tfrmmain.mi5050.caption
|
|
msgid "&50/50"
|
|
msgstr "&50/50"
|
|
|
|
#: tfrmmain.mi6040.caption
|
|
msgid "&60/40"
|
|
msgstr "&60/40"
|
|
|
|
#: tfrmmain.mi7030.caption
|
|
msgid "&70/30"
|
|
msgstr "&70/30"
|
|
|
|
#: tfrmmain.mi8020.caption
|
|
msgid "&80/20"
|
|
msgstr "&80/20"
|
|
|
|
#: tfrmmain.micancel.caption
|
|
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Abbrechen"
|
|
|
|
#: tfrmmain.micopy.caption
|
|
msgid "Copy..."
|
|
msgstr "Kopiere..."
|
|
|
|
#: tfrmmain.mihardlink.caption
|
|
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
|
|
msgid "Create link..."
|
|
msgstr "Hardlink erstellen..."
|
|
|
|
#: tfrmmain.miline1.caption
|
|
msgctxt "TFRMMAIN.MILINE1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline10.caption
|
|
msgctxt "tfrmmain.miline10.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline11.caption
|
|
msgctxt "tfrmmain.miline11.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline12.caption
|
|
msgctxt "TFRMMAIN.MILINE12.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline13.caption
|
|
msgctxt "TFRMMAIN.MILINE13.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline14.caption
|
|
msgctxt "TFRMMAIN.MILINE14.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline15.caption
|
|
msgctxt "TFRMMAIN.MILINE15.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline16.caption
|
|
msgctxt "TFRMMAIN.MILINE16.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline17.caption
|
|
msgctxt "TFRMMAIN.MILINE17.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline18.caption
|
|
msgctxt "TFRMMAIN.MILINE18.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline19.caption
|
|
msgctxt "TFRMMAIN.MILINE19.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline2.caption
|
|
msgctxt "TFRMMAIN.MILINE2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline20.caption
|
|
msgctxt "TFRMMAIN.MILINE20.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline21.caption
|
|
msgctxt "tfrmmain.miline21.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline22.caption
|
|
msgctxt "TFRMMAIN.MILINE22.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline23.caption
|
|
msgctxt "tfrmmain.miline23.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline24.caption
|
|
msgctxt "TFRMMAIN.MILINE24.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline25.caption
|
|
msgctxt "TFRMMAIN.MILINE25.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline26.caption
|
|
msgctxt "tfrmmain.miline26.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline3.caption
|
|
msgctxt "TFRMMAIN.MILINE3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline32.caption
|
|
msgctxt "TFRMMAIN.MILINE32.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline33.caption
|
|
msgctxt "tfrmmain.miline33.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline37.caption
|
|
msgctxt "TFRMMAIN.MILINE37.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline38.caption
|
|
msgctxt "tfrmmain.miline38.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline39.caption
|
|
msgctxt "tfrmmain.miline39.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline4.caption
|
|
msgctxt "TFRMMAIN.MILINE4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline40.caption
|
|
msgctxt "tfrmmain.miline40.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline47.caption
|
|
msgctxt "TFRMMAIN.MILINE47.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline5.caption
|
|
msgctxt "TFRMMAIN.MILINE5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline50.caption
|
|
msgctxt "tfrmmain.miline50.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline55.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmain.miline55.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline6.caption
|
|
msgctxt "TFRMMAIN.MILINE6.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline7.caption
|
|
msgctxt "TFRMMAIN.MILINE7.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline8.caption
|
|
msgctxt "TFRMMAIN.MILINE8.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.miline9.caption
|
|
msgctxt "TFRMMAIN.MILINE9.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.milogclear.caption
|
|
msgid "Clear"
|
|
msgstr "Leeren"
|
|
|
|
#: tfrmmain.milogcopy.caption
|
|
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmmain.miloghide.caption
|
|
msgid "Hide"
|
|
msgstr "Verstecken"
|
|
|
|
#: tfrmmain.milogselectall.caption
|
|
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
|
msgid "Select All"
|
|
msgstr "Alle mar&kieren"
|
|
|
|
#: tfrmmain.mimove.caption
|
|
msgid "Move..."
|
|
msgstr "Verschiebe..."
|
|
|
|
#: tfrmmain.misymlink.caption
|
|
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
|
|
msgid "Create symlink..."
|
|
msgstr "Erstelle symbolischen Link"
|
|
|
|
#: tfrmmain.mitaboptions.caption
|
|
msgid "Tab options"
|
|
msgstr "Tab-Optionen"
|
|
|
|
#: tfrmmain.mitrayiconexit.caption
|
|
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Beenden"
|
|
|
|
#: tfrmmain.mitrayiconrestore.caption
|
|
msgid "Restore"
|
|
msgstr "Wiederherstellen"
|
|
|
|
#: tfrmmain.mnualloperpause.caption
|
|
msgctxt "tfrmmain.mnualloperpause.caption"
|
|
msgid "||"
|
|
msgstr "||"
|
|
|
|
#: tfrmmain.mnualloperstart.caption
|
|
msgctxt "tfrmmain.mnualloperstart.caption"
|
|
msgid "Start"
|
|
msgstr "Start"
|
|
|
|
#: tfrmmain.mnualloperstop.caption
|
|
msgctxt "tfrmmain.mnualloperstop.caption"
|
|
msgid "Cancel"
|
|
msgstr "Abbrechen"
|
|
|
|
#: tfrmmain.mnucmd.caption
|
|
msgid "&Commands"
|
|
msgstr "&Befehle"
|
|
|
|
#: tfrmmain.mnuconfig.caption
|
|
msgid "C&onfiguration"
|
|
msgstr "K&onfigurieren"
|
|
|
|
#: tfrmmain.mnucontextline1.caption
|
|
msgctxt "tfrmmain.mnucontextline1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.mnucontextline2.caption
|
|
msgctxt "tfrmmain.mnucontextline2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmain.mnufavoritetabs.caption
|
|
msgid "Favorites"
|
|
msgstr "&Favoriten"
|
|
|
|
#: tfrmmain.mnufiles.caption
|
|
msgid "&Files"
|
|
msgstr "&Dateien"
|
|
|
|
#: tfrmmain.mnuhelp.caption
|
|
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "&Hilfe"
|
|
|
|
#: tfrmmain.mnumark.caption
|
|
msgid "&Mark"
|
|
msgstr "&Markieren"
|
|
|
|
#: tfrmmain.mnunetwork.caption
|
|
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
|
|
msgid "Network"
|
|
msgstr "&Netzwerk"
|
|
|
|
#: tfrmmain.mnushow.caption
|
|
msgid "&Show"
|
|
msgstr "&Anzeigen"
|
|
|
|
#: tfrmmain.mnutaboptions.caption
|
|
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
|
|
msgid "Tab &Options"
|
|
msgstr "Tab &Optionen..."
|
|
|
|
#: tfrmmain.mnutabs.caption
|
|
msgid "&Tabs"
|
|
msgstr "&Tabs"
|
|
|
|
#: tfrmmain.tbchangedir.caption
|
|
msgid "CD"
|
|
msgstr "Verzeichnis-Wechsel"
|
|
|
|
#: tfrmmain.tbcopy.caption
|
|
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmmain.tbcut.caption
|
|
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Ausschneiden"
|
|
|
|
#: tfrmmain.tbdelete.caption
|
|
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmmain.tbedit.caption
|
|
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
|
msgid "Edit"
|
|
msgstr "Bea&rbeiten"
|
|
|
|
#: tfrmmain.tbpaste.caption
|
|
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Einfügen"
|
|
|
|
#: tfrmmain.tbseparator.caption
|
|
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmaincommandsdlg.btncancel.caption
|
|
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmmaincommandsdlg.btnok.caption
|
|
msgctxt "tfrmmaincommandsdlg.btnok.caption"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmmaincommandsdlg.caption
|
|
msgid "Select your internal command"
|
|
msgstr "Internen Befehl auswählen"
|
|
|
|
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
|
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
|
msgid "Legacy sorted"
|
|
msgstr "Auf alte Art sortiert"
|
|
|
|
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
|
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
|
|
msgid "Legacy sorted"
|
|
msgstr "Auf alte Art sortiert"
|
|
|
|
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
|
msgid "Select all categories by default"
|
|
msgstr "Alle Kategorien nach Standard sortieren"
|
|
|
|
#: tfrmmaincommandsdlg.gbselection.caption
|
|
msgid "Selection:"
|
|
msgstr "Auswahl:"
|
|
|
|
#: tfrmmaincommandsdlg.lblcategory.caption
|
|
msgid "&Categories:"
|
|
msgstr "Kategorien:"
|
|
|
|
#: tfrmmaincommandsdlg.lblcommandname.caption
|
|
msgid "Command &name:"
|
|
msgstr "Befehls&name:"
|
|
|
|
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
|
msgid "&Filter:"
|
|
msgstr "&Filter:"
|
|
|
|
#: tfrmmaincommandsdlg.lblhint.caption
|
|
msgid "Hint:"
|
|
msgstr "Hinweis:"
|
|
|
|
#: tfrmmaincommandsdlg.lblhotkey.caption
|
|
msgid "Hotkey:"
|
|
msgstr "Tastaturkürzel:"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
|
msgid "cm_name"
|
|
msgstr ""
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
|
msgid "Category"
|
|
msgstr "Kategorie"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
|
msgid "Help"
|
|
msgstr "Hilfe"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
|
msgid "Hint"
|
|
msgstr "Hinweis"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
|
msgid "Hotkey"
|
|
msgstr "Tastaturkürzel"
|
|
|
|
#: tfrmmaskinputdlg.btnaddattribute.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmmaskinputdlg.btnattrshelp.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
|
|
msgid "&Help"
|
|
msgstr "&Hilfe"
|
|
|
|
#: tfrmmaskinputdlg.btncancel.caption
|
|
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
|
msgid "&Define..."
|
|
msgstr "&Definieren..."
|
|
|
|
#: tfrmmaskinputdlg.btnok.caption
|
|
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
|
msgid "Case sensitive"
|
|
msgstr "Abhängig von der Schreibweise"
|
|
|
|
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
|
msgid "Ignore accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmmaskinputdlg.lblattributes.caption
|
|
msgid "Attri&butes:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaskinputdlg.lblprompt.caption
|
|
msgid "Input Mask:"
|
|
msgstr "Eingabemaske:"
|
|
|
|
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
|
msgid "O&r select predefined selection type:"
|
|
msgstr "Ode&r vordefinierten Auswahltyp wählen:"
|
|
|
|
#: tfrmmkdir.btncancel.caption
|
|
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmmkdir.btnok.caption
|
|
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmmkdir.caption
|
|
msgid "Create new directory"
|
|
msgstr "Neues Verzeichnis anlegen"
|
|
|
|
#: tfrmmkdir.lblmakedir.caption
|
|
msgid "&Input new directory name:"
|
|
msgstr "Namen für neues Verze&ichnis eingeben"
|
|
|
|
#: tfrmmodview.btnpath1.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath2.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath3.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath4.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath5.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.caption
|
|
msgctxt "TFRMMODVIEW.CAPTION"
|
|
msgid "New Size"
|
|
msgstr "Neue Größe"
|
|
|
|
#: tfrmmodview.lblheight.caption
|
|
msgid "Height :"
|
|
msgstr "Höhe :"
|
|
|
|
#: tfrmmodview.lblpath1.caption
|
|
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmodview.lblpath2.caption
|
|
msgid "2"
|
|
msgstr "2"
|
|
|
|
#: tfrmmodview.lblpath3.caption
|
|
msgid "3"
|
|
msgstr "3"
|
|
|
|
#: tfrmmodview.lblpath4.caption
|
|
msgid "4"
|
|
msgstr "4"
|
|
|
|
#: tfrmmodview.lblpath5.caption
|
|
msgid "5"
|
|
msgstr "5"
|
|
|
|
#: tfrmmodview.lblquality.caption
|
|
msgid "Quality of compress to Jpg"
|
|
msgstr "Kompressions-Qualität für Jpg"
|
|
|
|
#: tfrmmodview.lblwidth.caption
|
|
msgid "Width :"
|
|
msgstr "Breite :"
|
|
|
|
#: tfrmmodview.rbbmp.caption
|
|
msgid "BMP"
|
|
msgstr "BMP"
|
|
|
|
#: tfrmmodview.rbico.caption
|
|
msgid "ICO"
|
|
msgstr "ICO"
|
|
|
|
#: tfrmmodview.rbjpg.caption
|
|
msgid "JPG"
|
|
msgstr "JPG"
|
|
|
|
#: tfrmmodview.rbpng.caption
|
|
msgid "PNG"
|
|
msgstr "PNG"
|
|
|
|
#: tfrmmodview.rbpnm.caption
|
|
msgid "PNM"
|
|
msgstr "PNM"
|
|
|
|
#: tfrmmodview.teheight.text
|
|
msgctxt "tfrmmodview.teheight.text"
|
|
msgid "Height"
|
|
msgstr "Höhe"
|
|
|
|
#: tfrmmodview.tequality.text
|
|
msgid "80"
|
|
msgstr "80"
|
|
|
|
#: tfrmmodview.tewidth.text
|
|
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
|
|
msgid "Width"
|
|
msgstr "Breite"
|
|
|
|
#: tfrmmsg.lblmsg.caption
|
|
msgid "456456465465465"
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.btnclose.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmmultirename.btndeletepreset.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "L&öschen"
|
|
|
|
#: tfrmmultirename.btnedit.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmultirename.btnedit.caption"
|
|
msgid "&Edit"
|
|
msgstr "B&earbeiten"
|
|
|
|
#: tfrmmultirename.btnextmenu.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmultirename.btnloadpreset.caption
|
|
msgid "&Load"
|
|
msgstr "&Laden"
|
|
|
|
#: tfrmmultirename.btnnamemenu.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmultirename.btnrename.caption
|
|
msgctxt "tfrmmultirename.btnrename.caption"
|
|
msgid "&Rename"
|
|
msgstr "&Umbenennen"
|
|
|
|
#: tfrmmultirename.btnrestore.caption
|
|
msgid "Reset &all"
|
|
msgstr "&Alles zurücksetzen"
|
|
|
|
#: tfrmmultirename.btnsavepreset.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
|
msgid "&Save"
|
|
msgstr "&Speichern"
|
|
|
|
#: tfrmmultirename.caption
|
|
msgctxt "tfrmmultirename.caption"
|
|
msgid "MultiRename"
|
|
msgstr "Mehrfaches Umbenennen"
|
|
|
|
#: tfrmmultirename.cblog.caption
|
|
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
|
|
msgid "Ena&ble"
|
|
msgstr "Akti&vieren"
|
|
|
|
#: tfrmmultirename.cbregexp.caption
|
|
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
|
|
msgid "Regular e&xpressions"
|
|
msgstr "&Reguläre Ausdrücke"
|
|
|
|
#: tfrmmultirename.cbusesubs.caption
|
|
msgid "&Use substitution"
|
|
msgstr "N&utze Ersetzung"
|
|
|
|
#: tfrmmultirename.cmbxwidth.text
|
|
msgid "01"
|
|
msgstr "01"
|
|
|
|
#: tfrmmultirename.edinterval.text
|
|
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmultirename.edpoc.text
|
|
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmultirename.extension.caption
|
|
msgid "[E] Extension"
|
|
msgstr "[E]ndung"
|
|
|
|
#: tfrmmultirename.gbcounter.caption
|
|
msgid "Counter"
|
|
msgstr "Zähler"
|
|
|
|
#: tfrmmultirename.gbfindreplace.caption
|
|
msgid "Find && Replace"
|
|
msgstr "Suchen und e&rsetzen"
|
|
|
|
#: tfrmmultirename.gblog.caption
|
|
msgid "Log Result"
|
|
msgstr "Log-Ergebnis"
|
|
|
|
#: tfrmmultirename.gbmaska.caption
|
|
msgid "Mask"
|
|
msgstr "Maske"
|
|
|
|
#: tfrmmultirename.gbpresets.caption
|
|
msgid "Presets"
|
|
msgstr "Vorgaben"
|
|
|
|
#: tfrmmultirename.lbext.caption
|
|
msgid "&Extension"
|
|
msgstr "&Endung"
|
|
|
|
#: tfrmmultirename.lbfind.caption
|
|
msgid "&Find..."
|
|
msgstr "Su&che..."
|
|
|
|
#: tfrmmultirename.lbinterval.caption
|
|
msgid "&Interval"
|
|
msgstr "&Interval"
|
|
|
|
#: tfrmmultirename.lbname.caption
|
|
msgid "File &Name"
|
|
msgstr "Datei&name"
|
|
|
|
#: tfrmmultirename.lbreplace.caption
|
|
msgid "Re&place..."
|
|
msgstr "Er&setze..."
|
|
|
|
#: tfrmmultirename.lbstnb.caption
|
|
msgid "S&tart Number"
|
|
msgstr "S&tarten bei"
|
|
|
|
#: tfrmmultirename.lbwidth.caption
|
|
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
|
|
msgid "&Width"
|
|
msgstr "&Breite"
|
|
|
|
#: tfrmmultirename.micounter.caption
|
|
msgid "[C] Counter"
|
|
msgstr "[C] Zählweise"
|
|
|
|
#: tfrmmultirename.miday.caption
|
|
msgid "[D] Day"
|
|
msgstr "[D] Tag"
|
|
|
|
#: tfrmmultirename.miday1.caption
|
|
msgid "[DD] Day (2 digits)"
|
|
msgstr "[DD] Tag (zweistellig)"
|
|
|
|
#: tfrmmultirename.miday2.caption
|
|
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
|
msgstr "[DDD] Tag der Woche (kurz, z. B. \"Mo\")"
|
|
|
|
#: tfrmmultirename.miday3.caption
|
|
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
|
msgstr "[DDDD] Tag der Woche (lang, z. B. \"Montag\")"
|
|
|
|
#: tfrmmultirename.miextensionx.caption
|
|
msgid "[Ex] Character at position x"
|
|
msgstr "[Ex]Bezeichnung an Position x"
|
|
|
|
#: tfrmmultirename.miextensionxx.caption
|
|
msgid "[Ex:y] Characters from position x to y"
|
|
msgstr "[Ex:y]Bezeichnung von Positionx bis y"
|
|
|
|
#: tfrmmultirename.mihour.caption
|
|
msgid "[h] Hour"
|
|
msgstr "[h] Stunde"
|
|
|
|
#: tfrmmultirename.mihour1.caption
|
|
msgid "[hh] Hour (2 digits)"
|
|
msgstr "[hh] Stunde (zweistellig)"
|
|
|
|
#: tfrmmultirename.miminute.caption
|
|
msgid "[n] Minute"
|
|
msgstr "[n] Minute"
|
|
|
|
#: tfrmmultirename.miminute1.caption
|
|
msgid "[nn] Minute (2 digits)"
|
|
msgstr "[nn] Minute (zweistellig)"
|
|
|
|
#: tfrmmultirename.mimonth.caption
|
|
msgid "[M] Month"
|
|
msgstr "[M] Monat"
|
|
|
|
#: tfrmmultirename.mimonth1.caption
|
|
msgid "[MM] Month (2 digits)"
|
|
msgstr "[MM] Monat (zweistellig)"
|
|
|
|
#: tfrmmultirename.mimonth2.caption
|
|
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
|
msgstr "[MMM] Monatsname (kurz, z. B. \"Jan\")"
|
|
|
|
#: tfrmmultirename.mimonth3.caption
|
|
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
|
msgstr "[MMMM] Monatsname (lang, z. B. \"Januar\")"
|
|
|
|
#: tfrmmultirename.miname.caption
|
|
msgid "[N] Name"
|
|
msgstr "[N] Name"
|
|
|
|
#: tfrmmultirename.minamex.caption
|
|
msgid "[Nx] Character at position x"
|
|
msgstr "[Nx] Bezeichnung an Position x"
|
|
|
|
#: tfrmmultirename.minamexx.caption
|
|
msgid "[Nx:y] Characters from position x to y"
|
|
msgstr "[Nx:y] Bezeichnung von Position x bis y"
|
|
|
|
#: tfrmmultirename.minext.caption
|
|
msgid "Time..."
|
|
msgstr "Zeit..."
|
|
|
|
#: tfrmmultirename.minextextension.caption
|
|
msgid "Extension..."
|
|
msgstr "Endung..."
|
|
|
|
#: tfrmmultirename.minextname.caption
|
|
msgid "Name..."
|
|
msgstr "Name..."
|
|
|
|
#: tfrmmultirename.miplugin.caption
|
|
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
|
|
msgid "Plugin"
|
|
msgstr "Plugin"
|
|
|
|
#: tfrmmultirename.misecond.caption
|
|
msgid "[s] Second"
|
|
msgstr "[S] Sekunde"
|
|
|
|
#: tfrmmultirename.misecond1.caption
|
|
msgid "[ss] Second (2 digits)"
|
|
msgstr "[ss] Sekunde (zweistellig)"
|
|
|
|
#: tfrmmultirename.miyear.caption
|
|
msgid "[Y] Year (2 digits)"
|
|
msgstr "[Y] Jahr (zweistellig)"
|
|
|
|
#: tfrmmultirename.miyear1.caption
|
|
msgid "[YYYY] Year (4 digits)"
|
|
msgstr "[YYYY] Jahr (vierstellig)"
|
|
|
|
#: tfrmmultirename.mnueditnames.caption
|
|
msgid "Edit names..."
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.mnuloadfromfile.caption
|
|
msgid "Load names from file..."
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.n1.caption
|
|
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n2.caption
|
|
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n3.caption
|
|
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n4.caption
|
|
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n5.caption
|
|
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
|
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
|
|
msgid "Old File Name"
|
|
msgstr "Vorheriger Dateiname"
|
|
|
|
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
|
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
|
|
msgid "New File Name"
|
|
msgstr "Neuer Dateiname"
|
|
|
|
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
|
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
|
|
msgid "File Path"
|
|
msgstr "Dateipfad"
|
|
|
|
#: tfrmmultirenamewait.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmultirenamewait.caption"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmmultirenamewait.lblmessage.caption
|
|
msgid "Click OK when you have closed the editor to load the changed names!"
|
|
msgstr ""
|
|
|
|
#: tfrmopenwith.caption
|
|
msgid "Choose an application"
|
|
msgstr "Anwendung auswählen"
|
|
|
|
#: tfrmopenwith.chkcustomcommand.caption
|
|
msgid "Custom command"
|
|
msgstr "Angepasster Befehl"
|
|
|
|
#: tfrmopenwith.chksaveassociation.caption
|
|
msgid "Save association"
|
|
msgstr "Verknüpfung speichern"
|
|
|
|
#: tfrmopenwith.chkuseasdefault.caption
|
|
msgid "Set selected application as default action"
|
|
msgstr "Gewählte Aktion als Standard festlegen"
|
|
|
|
#: tfrmopenwith.lblmimetype.caption
|
|
msgid "File type to be opened: %s"
|
|
msgstr "Dateityp zum Öffnen: %s"
|
|
|
|
#: tfrmopenwith.milistoffiles.caption
|
|
msgid "Multiple file names"
|
|
msgstr "Mehrere Dateinamen"
|
|
|
|
#: tfrmopenwith.milistoffiles.hint
|
|
msgid "%F"
|
|
msgstr ""
|
|
|
|
#: tfrmopenwith.milistofurls.caption
|
|
msgid "Multiple URIs"
|
|
msgstr "Mehrere URL"
|
|
|
|
#: tfrmopenwith.milistofurls.hint
|
|
msgid "%U"
|
|
msgstr ""
|
|
|
|
#: tfrmopenwith.misinglefilename.caption
|
|
msgid "Single file name"
|
|
msgstr "Einzelner Dateiname"
|
|
|
|
#: tfrmopenwith.misinglefilename.hint
|
|
msgid "%f"
|
|
msgstr ""
|
|
|
|
#: tfrmopenwith.misingleurl.caption
|
|
msgid "Single URI"
|
|
msgstr "Einzelne URL"
|
|
|
|
#: tfrmopenwith.misingleurl.hint
|
|
msgid "%u"
|
|
msgstr ""
|
|
|
|
#: tfrmoptions.btnapply.caption
|
|
msgid "&Apply"
|
|
msgstr "&Übernehmen"
|
|
|
|
#: tfrmoptions.btncancel.caption
|
|
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmoptions.btnok.caption
|
|
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmoptions.caption
|
|
msgctxt "tfrmoptions.caption"
|
|
msgid "Options"
|
|
msgstr "Optionen"
|
|
|
|
#: tfrmoptions.lblemptyeditor.caption
|
|
msgid "Please select one of the subpages, this page does not contain any settings."
|
|
msgstr "Bitte eine der Unterseiten auswählen, diese Seite hier enthält keine Einstellmöglichkeiten."
|
|
|
|
#: tfrmoptionsarchivers.btnautoconfig.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.BTNAUTOCONFIG.CAPTION"
|
|
msgid "A&uto Configure"
|
|
msgstr "A&uto-Konfiguration"
|
|
|
|
#: tfrmoptionsarchivers.btnmultiarcadd.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmoptionsarchivers.btnmultiarcapply.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCAPPLY.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "&Übernehmen"
|
|
|
|
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCDELETE.CAPTION"
|
|
msgid "D&elete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmoptionsarchivers.btnmultiarcrename.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
|
|
msgid "&Rename"
|
|
msgstr "&Umbenennen"
|
|
|
|
#: tfrmoptionsarchivers.btnrelativearchiver.hint
|
|
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCDEBUG.CAPTION"
|
|
msgid "De&bug mode"
|
|
msgstr "De&bug-Modus"
|
|
|
|
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
|
|
msgid "E&nabled"
|
|
msgstr "A&ktiviert"
|
|
|
|
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCOUTPUT.CAPTION"
|
|
msgid "S&how console output"
|
|
msgstr "&Zeige die Ausgabe des Konsolenfensters"
|
|
|
|
#: tfrmoptionsarchivers.gbarchiveroptions.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
|
|
msgid "Options"
|
|
msgstr "Optionen"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveadd.caption
|
|
msgid "Add&ing:"
|
|
msgstr "H&inzufügen:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveextension.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTENSION.CAPTION"
|
|
msgid "E&xtension:"
|
|
msgstr "&Endung:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveextract.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTRACT.CAPTION"
|
|
msgid "Ex&tract:"
|
|
msgstr "En&tpacken:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchivelist.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELIST.CAPTION"
|
|
msgid "&List:"
|
|
msgstr "&Liste:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchivelistend.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTEND.CAPTION"
|
|
msgid "Listing &finish (optional):"
|
|
msgstr "Aufli&stungsende (optional):"
|
|
|
|
#: tfrmoptionsarchivers.lblarchivelistformat.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTFORMAT.CAPTION"
|
|
msgid "Listing for&mat:"
|
|
msgstr "Auflistungsfor&mat"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveliststart.caption
|
|
msgid "Listin&g start (optional):"
|
|
msgstr "Auflistun&gsbeginn (optional):"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiver.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVER.CAPTION"
|
|
msgid "Arc&hiver:"
|
|
msgstr "Arc&hivierer:"
|
|
|
|
#: tfrmoptionsarchivers.lbldescription.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.LBLDESCRIPTION.CAPTION"
|
|
msgid "De&scription:"
|
|
msgstr "Be&schreibung:"
|
|
|
|
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
|
|
msgid "Additional"
|
|
msgstr "Zusätzlich"
|
|
|
|
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
|
|
msgid "General"
|
|
msgstr "Allgemein"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
|
msgid "When &size, date or attributes change"
|
|
msgstr "wenn &Größe, Datum oder Attribute geändert werden"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
|
|
msgid "For the following &paths and their subdirectories:"
|
|
msgstr "Für die &folgenden Pfade und Unterverzeichnisse:"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
|
msgid "When &files are created, deleted or renamed"
|
|
msgstr "wenn Dateien erstellt, gelöscht oder umbenannt werden"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
|
msgid "When application is in the &background"
|
|
msgstr "Wenn die Anwendung im Hintergrund läuft"
|
|
|
|
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
|
msgid "Disable auto-refresh"
|
|
msgstr "Kein automatisches Auffrischen"
|
|
|
|
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
|
msgid "Refresh file list"
|
|
msgstr "Dateiliste auffrischen"
|
|
|
|
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
|
msgid "Al&ways show tray icon"
|
|
msgstr "Tray-Icon &immer anzeigen"
|
|
|
|
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
|
msgid "Automatically &hide unmounted devices"
|
|
msgstr "nicht mehr eingehängte Laufwerke automatisc&h ausblenden (Linux: unmounted)"
|
|
|
|
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
|
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
|
|
msgid "Mo&ve icon to system tray when minimized"
|
|
msgstr "In den Sys-Tray minimieren"
|
|
|
|
#: tfrmoptionsbehavior.cbonlyonce.caption
|
|
msgid "A&llow only one copy of DC at a time"
|
|
msgstr "Nur eine Instanz von Doub&le Commander gleichzeitig erlauben"
|
|
|
|
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
|
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
|
msgstr "Hier können ein oder mehrere Laufwerke oder Mount_Points angegeben werden, die so getrennt werden müssen \";\"."
|
|
|
|
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
|
msgid "Drives &blacklist"
|
|
msgstr "A&usschlussliste für Laufwerke"
|
|
|
|
#: tfrmoptionsbriefview.gbcolumns.caption
|
|
msgid "Columns size"
|
|
msgstr "Spaltenweite"
|
|
|
|
#: tfrmoptionsbriefview.gbshowfileext.caption
|
|
msgid "Show file extensions"
|
|
msgstr "Zeige Dateiendungen"
|
|
|
|
#: tfrmoptionsbriefview.rbaligned.caption
|
|
msgid "ali&gned (with Tab)"
|
|
msgstr "Ausgerichtet (mit TAB)"
|
|
|
|
#: tfrmoptionsbriefview.rbdirectly.caption
|
|
msgid "di&rectly after filename"
|
|
msgstr "Unmittelba&r hinter dem Dateinamen"
|
|
|
|
#: tfrmoptionsbriefview.rbuseautosize.caption
|
|
msgid "Auto"
|
|
msgstr "Auto"
|
|
|
|
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
|
msgid "Fixed columns count"
|
|
msgstr "Feste Anzahl von Spalten"
|
|
|
|
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
|
msgid "Fixed columns width"
|
|
msgstr "Feste Spaltenweite"
|
|
|
|
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
|
msgid "Cut &text to column width"
|
|
msgstr "&Text auf Spaltenbreite kürzen"
|
|
|
|
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
|
|
msgid "&Extend cell width if text is not fitting into column"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
|
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDHORZLINE.CAPTION"
|
|
msgid "&Horizontal lines"
|
|
msgstr "&Horizontale Linien"
|
|
|
|
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
|
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDVERTLINE.CAPTION"
|
|
msgid "&Vertical lines"
|
|
msgstr "&Vertikale Linien"
|
|
|
|
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
|
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CHKAUTOFILLCOLUMNS.CAPTION"
|
|
msgid "A&uto fill columns"
|
|
msgstr "Spalten &automatisch füllen"
|
|
|
|
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
|
msgid "Show grid"
|
|
msgstr "Zeige Gitterstruktur zur Orientierung"
|
|
|
|
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
|
msgid "Auto-size columns"
|
|
msgstr "Größe der Spalten automatisch einstellen"
|
|
|
|
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
|
msgctxt "TFRMOPTIONSCOLUMNSVIEW.LBLAUTOSIZECOLUMN.CAPTION"
|
|
msgid "Auto si&ze column:"
|
|
msgstr "&Größe der Spalten automatisch einstellen:"
|
|
|
|
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "&Übernehmen"
|
|
|
|
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "B&earbeiten"
|
|
|
|
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.CBCMDLINEHISTORY.CAPTION"
|
|
msgid "Co&mmand line history"
|
|
msgstr "&Verlauf der Befehlszeile"
|
|
|
|
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
|
|
msgid "&Directory history"
|
|
msgstr "Ver&zeichnisverlauf"
|
|
|
|
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.CBFILEMASKHISTORY.CAPTION"
|
|
msgid "&File mask history"
|
|
msgstr "Dateimasken-Verlau&f"
|
|
|
|
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSAVECONFIGURATION.CAPTION"
|
|
msgid "Sa&ve configuration"
|
|
msgstr "&Konfiguration speichern"
|
|
|
|
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSEARCHREPLACEHISTORY.CAPTION"
|
|
msgid "Searc&h/Replace history"
|
|
msgstr "Suc&he / Ersetze Verlauf"
|
|
|
|
#: tfrmoptionsconfiguration.gbdirectories.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
|
|
msgid "Directories"
|
|
msgstr "Verzeichnisse"
|
|
|
|
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
|
msgid "Location of configuration files"
|
|
msgstr "Speicherort der Konfigurationsdatei"
|
|
|
|
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
|
msgid "Save on exit"
|
|
msgstr "Beim Beenden speichern"
|
|
|
|
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
|
msgid "Sort order of configuration order in left tree"
|
|
msgstr "Reihenfolge der Konfigurationsfolge im linken Baum sortieren"
|
|
|
|
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
|
msgid "Set on command line"
|
|
msgstr "An Eingabeaufforderung übergeben"
|
|
|
|
#: tfrmoptionsconfiguration.lbliconthemes.caption
|
|
msgid "Icon themes:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.lblthumbcache.caption
|
|
msgid "Thumbnails cache:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
|
msgid "P&rogram directory (portable version)"
|
|
msgstr "P&rogrammverzeichnis (portable Version)"
|
|
|
|
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
|
msgid "&User home directory"
|
|
msgstr "&Benutzerverzeichnis"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallfont.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallfont.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Änderung für alle Spalten übernehmen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursortext.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
|
|
msgid "&Delete"
|
|
msgstr "L&öschen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnfont.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
|
msgid "Go to set default"
|
|
msgstr "Standard für Gehe zu"
|
|
|
|
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
|
|
msgid "New"
|
|
msgstr "Neu"
|
|
|
|
#: tfrmoptionscustomcolumns.btnnext.caption
|
|
msgid "Next"
|
|
msgstr "Nächstes"
|
|
|
|
#: tfrmoptionscustomcolumns.btnprev.caption
|
|
msgid "Previous"
|
|
msgstr "Vorheriges"
|
|
|
|
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
|
|
msgid "Rename"
|
|
msgstr "Umbenennen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Auf Standard zurücksetzen"
|
|
|
|
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
|
|
msgid "Save as"
|
|
msgstr "Speichern unter..."
|
|
|
|
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
|
|
msgid "Save"
|
|
msgstr "Speichern"
|
|
|
|
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
|
msgid "Allow Overcolor"
|
|
msgstr "Erlaube Farb-Überschneidung"
|
|
|
|
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
|
msgid "When clicking to change something, change for all columns"
|
|
msgstr "Wenn etwas geändert wird, das in allen Spalten ändern"
|
|
|
|
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
|
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
|
|
msgid "General"
|
|
msgstr "Allgemein"
|
|
|
|
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
|
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
|
msgid "Cursor border"
|
|
msgstr "Cursor Begrenzung"
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
|
msgid "Use Frame Cursor"
|
|
msgstr "Nutze Frame-Cursor"
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
|
msgid "Use Inactive Selection Color"
|
|
msgstr "Farbe der inaktiven Auswahl nutzen"
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
|
msgid "Use Inverted Selection"
|
|
msgstr "Umgekehrte Auswahl nutzen"
|
|
|
|
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
|
msgid "Use custom font and color for this view"
|
|
msgstr "Angepasste Schriftart und -farbe für diese Ansicht nutzen"
|
|
|
|
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
|
|
msgid "BackGround:"
|
|
msgstr "Hintergrund:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
|
|
msgid "Background 2:"
|
|
msgstr "Hintergrund 2:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
|
msgid "Con&figure columns view:"
|
|
msgstr "Spaltenansicht konfigurieren:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
|
msgid "[Current Column Name]"
|
|
msgstr "[Aktuelle Bezeichnung der Spalte]"
|
|
|
|
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
|
|
msgid "Cursor Color:"
|
|
msgstr "Cursorfarbe"
|
|
|
|
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
|
|
msgid "Cursor Text:"
|
|
msgstr "Cursortext"
|
|
|
|
#: tfrmoptionscustomcolumns.lblfontname.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
|
|
msgid "Font:"
|
|
msgstr "Schriftart:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
|
|
msgid "Size:"
|
|
msgstr "Größe:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
|
|
msgid "Text Color:"
|
|
msgstr "Textfarbe"
|
|
|
|
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
|
msgid "Inactive Cursor Color:"
|
|
msgstr "Farbe für inaktiven Cursor:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
|
msgid "Inactive Mark Color:"
|
|
msgstr "Farbe für inaktive Markierung:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
|
|
msgid "Mark Color:"
|
|
msgstr "Markierungsfarbe"
|
|
|
|
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
|
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
|
msgstr "Unten ist eine Vorschau. Sie kann für eine sofortige Überprüfung er Einstellungen genutzt werden."
|
|
|
|
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
|
msgid "Settings for column:"
|
|
msgstr "Einstellungen für Spalten:"
|
|
|
|
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
|
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
|
|
msgid "Add column"
|
|
msgstr "Spalte hinzufügen"
|
|
|
|
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
|
msgid "Position of frame panel after the comparison:"
|
|
msgstr "Position des Frame-Panel nach dem Vergleich:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
|
|
msgid "Add directory of the &active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
|
|
msgid "Add &directories of the active && inactive frames"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
|
|
msgid "Add directory I will bro&wse to"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
|
|
msgid "Add a copy of the selected entry"
|
|
msgstr "Füge eine Kopie des gewählten Eintrages hinzu"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
|
|
msgid "Add current &selected or active directories of active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
|
|
msgid "Add a separator"
|
|
msgstr "Füge ein Trennzeichen hinzu"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
|
|
msgid "Add a sub menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
|
|
msgid "Add directory I will type"
|
|
msgstr "Füge Verzeichnis hinzu, dass ich eintippe"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
|
|
msgid "Collapse all"
|
|
msgstr "Alle zusammenfalten"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
|
|
msgid "Collapse item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcut.caption
|
|
msgid "Cut selection of entries"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
|
|
msgid "Delete all!"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
|
|
msgid "Delete selected item"
|
|
msgstr "Lösche gewählte Einträge"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
|
|
msgid "Delete sub-menu and all its elements"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
|
|
msgid "Delete just sub-menu but keep elements"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
|
|
msgid "Expand item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
|
|
msgid "Focus tree window"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
|
|
msgid "Goto first item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
|
|
msgid "Goto last item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
|
|
msgid "Go to next item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
|
|
msgid "Go to previous item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
|
|
msgid "Insert directory of the &active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
|
|
msgid "Insert &directories of the active && inactive frames"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
|
|
msgid "Insert directory I will bro&wse to"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
|
|
msgid "Insert a copy of the selected entry"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
|
|
msgid "Insert current &selected or active directories of active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
|
|
msgid "Insert a separator"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
|
|
msgid "Insert sub menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
|
|
msgid "Insert directory I will type"
|
|
msgstr "Füge Verzeichnis ein, das ich eintippe"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
|
|
msgid "Move to next"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
|
|
msgid "Move to previous"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
|
|
msgid "Open all branches"
|
|
msgstr "Alle Zweige öffnen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actpaste.caption
|
|
msgid "Paste what was cut"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
|
|
msgid "Search && replace in &path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
|
|
msgid "Search && replace in both path and target"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
|
|
msgid "Search && replace in &target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
|
|
msgid "Tweak path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
|
|
msgid "Tweak target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
|
msgid "A&dd..."
|
|
msgstr "Füge hinzu..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
|
msgid "Bac&kup..."
|
|
msgstr "Backup..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
|
msgid "De&lete..."
|
|
msgstr "Lösche..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
|
msgid "E&xport..."
|
|
msgstr "Exportieren..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
|
|
msgid "&Help"
|
|
msgstr "Hilfe"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
|
msgid "Impo&rt..."
|
|
msgstr "Importieren..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
|
msgid "&Insert..."
|
|
msgstr "Einfügen..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
|
msgid "&Miscellaneous..."
|
|
msgstr "Verschiedenes..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
|
|
msgid "Some functions to select appropriate target"
|
|
msgstr "Einige Funktionen um angemessene Ziele zu wählen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
|
msgid "&Sort..."
|
|
msgstr "Sortieren..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
|
msgid "&When adding directory, add also target"
|
|
msgstr "Beim Hinzufügen eines Verzeichnisses, auch das Ziel hinzufügen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
|
msgid "Alwa&ys expand tree"
|
|
msgstr "Struktur immer aufklappen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
|
msgid "Show only &valid environment variables"
|
|
msgstr "Nur gültige Umgebungsvariablen anzeigen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
|
msgid "In pop&up, show [path also]"
|
|
msgstr "Im Pop-Up-Menü [auch Pfad] zeigen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
|
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
|
|
msgid "Name, a-z"
|
|
msgstr "Name, a bis z"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
|
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
|
|
msgid "Name, a-z"
|
|
msgstr "Name, a bis z"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
|
msgid "Directory Hotlist (reorder by drag && drop)"
|
|
msgstr "Verzeichnis hotlist (Umsortieren durch Drag&&Drop"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
|
msgid "Other options"
|
|
msgstr "Andere Optionen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
|
|
msgid "Name:"
|
|
msgstr "Name:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
|
|
msgid "Path:"
|
|
msgstr "Pfad:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
|
|
msgid "&Target:"
|
|
msgstr "Ziel:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
|
msgid "...current le&vel of item(s) selected only"
|
|
msgstr "...aktuelles Level an markierten Einträgen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
|
|
msgid "Scan all &hotdir's path to validate the ones that actually exist"
|
|
msgstr "Alle Hot-Dir Verzeichnisse scannen um die zu erkennen, die wirklich existieren"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
|
|
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
|
|
msgstr "Alle Hot-Dir Verzeichnisse und Ziele scannen, um die zu erkennen, die wirklich existieren"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
|
msgid "to a Directory &Hotlist file (.hotlist)"
|
|
msgstr "zu einer Verzeichnis-Hotlist (.hotlist)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
|
|
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende erhalten)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
|
|
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende ersetzen)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
|
msgid "Go to &configure TC related info"
|
|
msgstr "Starte die Konfiguration von TC-bezogenen Informationen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
|
|
msgid "Go to &configure TC related info"
|
|
msgstr "Starte die Konfiguration von TC-bezogenen Informationen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
|
msgid "HotDirTestMenu"
|
|
msgstr "HotDir-Testmenü"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
|
msgid "from a Directory &Hotlist file (.hotlist)"
|
|
msgstr "aus einer Verzeichnis-Hotlist (.hotlis)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
|
msgid "from \"&wincmd.ini\" of TC"
|
|
msgstr "aus einer \"wincmd.ini\" des TotalCommander"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.minavigate.caption
|
|
msgid "&Navigate..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
|
msgid "&Restore a backup of Directory Hotlist"
|
|
msgstr "Wiederherstellen einer Verzeichnis-Hotlist aus einem Backup"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
|
msgid "&Save a backup of current Directory Hotlist"
|
|
msgstr "Speichern einer aktuellen Verzeichnis-Hotlist in ein Backup"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
|
msgid "Search and &replace..."
|
|
msgstr "Suchen und Ersetzen..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
|
msgid "...everything, from A to &Z!"
|
|
msgstr "...alles von A bis Z"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
|
msgid "...single &group of item(s) only"
|
|
msgstr "...nur einzelne Gruppe von Einträgen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
|
msgid "...&content of submenu(s) selected, no sublevel"
|
|
msgstr "...Inhalt von Untermenüs gewählt, aber keine tieferen Level"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
|
msgid "...content of submenu(s) selected and &all sublevels"
|
|
msgstr "Inhalt von Untermenüs ausgewählt, auch alle tiferen Level"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
|
|
msgid "Test resultin&g menu"
|
|
msgstr "Menü aus Testergebnissen"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
|
|
msgid "Tweak &path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
|
|
msgid "Tweak &target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
|
msgid "Addition from main panel"
|
|
msgstr "Zusatz aus dem Hauptpanel:"
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
|
msgid "From all the supported formats, ask which one to use every time"
|
|
msgstr "Frage welches von allen unterstützten Formaten ständig benutzt werden soll"
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
|
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
|
msgstr "Wenn Unicode-Text gespeichert werden soll, nutze das UTF-8 Format (ansonsten wird das UTF-16 Format benutzt)"
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
|
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
|
msgstr "Wenn Text fallen gelassen wird, erstelle den Dateinamen automatisch (ansonsten wird der Nutzer gefragt)"
|
|
|
|
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
|
msgid "&Show confirmation dialog after drop"
|
|
msgstr "Zeige Be&stätigungsdialog nach dem Ziehen und Ablegen von Dateien"
|
|
|
|
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
|
msgid "When drag && dropping text into panels:"
|
|
msgstr "Wenn Drag && Drop benutzt wird:"
|
|
|
|
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
|
msgid "Place the most desired format on top of list (use dag && drop):"
|
|
msgstr "Das wahrscheinlichste Format an oberste Stelle setzen (Nutze Drag && Drop):"
|
|
|
|
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
|
msgid "(if the most desired is not present, we'll take second one and so on)"
|
|
msgstr "(ist das wahrscheinlichste Format nicht verfügbar, nächstes verwenden, und so weiter)"
|
|
|
|
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
|
msgid "(will not work with some source application, so try to uncheck if problem)"
|
|
msgstr "(wird mit einigen Quellen nicht fünktionieren, bitte in diesem Fall versuchen das Problem durch Nicht-Markieren zu lösen)"
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
|
msgid "Show &file system"
|
|
msgstr "&Zeige Dateisystem"
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
|
msgid "Show fr&ee space"
|
|
msgstr "Z&eige freien Speicherplatz"
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
|
msgid "Show &label"
|
|
msgstr "Zeige &Laufwerksbezeichnung"
|
|
|
|
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
|
msgid "Drives list"
|
|
msgstr "Laufwerksliste"
|
|
|
|
#: tfrmoptionseditor.chkscrollpastendline.caption
|
|
msgid "Caret past end of line"
|
|
msgstr "Cursor über Zeilenende hinaus"
|
|
|
|
#: tfrmoptionseditor.chkshowspecialchars.caption
|
|
msgid "Show special characters"
|
|
msgstr "Sonderzeichen anzeigen"
|
|
|
|
#: tfrmoptionseditor.gbinternaleditor.caption
|
|
msgid "Internal editor options"
|
|
msgstr "Optionen des internen Editors"
|
|
|
|
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
|
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
|
msgid "Bac&kground"
|
|
msgstr "&Hintergrund"
|
|
|
|
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
|
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
|
|
msgid "Bac&kground"
|
|
msgstr "&Hintergrund"
|
|
|
|
#: tfrmoptionseditorcolors.btnresetmask.hint
|
|
msgid "Reset"
|
|
msgstr "Zurücksetzen"
|
|
|
|
#: tfrmoptionseditorcolors.btnsavemask.hint
|
|
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
|
|
msgid "Save"
|
|
msgstr "Speichern"
|
|
|
|
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
|
msgid "Element Attributes"
|
|
msgstr "Attribut des Elements"
|
|
|
|
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
|
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
|
msgid "Fo®round"
|
|
msgstr "Vo&rdergrund"
|
|
|
|
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
|
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
|
|
msgid "Fo®round"
|
|
msgstr "Vo&rdergrund"
|
|
|
|
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
|
msgid "&Text-mark"
|
|
msgstr "&Textmarkierung"
|
|
|
|
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
|
msgid "Use (and edit) &global scheme settings"
|
|
msgstr "Nutze (und bearbeite) all&gemeine Schemaeinstellungen"
|
|
|
|
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
|
msgid "Use &local scheme settings"
|
|
msgstr "Nutze &lokale Schemaeinstellungen"
|
|
|
|
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
|
msgid "&Bold"
|
|
msgstr "&Fett"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
|
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
|
|
msgid "In&vert"
|
|
msgstr "&Umgekehrt"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
|
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
|
|
msgid "O&ff"
|
|
msgstr "Au&s"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradioon.caption
|
|
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
|
|
msgid "O&n"
|
|
msgstr "A&n"
|
|
|
|
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
|
msgid "&Italic"
|
|
msgstr "Kurs&iv"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
|
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
|
|
msgid "In&vert"
|
|
msgstr "Um&gekehrt"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
|
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
|
|
msgid "O&ff"
|
|
msgstr "Au&s"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
|
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
|
|
msgid "O&n"
|
|
msgstr "A&n"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
|
msgid "&Strike Out"
|
|
msgstr "Durchge&strichen"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
|
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
|
|
msgid "In&vert"
|
|
msgstr "Um&gekehrt"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
|
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
|
|
msgid "O&ff"
|
|
msgstr "Au&s"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
|
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
|
|
msgid "O&n"
|
|
msgstr "A&n"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
|
msgid "&Underline"
|
|
msgstr "&Unterstreichen"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
|
msgid "In&vert"
|
|
msgstr "Um&gekehrt"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
|
msgid "O&ff"
|
|
msgstr "Au&s"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
|
msgid "O&n"
|
|
msgstr "A&n"
|
|
|
|
#: tfrmoptionsfavoritetabs.btnadd.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
|
|
msgid "Add..."
|
|
msgstr "Füge hinzu..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btndelete.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
|
|
msgid "Delete..."
|
|
msgstr "Lösche..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
|
msgid "Import/Export"
|
|
msgstr "Import/Export"
|
|
|
|
#: tfrmoptionsfavoritetabs.btninsert.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
|
|
msgid "Insert..."
|
|
msgstr "Einfügen..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btnrename.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
|
|
msgid "Rename"
|
|
msgstr "Umbenennen"
|
|
|
|
#: tfrmoptionsfavoritetabs.btnsort.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
|
|
msgid "Sort..."
|
|
msgstr "Sortieren..."
|
|
|
|
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
|
msgid "None"
|
|
msgstr "Nichts"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
|
|
msgid "Always expand tree"
|
|
msgstr "Struktur immer aufklappen"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
|
msgid "No"
|
|
msgstr "Nein"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
|
msgid "Favorite Tabs list (reorder by drag && drop)"
|
|
msgstr "Liste der Favoriten-Tab (umsortieren durch Drag && Drop"
|
|
|
|
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
|
|
msgid "Other options"
|
|
msgstr "Andere Optionen"
|
|
|
|
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
|
msgid "What to restore where for the selected entry:"
|
|
msgstr "Was wo wiederhergestellt werden soll für den gewählten Eintrag:"
|
|
|
|
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
|
msgid "Existing tabs to keep:"
|
|
msgstr "Existierende Tabs die erhalten bleiben sollen:"
|
|
|
|
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
|
msgid "Save dir history:"
|
|
msgstr "Verzeichnisverlauf speichern:"
|
|
|
|
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
|
msgid "Tabs saved on left to be restored to:"
|
|
msgstr "Links gespeicherte Tabs dort wiederherstellen:"
|
|
|
|
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
|
msgid "Tabs saved on right to be restored to:"
|
|
msgstr "Rechts gespeicherte Tabs dort wiederherstellen:"
|
|
|
|
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
|
|
msgid "a separator"
|
|
msgstr "Ein Trennzeichen"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
|
msgid "Add separator"
|
|
msgstr "Trennzeichen hinzufügen"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
|
|
msgid "sub-menu"
|
|
msgstr "Untermenü"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
|
|
msgid "Add sub-menu"
|
|
msgstr "Füge Untermenü hinzu"
|
|
|
|
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
|
|
msgid "Collapse all"
|
|
msgstr "Alle zusammenfalten"
|
|
|
|
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
|
|
msgid "...current level of item(s) selected only"
|
|
msgstr "... aktuelles Level an markierten Einträgen"
|
|
|
|
#: tfrmoptionsfavoritetabs.micutselection.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
|
|
msgid "Cut"
|
|
msgstr "Ausschneiden"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
|
|
msgid "delete all!"
|
|
msgstr "Lösche alle!"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
|
|
msgid "sub-menu and all its elements"
|
|
msgstr "Untermenü und alle seine Elemente"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
|
|
msgid "just sub-menu but keep elements"
|
|
msgstr "Nur das Untermenü, nicht seine Elemente"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
|
|
msgid "selected item"
|
|
msgstr "Gewählte Einträge"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
|
|
msgid "Delete selected item"
|
|
msgstr "Lösche gewählte Einträge"
|
|
|
|
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
|
msgid "Export selection to legacy .tab file(s)"
|
|
msgstr "Auswahl in veraltete .tab Datei(en) exportieren"
|
|
|
|
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
|
msgid "FavoriteTabsTestMenu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
|
msgid "Import legacy .tab file(s) according to default setting"
|
|
msgstr "Veraltete .tab Datei nach Standardart importieren"
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
|
|
msgid "Import legacy .tab file(s) at selected position"
|
|
msgstr "Veraltete .tab Datei(en) an gewählte Position importieren"
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
|
msgid "Import legacy .tab file(s) at selected position"
|
|
msgstr "Veraltete .tab Datei(en) an gewählte Position importieren"
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
|
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
|
msgstr "Veraltete .tab Datei(en) an gewählte Position in ein Untermenü importieren"
|
|
|
|
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
|
msgid "Insert separator"
|
|
msgstr "Trennzeichen einfügen"
|
|
|
|
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
|
msgid "Insert sub-menu"
|
|
msgstr "Untermenü einfügen"
|
|
|
|
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
|
|
msgid "Open all branches"
|
|
msgstr "Alle Zweige öffnen"
|
|
|
|
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
|
|
msgid "Paste"
|
|
msgstr "Einfügen"
|
|
|
|
#: tfrmoptionsfavoritetabs.mirename.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
|
|
msgid "Rename"
|
|
msgstr "Umbenennen"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
|
msgid "...everything, from A to Z!"
|
|
msgstr "... alles von A bis Z!"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
|
msgid "...single group of item(s) only"
|
|
msgstr "... nur einzelne Gruppe von Einträgen"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
|
msgid "Sort single group of item(s) only"
|
|
msgstr "Sortiere nur einzelne Gruppe von Einträgen"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
|
msgid "...content of submenu(s) selected, no sublevel"
|
|
msgstr "...Inhalt von Untermenüs gewählt, aber keine tieferen Level"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
|
msgid "...content of submenu(s) selected and all sublevels"
|
|
msgstr "...Inhalt von Untermenüs ausgewählt, auch alle tiferen Level"
|
|
|
|
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
|
msgid "Test resulting menu"
|
|
msgstr "Menü aus Testergebnissen"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
|
|
msgid "Add"
|
|
msgstr "Hinzufügen"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
|
|
msgid "&Add"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
|
|
msgid "A&dd"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmoptionsfileassoc.btncloneact.caption
|
|
msgid "Clone"
|
|
msgstr "Klonen"
|
|
|
|
#: tfrmoptionsfileassoc.btndownact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
|
|
msgid "&Down"
|
|
msgstr "&Abwärts"
|
|
|
|
#: tfrmoptionsfileassoc.btneditext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
|
|
msgid "Edit"
|
|
msgstr "Bea&rbeiten"
|
|
|
|
#: tfrmoptionsfileassoc.btninsertact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
|
msgid "Insert"
|
|
msgstr "Einfügen"
|
|
|
|
#: tfrmoptionsfileassoc.btninsertext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
|
|
msgid "Insert"
|
|
msgstr "Einfügen"
|
|
|
|
#: tfrmoptionsfileassoc.btnremoveact.caption
|
|
msgid "Remo&ve"
|
|
msgstr "Ent&fernen"
|
|
|
|
#: tfrmoptionsfileassoc.btnremoveext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
|
|
msgid "Re&move"
|
|
msgstr "Ent&fernen"
|
|
|
|
#: tfrmoptionsfileassoc.btnremovetype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
|
|
msgid "&Remove"
|
|
msgstr "Entfe&rnen"
|
|
|
|
#: tfrmoptionsfileassoc.btnrenametype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
|
msgid "R&ename"
|
|
msgstr "Umb&enennen"
|
|
|
|
#: tfrmoptionsfileassoc.btnupact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
|
|
msgid "&Up"
|
|
msgstr "&Hoch"
|
|
|
|
#: tfrmoptionsfileassoc.destartpath.hint
|
|
msgid "Starting path of the command. Never quote this string."
|
|
msgstr "Startpfad des Befehles. Nicht in Anführungstriche setzen!"
|
|
|
|
#: tfrmoptionsfileassoc.edbactionname.hint
|
|
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
|
msgstr "Name der Aktion. Wird nicht an das System übergeben, sondern dient nur der Identifizierung."
|
|
|
|
#: tfrmoptionsfileassoc.edtparams.hint
|
|
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
|
|
msgstr "Parameter für den Befehl. Lange Pfade mit Leerzeichen sollten in Anführungsstriche gesetzt werden."
|
|
|
|
#: tfrmoptionsfileassoc.fnecommand.hint
|
|
msgid "Command to execute. Long filename with space should be quoted."
|
|
msgstr "Befehl zum Ausführen. Lange Pfade mit Leerzeichen sollten in Anführungsstriche gesetzt werden."
|
|
|
|
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
|
msgid "Action description:"
|
|
msgstr "Beschreibung der Aktion"
|
|
|
|
#: tfrmoptionsfileassoc.gbactions.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
|
msgid "Actions"
|
|
msgstr "Aktionen"
|
|
|
|
#: tfrmoptionsfileassoc.gbexts.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
|
|
msgid "Extensions"
|
|
msgstr "Endungen"
|
|
|
|
#: tfrmoptionsfileassoc.gbexts.hint
|
|
msgid "Can be sorted by drag & drop"
|
|
msgstr "Kann durch Drag & Drop sortiert werden"
|
|
|
|
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
|
msgid "File types"
|
|
msgstr "Dateitypen"
|
|
|
|
#: tfrmoptionsfileassoc.gbicon.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
|
|
msgid "Icon"
|
|
msgstr "Icon"
|
|
|
|
#: tfrmoptionsfileassoc.lbactions.hint
|
|
msgid "Actions may be sorted by drag & drop"
|
|
msgstr "Aktionen können durch Drag & Drop angeordnet werden"
|
|
|
|
#: tfrmoptionsfileassoc.lbexts.hint
|
|
msgid "Extensions may be sorted by drag & drop"
|
|
msgstr "Endungen können durch Drag & Drop angeordnet werden"
|
|
|
|
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
|
msgid "File types may be sorted by drag & drop"
|
|
msgstr "Dateitypen können durch Drag & Drop angeordnet werden"
|
|
|
|
#: tfrmoptionsfileassoc.lblaction.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
|
|
msgid "Action name:"
|
|
msgstr "Name der Aktion:"
|
|
|
|
#: tfrmoptionsfileassoc.lblcommand.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
|
|
msgid "&Command:"
|
|
msgstr "&Befehl"
|
|
|
|
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
|
msgid "Parameter&s:"
|
|
msgstr "&Parameter:"
|
|
|
|
#: tfrmoptionsfileassoc.lblstartpath.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
|
msgid "Start pat&h:"
|
|
msgstr "Start&pfad"
|
|
|
|
#: tfrmoptionsfileassoc.menuitem1.caption
|
|
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfileassoc.menuitem3.caption
|
|
msgid "Custom with..."
|
|
msgstr "Angepasst mit..."
|
|
|
|
#: tfrmoptionsfileassoc.micustom.caption
|
|
msgid "Custom"
|
|
msgstr "Angepasst"
|
|
|
|
#: tfrmoptionsfileassoc.miedit.caption
|
|
msgctxt "tfrmoptionsfileassoc.miedit.caption"
|
|
msgid "Edit"
|
|
msgstr "Bea&rbeiten"
|
|
|
|
#: tfrmoptionsfileassoc.mieditor.caption
|
|
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
|
|
msgid "Open in Editor"
|
|
msgstr "im Editor öffnen"
|
|
|
|
#: tfrmoptionsfileassoc.mieditwith.caption
|
|
msgid "Edit with..."
|
|
msgstr "Bearbeiten mit..."
|
|
|
|
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
|
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
|
|
msgid "Get output from command"
|
|
msgstr "Ausgabe aus Konsolen-Fenster entnehmen"
|
|
|
|
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
|
msgid "Open in Internal Editor"
|
|
msgstr "Im internen Editor öffnen"
|
|
|
|
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
|
msgid "Open in Internal Viewer"
|
|
msgstr "Im internen Betrachter öffnen"
|
|
|
|
#: tfrmoptionsfileassoc.miopen.caption
|
|
msgctxt "tfrmoptionsfileassoc.miopen.caption"
|
|
msgid "Open"
|
|
msgstr "Öffnen"
|
|
|
|
#: tfrmoptionsfileassoc.miopenwith.caption
|
|
msgid "Open with..."
|
|
msgstr "Öffnen mit..."
|
|
|
|
#: tfrmoptionsfileassoc.miseparator.caption
|
|
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfileassoc.mishell.caption
|
|
msgctxt "tfrmoptionsfileassoc.mishell.caption"
|
|
msgid "Run in terminal"
|
|
msgstr "In Konsolen-Fenster ausführen"
|
|
|
|
#: tfrmoptionsfileassoc.miview.caption
|
|
msgctxt "tfrmoptionsfileassoc.miview.caption"
|
|
msgid "View"
|
|
msgstr "Betrachten"
|
|
|
|
#: tfrmoptionsfileassoc.miviewer.caption
|
|
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
|
|
msgid "Open in Viewer"
|
|
msgstr "In Betrachter öffnen"
|
|
|
|
#: tfrmoptionsfileassoc.miviewwith.caption
|
|
msgid "View with..."
|
|
msgstr "Betrachten mit..."
|
|
|
|
#: tfrmoptionsfileassoc.sbtnicon.hint
|
|
msgid "Click me to change icon!"
|
|
msgstr "Hier klicken um das Icon zu ändern!"
|
|
|
|
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
|
msgid "Execute via shell"
|
|
msgstr "Auf der Befehlszeile ausführen"
|
|
|
|
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
|
msgid "Extended context menu"
|
|
msgstr "Erweitertes Kontextmenü"
|
|
|
|
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
|
|
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
|
|
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
|
msgstr "Wenn die Dateityp-Verknüpfung genutzt wird, anbieten die aktuelle Datei hinzuzfügen, wenn nicht bereits in einem konfigurierten Typ enthalten"
|
|
|
|
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
|
msgid "File association configuration"
|
|
msgstr "Konfiguration der Dateitypen"
|
|
|
|
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
|
msgid "Offer to add selection to file association when not included already"
|
|
msgstr "Anbieten die Auswahl zur Dateityp-Verknüpfung hinzuzfügen, wenn nicht bereits enthalten"
|
|
|
|
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
|
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
|
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
|
msgstr "Wenn die Dateityp-Verknüpfung genutzt wird, anbieten die aktuelle Datei hinzuzfügen, wenn nicht bereits in einem konfigurierten Tpy enthalten"
|
|
|
|
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
|
msgid "Execute via terminal and close"
|
|
msgstr "Im Terminal ausführen und schließen"
|
|
|
|
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
|
msgid "Execute via terminal and stay open"
|
|
msgstr "Im Terminal ausführen und geöffnet lassen"
|
|
|
|
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
|
msgid "Extended options items:"
|
|
msgstr "Einträge für erweiterte Optionen:"
|
|
|
|
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
|
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
|
|
msgid "Show confirmation window for:"
|
|
msgstr "Bestätigungsdialog zeigen für:"
|
|
|
|
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
|
msgid "Cop&y operation"
|
|
msgstr "Kop&ieren"
|
|
|
|
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
|
msgid "&Delete operation"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDELETETOTRASH.CAPTION"
|
|
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
|
msgstr "Löschen in den Papierkorb ('Umschalt'-Taste invertiert diese Funktion)"
|
|
|
|
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
|
msgid "D&elete to trash operation"
|
|
msgstr "In d&en Papierkorb verschieben"
|
|
|
|
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
|
|
msgid "D&rop readonly flag"
|
|
msgstr "Sch&reibschutz-Attribut entfernen"
|
|
|
|
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
|
msgid "&Move operation"
|
|
msgstr "&Verschieben"
|
|
|
|
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBPROCESSCOMMENTS.CAPTION"
|
|
msgid "&Process comments with files/folders"
|
|
msgstr "K&ommentare von Dateien/Verzeichnissen mitbearbeiten"
|
|
|
|
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBRENAMESELONLYNAME.CAPTION"
|
|
msgid "Select &file name without extension when renaming"
|
|
msgstr "&Bei Umbenennen den Dateinamen ohne Endung selektieren"
|
|
|
|
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSHOWCOPYTABSELECTPANEL.CAPTION"
|
|
msgid "Sho&w tab select panel in copy/move dialog"
|
|
msgstr "&Zeige Auswahldialog für Tabs im Kopieren/Verschieben-Dialog"
|
|
|
|
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSKIPFILEOPERROR.CAPTION"
|
|
msgid "S&kip file operations errors and write them to log window"
|
|
msgstr "&Fehler bei Datei-Operationen ignorieren und sie im Log-Fenster anzeigen"
|
|
|
|
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
|
msgid "Executing operations"
|
|
msgstr "Führe Operationen aus"
|
|
|
|
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
|
msgid "User interface"
|
|
msgstr "Nutzeroberfläche"
|
|
|
|
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
|
msgid "&Buffer size for file operations (in KB):"
|
|
msgstr "&Puffergröße für Dateioperationen (in KB)"
|
|
|
|
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
|
msgid "Buffer size for &hash calculation (in KB):"
|
|
msgstr "Puffergröße für die &Hash-Kalkulation (in KB):"
|
|
|
|
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
|
msgid "Show operations progress &initially in"
|
|
msgstr "Ze&ige Operationsfortschritt von Anfang an"
|
|
|
|
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
|
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
|
|
msgid "Duplicated name auto-rename style:"
|
|
msgstr "Art der Neubenennung bei gleichem Namen:"
|
|
|
|
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLWIPEPASSNUMBER.CAPTION"
|
|
msgid "&Number of wipe passes:"
|
|
msgstr "A&nzahl der Überschreibvorgänge"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
|
msgid "Reset to DC default"
|
|
msgstr "Auf Standard-Einstellungen zurücksetzen"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
|
|
msgid "Allow Overcolor"
|
|
msgstr "Erlaube Farb-Überschneidung"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEFRAMECURSOR.CAPTION"
|
|
msgid "Use &Frame Cursor"
|
|
msgstr "&Cursor nur als Rahmen"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
|
msgid "Use &Gradient Indicator"
|
|
msgstr "Ver&wende Farbverlauf als Indikator"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
|
msgid "Use Inactive Sel Color"
|
|
msgstr "Nutze inaktive Sel-Farbe"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEINVERTEDSELECTION.CAPTION"
|
|
msgid "U&se Inverted Selection"
|
|
msgstr "Invertierte Au&swahl nutzen"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
|
|
msgid "Cursor border"
|
|
msgstr "Cursor Begrenzung"
|
|
|
|
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
|
|
msgid "Drive Free Space Indicator"
|
|
msgstr "Indikator für freien Speicherplatz auf Laufwerken"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR.CAPTION"
|
|
msgid "Bac&kground:"
|
|
msgstr "Hinter&grund:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
|
|
msgid "Backg&round 2:"
|
|
msgstr "Hinte&rgrund 2:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
|
|
msgid "C&ursor Color:"
|
|
msgstr "C&ursorfarbe"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
|
|
msgid "Cursor Te&xt:"
|
|
msgstr "Cursorte&xt"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
|
|
msgid "Inactive Cursor Color:"
|
|
msgstr "Inaktive Cursor-Farbe"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
|
|
msgid "Inactive Mark Color:"
|
|
msgstr "Inaktive Markierungsfarbe"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEPANELBRIGHTNESS.CAPTION"
|
|
msgid "&Brightness level of inactive panel"
|
|
msgstr "&Helligkeitswert des inaktiven Panels"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
|
msgid "In&dicator Back Color:"
|
|
msgstr "Hintergrun&dfarbe für Indikator"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
|
msgid "&Indicator Fore Color:"
|
|
msgstr "Vordergrundfarbe für &Indikator:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
|
|
msgid "&Mark Color:"
|
|
msgstr "&Markierungsfarbe"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
|
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
|
msgstr "Vorschau: Cursor bewegen und Dateien markieren, um einen sofortigen Eindruck von den verschieden Einstellungen zu bekommen."
|
|
|
|
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
|
|
msgid "T&ext Color:"
|
|
msgstr "T&extfarbe"
|
|
|
|
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
|
msgid "When launching file search, clear file mask filter"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
|
msgid "&Search for part of file name"
|
|
msgstr "&Suche nach Teil des Dateinamens"
|
|
|
|
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
|
msgid "Show menu bar in \"Find files\""
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
|
msgid "Text search in files"
|
|
msgstr "Textsuche in Dateien"
|
|
|
|
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
|
|
msgid "File search"
|
|
msgstr "Dateisuche"
|
|
|
|
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
|
msgid "Current filters with \"New search\" button:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
|
msgid "Default search template:"
|
|
msgstr "Standardvorlage für Suche:"
|
|
|
|
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
|
msgid "Use memory mapping for search te&xt in files"
|
|
msgstr "Nutze Memor&y-Mapping zur Textsuche in Dateien"
|
|
|
|
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
|
msgid "&Use stream for search text in files"
|
|
msgstr "N&utze Stream zur Textsuche in Dateien"
|
|
|
|
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
|
|
msgid "&Help"
|
|
msgstr "&Hilfe"
|
|
|
|
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
|
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
|
msgid "Do&n't load file list until a tab is activated"
|
|
msgstr "Dateiliste &nicht laden bis ein Tab aktiviert ist"
|
|
|
|
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBDIRBRACKETS.CAPTION"
|
|
msgid "S&how square brackets around directories"
|
|
msgstr "Zeige eckige Klammern um Verzeic&hnisse"
|
|
|
|
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
|
msgid "Hi&ghlight new and updated files"
|
|
msgstr "Ma&rkiere neue und aktualisierte Dateien"
|
|
|
|
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
|
msgid "Enable inplace &renaming when clicking twice on a name"
|
|
msgstr "Sofortiges Umbenennen bei zweimaligem Anklicken eines Dateinamens ermöglichen"
|
|
|
|
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
|
|
msgid "Load &file list in separate thread"
|
|
msgstr "&Dateiliste in eigenem Prozess starten"
|
|
|
|
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
|
|
msgid "Load icons af&ter file list"
|
|
msgstr "Icons nach Da&teiliste laden"
|
|
|
|
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
|
|
msgid "Show s&ystem and hidden files"
|
|
msgstr "Zeige versteckte und S&ystemdateien"
|
|
|
|
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBSPACEMOVESDOWN.CAPTION"
|
|
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
|
msgstr "&Wenn Dateien mit der <Leertaste> ausgewählt werden, zur nächsten Datei wechseln (wie mit <Einfügen>)"
|
|
|
|
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
|
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
|
|
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
|
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
|
|
msgid "Use an independent attribute filter in mask input dialog each time"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.gbformatting.caption
|
|
msgid "Formatting"
|
|
msgstr "Format"
|
|
|
|
#: tfrmoptionsfilesviews.gbmarking.caption
|
|
msgid "Marking/Unmarking entries"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.gbsorting.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.GBSORTING.CAPTION"
|
|
msgid "Sorting"
|
|
msgstr "Sortierung"
|
|
|
|
#: tfrmoptionsfilesviews.lbattributemask.caption
|
|
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
|
|
msgid "Default attribute mask value to use:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
|
msgid "Case s&ensitivity:"
|
|
msgstr "Groß-/Kleinschr&eibung:"
|
|
|
|
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
|
msgid "Incorrect format"
|
|
msgstr "Falsches Format"
|
|
|
|
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.LBLDATETIMEFORMAT.CAPTION"
|
|
msgid "&Date and time format:"
|
|
msgstr "&Datums- und Zeitformat"
|
|
|
|
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
|
msgid "File si&ze format:"
|
|
msgstr "Format Dateigr&öße"
|
|
|
|
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
|
#, fuzzy
|
|
#| msgid "&Insert new files"
|
|
msgid "&Insert new files:"
|
|
msgstr "Neue Date&ien einfügen"
|
|
|
|
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
|
msgid "So&rting directories:"
|
|
msgstr "So&rtierung von Verzeichnissen:"
|
|
|
|
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.LBLSORTMETHOD.CAPTION"
|
|
msgid "&Sort method:"
|
|
msgstr "&Sortier&methode:"
|
|
|
|
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
|
#, fuzzy
|
|
#| msgid "&Move updated files"
|
|
msgid "&Move updated files:"
|
|
msgstr "Aktualisierte Dateien verschiebe&n"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "&Übernehmen"
|
|
|
|
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
|
msgid "D&elete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
|
msgid "Template..."
|
|
msgstr "Vorlage..."
|
|
|
|
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.GBFILETYPESCOLORS.CAPTION"
|
|
msgid "File types colors (sort by drag&&drop)"
|
|
msgstr "Dateitypfarben (durch \"Drag & Drop\" anordnen)"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYATTR.CAPTION"
|
|
msgid "Category a&ttributes:"
|
|
msgstr "Ka&tegorie der Attribute"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
|
msgid "Category co&lor:"
|
|
msgstr "&Kategoriefarbe"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
|
msgid "Category &mask:"
|
|
msgstr "Kategorie&maske"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
|
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
|
|
msgid "Category &name:"
|
|
msgstr "Kategorie&name"
|
|
|
|
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
|
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
|
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
|
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnseleditfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnsellogfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselmainfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselviewfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.lblconsolefont.caption
|
|
msgid "&Console font"
|
|
msgstr "S&chriftart für die Konsole"
|
|
|
|
#: tfrmoptionsfonts.lbleditorfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
|
|
msgid "&Editor font"
|
|
msgstr "Schrift für &Editor"
|
|
|
|
#: tfrmoptionsfonts.lbllogfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
|
|
msgid "&Log font"
|
|
msgstr "Schriftart für &Log-Dateien"
|
|
|
|
#: tfrmoptionsfonts.lblmainfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
|
|
msgid "Main &font"
|
|
msgstr "Hauptschri&ftart"
|
|
|
|
#: tfrmoptionsfonts.lblpatheditfont.caption
|
|
msgid "Path font"
|
|
msgstr "Pfad zur Schrift"
|
|
|
|
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
|
msgid "Search results font"
|
|
msgstr "Schriftart für Suchergebnisse"
|
|
|
|
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
|
|
msgid "Viewer&Book Font"
|
|
msgstr "Schriftart für die &buchartige Ansicht"
|
|
|
|
#: tfrmoptionsfonts.lblviewerfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
|
|
msgid "&Viewer font"
|
|
msgstr "Schriftart für &Betrachter"
|
|
|
|
#: tfrmoptionshotkeys.actaddhotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
|
|
msgid "Add &hotkey"
|
|
msgstr "Tastaturkürzel &hinzufügen"
|
|
|
|
#: tfrmoptionshotkeys.actcopy.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actcopy.caption"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmoptionshotkeys.actdelete.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actdelete.caption"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
|
|
msgid "&Delete hotkey"
|
|
msgstr "&Tastaturkürzel löschen"
|
|
|
|
#: tfrmoptionshotkeys.actedithotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
|
|
msgid "&Edit hotkey"
|
|
msgstr "Tastaturkürz&el bearbeiten"
|
|
|
|
#: tfrmoptionshotkeys.actnextcategory.caption
|
|
msgid "Next category"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
|
msgid "Make popup the file related menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
|
msgid "Previous category"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actrename.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actrename.caption"
|
|
msgid "Rename"
|
|
msgstr "Umbenennen"
|
|
|
|
#: tfrmoptionshotkeys.actrestoredefault.caption
|
|
msgid "Restore DC default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsavenow.caption
|
|
msgid "Save now"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbycommand.caption
|
|
msgid "Sort by command name"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
|
msgid "Sort by hotkeys (grouped)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
|
msgid "Sort by hotkeys (one per row)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.lbfilter.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
|
|
msgid "&Filter"
|
|
msgstr "&Filter"
|
|
|
|
#: tfrmoptionshotkeys.lblcategories.caption
|
|
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
|
|
msgid "C&ategories:"
|
|
msgstr "K&ategorien:"
|
|
|
|
#: tfrmoptionshotkeys.lblcommands.caption
|
|
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
|
|
msgid "Co&mmands:"
|
|
msgstr "&Befehle:"
|
|
|
|
#: tfrmoptionshotkeys.lblscfiles.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
|
|
msgid "&Shortcut files:"
|
|
msgstr "&Verknüpfungen:"
|
|
|
|
#: tfrmoptionshotkeys.lblsortorder.caption
|
|
msgid "So&rt order:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.micategories.caption
|
|
msgid "Categories"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.micommands.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.micommands.caption"
|
|
msgid "Command"
|
|
msgstr "Befehle"
|
|
|
|
#: tfrmoptionshotkeys.miseparator1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionshotkeys.misortorder.caption
|
|
msgid "Sort order"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.cbiconsexclude.caption
|
|
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
|
msgid "For the following &paths and their subdirectories:"
|
|
msgstr "Für die &folgenden Pfade und Unterverzeichnisse:"
|
|
|
|
#: tfrmoptionsicons.cbiconsinmenus.caption
|
|
msgid "Show icons for actions in &menus"
|
|
msgstr "Icons für Aktionen in Menüs anzeigen"
|
|
|
|
#: tfrmoptionsicons.cbiconsinmenussize.text
|
|
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
|
|
msgid "16x16"
|
|
msgstr "16x16"
|
|
|
|
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
|
msgid "Show icons on buttons"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
|
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
|
|
msgid "Show o&verlay icons, e.g. for links"
|
|
msgstr "&Überlagernde Icons zeigen (z. B. Pfeile bei Verknüpfungen)"
|
|
|
|
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
|
msgid "Disable special icons"
|
|
msgstr "Keine speziellen Symbole"
|
|
|
|
#: tfrmoptionsicons.gbiconssize.caption
|
|
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
|
|
msgid " Icon size "
|
|
msgstr "Größe der Icons"
|
|
|
|
#: tfrmoptionsicons.gbicontheme.caption
|
|
msgid "Icon theme"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.gbshowicons.caption
|
|
msgid "Show icons"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.gbshowiconsmode.caption
|
|
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
|
|
msgid " Show icons to the left of the filename "
|
|
msgstr "Icons links vom Dateinamen anzeigen"
|
|
|
|
#: tfrmoptionsicons.lbldiskpanel.caption
|
|
msgid "Disk panel:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.lblfilepanel.caption
|
|
msgid "File panel:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.rbiconsshowall.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
|
msgid "A&ll"
|
|
msgstr "A&lle"
|
|
|
|
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
|
|
msgid "All associated + &EXE/LNK (slow)"
|
|
msgstr "Alle verknüpften .&exe / .lnk - Dateien (langsam)"
|
|
|
|
#: tfrmoptionsicons.rbiconsshownone.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
|
|
msgid "&No icons"
|
|
msgstr "&Keine Icons"
|
|
|
|
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
|
|
msgid "Only &standard icons"
|
|
msgstr "Nur &Standard-Icons"
|
|
|
|
#: tfrmoptionsignorelist.btnaddsel.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
|
|
msgid "A&dd selected names"
|
|
msgstr "&Ausgewählte Namen hinzufügen"
|
|
|
|
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
|
|
msgid "Add selected names with &full path"
|
|
msgstr "Ausgewählte Namen mit &komplettem Pfad hinzufügen"
|
|
|
|
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
|
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmoptionsignorelist.chkignoreenable.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
|
|
msgid "&Ignore (don't show) the following files and folders:"
|
|
msgstr "&Ignoriere (zeige nicht) die folgenden Dateien und Verzeichnisse:"
|
|
|
|
#: tfrmoptionsignorelist.lblsavein.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
|
|
msgid "&Save in:"
|
|
msgstr "&Speichern in:"
|
|
|
|
#: tfrmoptionskeyboard.cblynxlike.caption
|
|
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
|
msgstr "P&feil nach links, bzw. rechts wechselt das Verzeichnis (Lynx-artiges Navigieren)"
|
|
|
|
#: tfrmoptionskeyboard.gbtyping.caption
|
|
msgid "Typing"
|
|
msgstr "Schreiben"
|
|
|
|
#: tfrmoptionskeyboard.lblalt.caption
|
|
#, fuzzy
|
|
#| msgid "Alt+L&etters"
|
|
msgid "Alt+L&etters:"
|
|
msgstr "Alt-Tast&e+Buchstabe"
|
|
|
|
#: tfrmoptionskeyboard.lblctrlalt.caption
|
|
#, fuzzy
|
|
#| msgid "Ctrl+Alt+Le&tters"
|
|
msgid "Ctrl+Alt+Le&tters:"
|
|
msgstr "S&trg+Alt+Buchstabe"
|
|
|
|
#: tfrmoptionskeyboard.lblnomodifier.caption
|
|
#, fuzzy
|
|
#| msgid "&Letters"
|
|
msgid "&Letters:"
|
|
msgstr "&Buchstaben"
|
|
|
|
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
|
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
|
|
msgid "&Flat buttons"
|
|
msgstr "&Flache Buttons"
|
|
|
|
#: tfrmoptionslayout.cbflatinterface.caption
|
|
msgid "Flat i&nterface"
|
|
msgstr "Flaches Erschei&nungsbild"
|
|
|
|
#: tfrmoptionslayout.cbflattoolbar.caption
|
|
msgid "Flat b&uttons"
|
|
msgstr "Fla&che Buttons"
|
|
|
|
#: tfrmoptionslayout.cbfreespaceind.caption
|
|
msgid "Show fr&ee space indicator on drive label"
|
|
msgstr "Z&eige den 'Freien Speicher'-Indikator über den Panels"
|
|
|
|
#: tfrmoptionslayout.cblogwindow.caption
|
|
msgid "Show lo&g window"
|
|
msgstr "Lo&g-Datei anzeigen"
|
|
|
|
#: tfrmoptionslayout.cbpanelofoperations.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
|
|
msgid "Show panel of operation in background"
|
|
msgstr "Zeige den ausführenden Fensterteil im Hintergrund"
|
|
|
|
#: tfrmoptionslayout.cbproginmenubar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
|
|
msgid "Show common progress in menu bar"
|
|
msgstr "Zeige allgemeinen Fortschritt in der Menü-Zeile"
|
|
|
|
#: tfrmoptionslayout.cbshowcmdline.caption
|
|
msgid "Show command l&ine"
|
|
msgstr "Befehlsze&ile anzeigen"
|
|
|
|
#: tfrmoptionslayout.cbshowcurdir.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
|
|
msgid "Show current director&y"
|
|
msgstr "&Zeige aktuelles Verzeichnis"
|
|
|
|
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
|
|
msgid "Show &drive buttons"
|
|
msgstr "Zeige Buttons für &Laufwerke"
|
|
|
|
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
|
|
msgid "Show free s&pace label"
|
|
msgstr "Zeige '&freien Speicher' von 'Gesamt-Speicherplatz' über den Panels"
|
|
|
|
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
|
msgid "Show drives list bu&tton"
|
|
msgstr "Zeige Button für das Laufwe&rks-Drop-down-Menü"
|
|
|
|
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
|
msgid "Show function &key buttons"
|
|
msgstr "Ze&ige Buttons der Funktionstasten"
|
|
|
|
#: tfrmoptionslayout.cbshowmainmenu.caption
|
|
msgid "Show &main menu"
|
|
msgstr "Zeige Haupt&menü"
|
|
|
|
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
|
|
msgid "Show tool&bar"
|
|
msgstr "Zeige Tool&bar"
|
|
|
|
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
|
msgid "Show short free space &label"
|
|
msgstr "Zeige kurze Information zum freien Speicherp&latz"
|
|
|
|
#: tfrmoptionslayout.cbshowstatusbar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
|
|
msgid "Show &status bar"
|
|
msgstr "&Statusleiste zeigen"
|
|
|
|
#: tfrmoptionslayout.cbshowtabheader.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
|
|
msgid "S&how tabstop header"
|
|
msgstr "Zeige Ta&bstop-Zeile"
|
|
|
|
#: tfrmoptionslayout.cbshowtabs.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
|
|
msgid "Sho&w folder tabs"
|
|
msgstr "Zeige &Verzeichnis-Tabs"
|
|
|
|
#: tfrmoptionslayout.cbtermwindow.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
|
|
msgid "Show te&rminal window"
|
|
msgstr "Konsolenfenste&r zeigen"
|
|
|
|
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
|
|
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
|
msgstr "Zeige zwei &Laufwerksleisten (feste Breite, über den Dateifenstern)"
|
|
|
|
#: tfrmoptionslayout.gbscreenlayout.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
|
|
msgid " Screen layout "
|
|
msgstr "Bildschirmdarstellung"
|
|
|
|
#: tfrmoptionslog.btnrelativelogfile.hint
|
|
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmoptionslog.btnviewlogfile.hint
|
|
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
|
msgid "View log file content"
|
|
msgstr "Inhalt der Log-Datei betrachten"
|
|
|
|
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
|
msgid "Include date in log filename"
|
|
msgstr "Datum in den Namen der Log-Datei aufnehmen"
|
|
|
|
#: tfrmoptionslog.cblogarcop.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
|
|
msgid "&Pack/Unpack"
|
|
msgstr "&Packen / Entpacken"
|
|
|
|
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
|
msgid "External command line execution"
|
|
msgstr "Externe Befehlszeile ausführen"
|
|
|
|
#: tfrmoptionslog.cblogcpmvln.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
|
|
msgid "Cop&y/Move/Create link/symlink"
|
|
msgstr "Kopiere/Verschiebe/Erstelle Link/s&ymb. Link"
|
|
|
|
#: tfrmoptionslog.cblogdelete.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmoptionslog.cblogdirop.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
|
|
msgid "Crea&te/Delete directories"
|
|
msgstr "Ers&telle / Lösche Verzeichnisse"
|
|
|
|
#: tfrmoptionslog.cblogerrors.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
|
|
msgid "Log &errors"
|
|
msgstr "F&ehler aufzeichnen"
|
|
|
|
#: tfrmoptionslog.cblogfile.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
|
|
msgid "C&reate a log file:"
|
|
msgstr "E&rstelle Log-Datei:"
|
|
|
|
#: tfrmoptionslog.cbloginfo.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
|
|
msgid "Log &information messages"
|
|
msgstr "Informat&ionsmeldungen aufzeichnen"
|
|
|
|
#: tfrmoptionslog.cblogstartshutdown.caption
|
|
msgid "Start/shutdown"
|
|
msgstr "Start/Beenden"
|
|
|
|
#: tfrmoptionslog.cblogsuccess.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
|
|
msgid "Log &successful operations"
|
|
msgstr "Erfolgreiche Vorg&änge aufzeichnen"
|
|
|
|
#: tfrmoptionslog.cblogvfs.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
|
|
msgid "&File system plugins"
|
|
msgstr "&Dateisystem Plugins"
|
|
|
|
#: tfrmoptionslog.gblogfile.caption
|
|
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
|
|
msgid "File operation log file"
|
|
msgstr "Dateioperation Log-Datei"
|
|
|
|
#: tfrmoptionslog.gblogfileop.caption
|
|
msgid "Log operations"
|
|
msgstr "Operationen aufzeichnen:"
|
|
|
|
#: tfrmoptionslog.gblogfilestatus.caption
|
|
msgid "Operation status"
|
|
msgstr "Fortschritt des Vorgangs"
|
|
|
|
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
|
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
|
msgid "&Remove thumbnails for no longer existing files"
|
|
msgstr "Vo&rschaubilder für gelöschte Dateien entfernen"
|
|
|
|
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
|
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
|
|
msgid "View log file content"
|
|
msgstr "Inhalt der Log-Datei betrachten"
|
|
|
|
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
|
msgid "Create new with the encoding:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.chkgotoroot.caption
|
|
msgid "Always &go to the root of a drive when changing drives"
|
|
msgstr "Beim Wechsel des Laufwerkes immer zur &obersten Ebenen des Laufwerkes wechseln"
|
|
|
|
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
|
msgid "Show &warning messages (\"OK\" button only)"
|
|
msgstr "&Warnungen anzeigen (nur \"OK\" Button)"
|
|
|
|
#: tfrmoptionsmisc.chkthumbsave.caption
|
|
msgid "&Save thumbnails in cache"
|
|
msgstr "&Speichern von Bildvorschauen im Cache"
|
|
|
|
#: tfrmoptionsmisc.dblthumbnails.caption
|
|
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
|
|
msgid "Thumbnails"
|
|
msgstr "Vorschaubilder"
|
|
|
|
#: tfrmoptionsmisc.gbfilecomments.caption
|
|
msgid "File comments (descript.ion)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.gbtcexportimport.caption
|
|
msgid "Regarding TC export/import:"
|
|
msgstr "In Bezug auf TC Import/Export:"
|
|
|
|
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
|
msgid "Default encoding:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.lbltcconfig.caption
|
|
msgid "Configuration file:"
|
|
msgstr "Konfigurationsdatei:"
|
|
|
|
#: tfrmoptionsmisc.lbltcexecutable.caption
|
|
msgid "TC executable:"
|
|
msgstr "TC.exe-Datei"
|
|
|
|
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
|
msgid "Toolbar output path:"
|
|
msgstr "Ausgabepfad für Toolbar:"
|
|
|
|
#: tfrmoptionsmisc.lblthumbpixels.caption
|
|
msgid "pixels"
|
|
msgstr "Pixel"
|
|
|
|
#: tfrmoptionsmisc.lblthumbseparator.caption
|
|
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
|
|
msgid "X"
|
|
msgstr "X"
|
|
|
|
#: tfrmoptionsmisc.lblthumbsize.caption
|
|
msgid "&Thumbnail size:"
|
|
msgstr "&Größe der Vorschaubilder"
|
|
|
|
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
|
msgid "&Selection by mouse"
|
|
msgstr "Au&swahl mit der Maus"
|
|
|
|
#: tfrmoptionsmouse.gbscrolling.caption
|
|
msgid "Scrolling"
|
|
msgstr "Maus-Rad: Bewegen durch die Seite"
|
|
|
|
#: tfrmoptionsmouse.gbselection.caption
|
|
msgid "Selection"
|
|
msgstr "Auswahl"
|
|
|
|
#: tfrmoptionsmouse.lblmousemode.caption
|
|
msgid "&Mode:"
|
|
msgstr "&Modus"
|
|
|
|
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
|
msgid "&Line by line"
|
|
msgstr "Anzahl Zei&len"
|
|
|
|
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
|
msgid "Line by line &with cursor movement"
|
|
msgstr "Zeile für Zeile mit Be&wegen der Zeilenmarkierung"
|
|
|
|
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
|
msgid "&Page by page"
|
|
msgstr "&Seite für Seite"
|
|
|
|
#: tfrmoptionsplugins.btnaddplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmoptionsplugins.btnconfigplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
|
|
msgid "Con&figure"
|
|
msgstr "E&instellen"
|
|
|
|
#: tfrmoptionsplugins.btnenableplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
|
|
msgid "E&nable"
|
|
msgstr "Aktiviere&n"
|
|
|
|
#: tfrmoptionsplugins.btnremoveplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
|
|
msgid "&Remove"
|
|
msgstr "Entfe&rnen"
|
|
|
|
#: tfrmoptionsplugins.btntweakplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
|
|
msgid "&Tweak"
|
|
msgstr "An&passen"
|
|
|
|
#: tfrmoptionsplugins.lbldsxdescription.caption
|
|
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
|
msgstr "Suc&h-Plugins erlauben es, alternative Such-Algorithmen oder aber externe Tools (wie \"locate\", oder ähnliches) zu nutzen"
|
|
|
|
#: tfrmoptionsplugins.lblwcxdescription.caption
|
|
msgid "Pack&er plugins are used to work with archives"
|
|
msgstr "Pack&er-PlugIns werden benutzt um mit Archiven zu arbeiten."
|
|
|
|
#: tfrmoptionsplugins.lblwdxdescription.caption
|
|
#, fuzzy
|
|
#| msgid "Content plu&gins allow to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
|
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
|
|
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
|
msgstr "Inhalt-Plu&gins erlauben es, weitere Details (wie z.B. MP3-Tags) in Dateilisten anzuzeigen, oder sie zur Suche oder Umbenennung zu nutzen"
|
|
|
|
#: tfrmoptionsplugins.lblwfxdescription.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
|
|
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
|
msgstr "Dateisystem-P&lugins erlauben auf Dateisysteme oder externe Laufwerke zuzugreifen, auf die das Betriebssystem nicht zugreifen kann (z.B. Palm oder Pocket-PCs)."
|
|
|
|
#: tfrmoptionsplugins.lblwlxdescription.caption
|
|
#, fuzzy
|
|
#| msgid "Vie&wer plugins allow to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
|
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
|
|
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
|
msgstr "Be&trachter-Plugins erlauben die Anzeige von Bilder, Tabellen, Datenbanken o.ä. mit dem Betrachter (F3 oder Strg+Q)."
|
|
|
|
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
|
|
msgid "Active"
|
|
msgstr "Aktiv"
|
|
|
|
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
|
|
msgid "Plugin"
|
|
msgstr "Plugin"
|
|
|
|
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
|
|
msgid "Registered for"
|
|
msgstr "Registriert für"
|
|
|
|
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Dateiname"
|
|
|
|
#: tfrmoptionsplugins.tsdsx.caption
|
|
msgid "&Search plugins (.DSX)"
|
|
msgstr "&Such-Plugins (.DSX)"
|
|
|
|
#: tfrmoptionsplugins.tswcx.caption
|
|
msgid "Pac&ker plugins (.WCX)"
|
|
msgstr "Pac&ker-Plugins (.WCX)"
|
|
|
|
#: tfrmoptionsplugins.tswdx.caption
|
|
msgid "Content pl&ugins (.WDX)"
|
|
msgstr "Inhalt-Pl&ugin (.WDX)"
|
|
|
|
#: tfrmoptionsplugins.tswfx.caption
|
|
msgid "F&ile system plugins (.WFX)"
|
|
msgstr "Date&isystem-Plugins (.WFX)"
|
|
|
|
#: tfrmoptionsplugins.tswlx.caption
|
|
msgid "&Viewer plugins (.WLX)"
|
|
msgstr "&Betrachter-PlugIns"
|
|
|
|
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
|
|
msgid "&Beginning (name must start with first typed character)"
|
|
msgstr "&Beginn (Name soll mit dem ersten eingetippten Buchstaben beginnen)"
|
|
|
|
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
|
|
msgid "En&ding (last character before a typed dot . must match)"
|
|
msgstr "Ende des Namens (letztes Zeichen vor einem . soll passen)"
|
|
|
|
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
|
msgid "Options"
|
|
msgstr "Optionen"
|
|
|
|
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
|
msgid "Exact name match"
|
|
msgstr "Exakte Übereinstimmung des &Names"
|
|
|
|
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
|
msgid "Search case"
|
|
msgstr "Suche Schreibweise"
|
|
|
|
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
|
msgid "Search for these items"
|
|
msgstr "Suche nach diesen Einträgen"
|
|
|
|
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
|
msgid "Keep renamed name when unlocking a tab"
|
|
msgstr "Umbennung erhalten, wenn ein Tab entsperrt wird"
|
|
|
|
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
|
|
msgid "Activate target &panel when clicking on one of its Tabs"
|
|
msgstr "Ziel-&Panel auswählen, wenn eines seiner Tabs angeklickt wird"
|
|
|
|
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
|
|
msgid "&Show tab header also when there is only one tab"
|
|
msgstr "&Tab-Titel auch zeigen wenn nur einer vorhanden"
|
|
|
|
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
|
msgid "Close duplicate tabs when closing application"
|
|
msgstr "Doppelte Tabs schließen wenn DC geschlossen wird"
|
|
|
|
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
|
|
msgid "Con&firm close all tabs"
|
|
msgstr "&Schließen aller Tabs bestätigen"
|
|
|
|
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
|
msgid "Confirm close locked tabs"
|
|
msgstr "Schließen von gesperrten Tabs bestätigen"
|
|
|
|
#: tfrmoptionstabs.cbtabslimitoption.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
|
|
msgid "&Limit tab title length to"
|
|
msgstr "Begrenze Tab-Tite&lzeile auf"
|
|
|
|
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
|
|
msgid "Show locked tabs &with an asterisk *"
|
|
msgstr "Alle gesperrten Tabs mit Stern * markieren"
|
|
|
|
#: tfrmoptionstabs.cbtabsmultilines.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
|
|
msgid "&Tabs on multiple lines"
|
|
msgstr "Rei&ter-Titel auf mehrere Zeilen verteilen"
|
|
|
|
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
|
|
msgid "Ctrl+&Up opens new tab in foreground"
|
|
msgstr "Strg+Pf&eil hoch öffnet einen neuen Tab im Vordergrund"
|
|
|
|
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
|
|
msgid "Open &new tabs near current tab"
|
|
msgstr "&Neuen Tab neben aktuellem Tab einfügen"
|
|
|
|
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
|
msgid "Reuse existing tab when possible"
|
|
msgstr "Bestehenden Tab erneut nutze, wenn möglich"
|
|
|
|
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
|
|
msgid "Show ta&b close button"
|
|
msgstr "Zeige Button um Ta&bs zu schließen"
|
|
|
|
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
|
msgid "Always show drive letter in tab title"
|
|
msgstr "Laufwerksbuchstaben im Tab-Titel immer zeigen"
|
|
|
|
#: tfrmoptionstabs.gbtabs.caption
|
|
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
|
|
msgid "Folder tabs headers"
|
|
msgstr "Verzeichnis-Tab-Titel"
|
|
|
|
#: tfrmoptionstabs.lblchar.caption
|
|
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
|
|
msgid "characters"
|
|
msgstr "Bu&chstaben"
|
|
|
|
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
|
msgid "Action to do when double click on a tab:"
|
|
msgstr "Aktion festlegen, wenn auf den Tab-Titel doppel-geklickt wird"
|
|
|
|
#: tfrmoptionstabs.lbltabsposition.caption
|
|
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
|
|
msgid "Ta&bs position"
|
|
msgstr "Rei&ter-Position"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
|
msgid "None"
|
|
msgstr "Nichts"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
|
msgid "No"
|
|
msgstr "Nein"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
|
msgid "Goto to Favorite Tabs Configuration after resaving"
|
|
msgstr "Nach dem erneuten Speichern zur-Tab-Konfiguration wechseln"
|
|
|
|
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
|
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
|
msgstr "Nach dem Speichern eines neuen Tab zur-Tab-Konfiguration wechseln"
|
|
|
|
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
|
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
|
msgstr "Extra-Optionen für Favoriten-Tabs ermöglichen (Zielseite beim Wiederherstellen auswählen, etc.)"
|
|
|
|
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
|
msgid "Default extra settings when saving new Favorite Tabs:"
|
|
msgstr "Standard-Extra-Einstellungen zum Speichern neuer Favoriten-Tabs:"
|
|
|
|
#: tfrmoptionstabsextra.gbtabs.caption
|
|
msgid "Folder tabs headers extra"
|
|
msgstr "Extras für Tabs-Header"
|
|
|
|
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
|
msgid "When restoring tab, existing tabs to keep:"
|
|
msgstr "Wenn Tabs wiederhergestellt werden, diese erhalten:"
|
|
|
|
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
|
msgid "Tabs saved on left will be restored to:"
|
|
msgstr "Links gespeicherte Tabs sollen hier wiederhergestellt werden:"
|
|
|
|
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
|
msgid "Tabs saved on right will be restored to:"
|
|
msgstr "Rechts gespeicherte Tabs sollen hier wiederhergestellt werden:"
|
|
|
|
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
|
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
|
msgid "Keep saving dir history with Favorite Tabs:"
|
|
msgstr "Verzeichnis-Verlauf weiter speichern bei diesen Favoriten-Tabs:"
|
|
|
|
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
|
msgid "Default position in menu when saving a new Favorite Tabs:"
|
|
msgstr "Standardposition im Menü beim Speicherneines neuen Favoriten-Tabs:"
|
|
|
|
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr "{Befehl} sollte normalerweise hier angezeigt werden um den Befehl im Terminal auszuführen"
|
|
|
|
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr "{Befehl} sollte normalerweise hier angezeigt werden um den Befehl im Terminal auszuführen"
|
|
|
|
#: tfrmoptionsterminal.edruntermparams.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr "{Befehl} sollte normalerweise hier angezeigt werden um den Befehl im Terminal auszuführen"
|
|
|
|
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
|
msgid "Command for just running terminal:"
|
|
msgstr "Befehl um das Terminal auszuführen"
|
|
|
|
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
|
msgid "Command for running a command in terminal and close after:"
|
|
msgstr "Befehl um einen Befehl im Terminal auszuführen und es anschließend zu schließen:"
|
|
|
|
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
|
msgid "Command for running a command in terminal and stay open:"
|
|
msgstr "Befehl um einen Befehl im Terminal auszuführen und es anschließend offen zu halten:"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Befehl"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Parameter"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Befehl"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Parameter"
|
|
|
|
#: tfrmoptionsterminal.lbruntermcmd.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Befehl"
|
|
|
|
#: tfrmoptionsterminal.lbruntermparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Parameter"
|
|
|
|
#: tfrmoptionstoolbar.btnclonebutton.caption
|
|
msgid "C&lone button"
|
|
msgstr "S&Button klonen"
|
|
|
|
#: tfrmoptionstoolbar.btndeletebutton.caption
|
|
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
|
|
msgid "&Delete"
|
|
msgstr "L&öschen"
|
|
|
|
#: tfrmoptionstoolbar.btnedithotkey.caption
|
|
msgid "Edit hot&key"
|
|
msgstr "Tastatur&kürzel bearbeiten"
|
|
|
|
#: tfrmoptionstoolbar.btninsertbutton.caption
|
|
msgid "&Insert new button"
|
|
msgstr "Neuen Button e&infügen"
|
|
|
|
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
|
msgid "Select"
|
|
msgstr "Auswählen"
|
|
|
|
#: tfrmoptionstoolbar.btnopenfile.caption
|
|
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstoolbar.btnother.caption
|
|
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
|
msgid "Other..."
|
|
msgstr "Andere..."
|
|
|
|
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
|
msgctxt "tfrmoptionstoolbar.btnremovehotkey.caption"
|
|
msgid "Remove hotke&y"
|
|
msgstr "Tastaturk&ürzel entfernen"
|
|
|
|
#: tfrmoptionstoolbar.btnstartpath.caption
|
|
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
|
msgid "Suggest"
|
|
msgstr "Vorschlag"
|
|
|
|
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
|
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
|
msgstr "DC einen Vorschlag für den Tooltip anhand des Buttons, Befehls oder Parameters machen lassen"
|
|
|
|
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
|
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
|
msgid "&Flat buttons"
|
|
msgstr "&Flache Buttons"
|
|
|
|
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
|
msgid "Report errors with commands"
|
|
msgstr "Berichte Fehler mit Befehlen"
|
|
|
|
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
|
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
|
msgstr "Befehlsparameter eingeben, jeden in einer eigenen Zeile. [F1] drücken um Hilfe zu Parametern zu erhalten."
|
|
|
|
#: tfrmoptionstoolbar.gbgroupbox.caption
|
|
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
|
|
msgid "Appearance"
|
|
msgstr "Aussehen"
|
|
|
|
#: tfrmoptionstoolbar.lblbarsize.caption
|
|
msgid "&Bar size:"
|
|
msgstr "Höhe de&r Leiste:"
|
|
|
|
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
|
msgid "Comman&d:"
|
|
msgstr "&Befehl:"
|
|
|
|
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
|
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
|
|
msgid "Parameter&s:"
|
|
msgstr "&Parameter:"
|
|
|
|
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
|
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
|
|
msgid "Help"
|
|
msgstr "Hilfe"
|
|
|
|
#: tfrmoptionstoolbar.lblhotkey.caption
|
|
msgid "Hot key:"
|
|
msgstr "Tastaturkürzel:"
|
|
|
|
#: tfrmoptionstoolbar.lbliconfile.caption
|
|
msgctxt "tfrmoptionstoolbar.lbliconfile.caption"
|
|
msgid "Ico&n:"
|
|
msgstr "Ico&n:"
|
|
|
|
#: tfrmoptionstoolbar.lbliconsize.caption
|
|
msgid "Icon si&ze:"
|
|
msgstr "Größe der I&cons:"
|
|
|
|
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
|
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
|
|
msgid "Co&mmand:"
|
|
msgstr "&Befehl:"
|
|
|
|
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
|
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
|
|
msgid "&Parameters:"
|
|
msgstr "&Parameter:"
|
|
|
|
#: tfrmoptionstoolbar.lblstartpath.caption
|
|
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
|
msgid "Start pat&h:"
|
|
msgstr "Start&pfad"
|
|
|
|
#: tfrmoptionstoolbar.lbltooltip.caption
|
|
msgid "&Tooltip:"
|
|
msgstr "&Tooltip:"
|
|
|
|
#: tfrmoptionstoolbar.miaddallcmds.caption
|
|
msgid "Add toolbar with ALL DC commands"
|
|
msgstr "Toolbar mit ALLEN DC-Befehlen hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
|
msgid "for an external command"
|
|
msgstr "für externen Befehl"
|
|
|
|
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
|
msgid "for an internal command"
|
|
msgstr "für internen Befehl"
|
|
|
|
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
|
msgid "for a separator"
|
|
msgstr "für ein Trennzeichen"
|
|
|
|
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
|
msgid "for a sub-tool bar"
|
|
msgstr "für ein Untermenü"
|
|
|
|
#: tfrmoptionstoolbar.mibackup.caption
|
|
msgctxt "tfrmoptionstoolbar.mibackup.caption"
|
|
msgid "Backup..."
|
|
msgstr "Backup..."
|
|
|
|
#: tfrmoptionstoolbar.miexport.caption
|
|
msgctxt "tfrmoptionstoolbar.miexport.caption"
|
|
msgid "Export..."
|
|
msgstr "Exportieren..."
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrent.caption
|
|
msgid "Current toolbar..."
|
|
msgstr "Aktuelle Toolbar..."
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
|
|
msgid "to a Toolbar File (.toolbar)"
|
|
msgstr "in eine Toolbar-Datei"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
|
|
msgid "to a TC .BAR file (keep existing)"
|
|
msgstr "in eine TC .bar - Datei (bestehende erhalten)"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
|
|
msgid "to a TC .BAR file (erase existing)"
|
|
msgstr "in eine TC .bar - Datei (bestehende überschreiben)"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
|
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende erhalten)"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
|
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende ersetzen)"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator1.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator2.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator3.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator4.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexporttop.caption
|
|
msgid "Top toolbar..."
|
|
msgstr "Top-Toolbar..."
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
|
msgid "Save a backup of Toolbar"
|
|
msgstr "speichere ein Backup der Toolbar"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
|
msgid "to a Toolbar File (.toolbar)"
|
|
msgstr "in eine Toolbar-Datei (.toolbar)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
|
msgid "to a TC .BAR file (keep existing)"
|
|
msgstr "in eine TC .bar - Datei (bestehende erhalten)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
|
msgid "to a TC .BAR file (erase existing)"
|
|
msgstr "in eine TC .bar - Datei (bestehende überschreiben)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
|
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende erhalten)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
|
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende ersetzen)"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr "direkt hinter der aktuellen Auswahl"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr "als erstes Element"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr "als letztes Element"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr "direkt vor die aktuelle Auswahl"
|
|
|
|
#: tfrmoptionstoolbar.miimport.caption
|
|
msgctxt "tfrmoptionstoolbar.miimport.caption"
|
|
msgid "Import..."
|
|
msgstr "Importieren..."
|
|
|
|
#: tfrmoptionstoolbar.miimportbackup.caption
|
|
msgid "Restore a backup of Toolbar"
|
|
msgstr "Backup einer Toolbar wieder herstellen"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr "zur aktuellen Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr "zu neuer Toolbar in der aktuellen Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr "zu einer neuen Toolbar auf oberster Toolbarebene hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr "zu oberster Toolbarebene hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr "die oberste Toolbarebene ersetzen"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbar.caption
|
|
msgid "from a Toolbar File (.toolbar)"
|
|
msgstr "aus einer Toolbar-Datei (.toolbar)"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr "zu aktueller Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr "zu neuer Toolbar in der aktueller Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr "zu neuer Toolbar an oberster Position der Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr "zu oberster Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr "die oberste Toolbar ersetzen"
|
|
|
|
#: tfrmoptionstoolbar.miimportseparator.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbar.caption
|
|
msgid "from a single TC .BAR file"
|
|
msgstr "aus einzelner TC .bar - Datei"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr "zu aktueller Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr "zu einer neuen Toolbar in der aktuellen Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr "zu einer neuen Toolbar der obersten Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr "zu oberster Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr "die oberste Toolbar ersetzen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcini.caption
|
|
msgid "from \"wincmd.ini\" of TC..."
|
|
msgstr "aus \"wincmd.ini\" des TC"
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr "zu aktueller Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr "zu einer neuen Toolbar in der aktuellen Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr "zu einer neuen Toolbar in der obersten Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr "zur obersten Toolbar hinzufügen"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr "die oberste Toolbar ersetzen"
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr "direkt hinter die aktuelle Markierung"
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr "als erstes Element"
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr "als letztes Element"
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr "direkt vor die aktuelle Markierung"
|
|
|
|
#: tfrmoptionstoolbar.misearchandreplace.caption
|
|
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
|
|
msgid "Search and replace..."
|
|
msgstr "Suchen und Ersetzen..."
|
|
|
|
#: tfrmoptionstoolbar.miseparator1.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator10.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator11.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator13.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator14.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator2.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator6.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator7.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator8.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator9.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr "direkt hinter die aktuelle Markierung"
|
|
|
|
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
|
msgid "as first element"
|
|
msgstr "als erstes Element"
|
|
|
|
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr "als letztes Element"
|
|
|
|
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr "direkt vor die aktuelle Markierung"
|
|
|
|
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
|
msgid "in all of all the above..."
|
|
msgstr "Alle in allen oberhalb..."
|
|
|
|
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
|
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
|
msgid "in all commands..."
|
|
msgstr "in allen Befehlen..."
|
|
|
|
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
|
msgid "in all icon names..."
|
|
msgstr "in allen Icon-Bezeichnungen..."
|
|
|
|
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
|
msgid "in all parameters..."
|
|
msgstr "in allen Parametern..."
|
|
|
|
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
|
msgid "in all start path..."
|
|
msgstr "in allen Startpfaden..."
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr "direkt hinter die aktuelle Markierung"
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr "als erstes Element"
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr "als letztes Element"
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr "direkt vor die aktuelle Markierung"
|
|
|
|
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
|
msgid "Button type"
|
|
msgstr "Button-Typ"
|
|
|
|
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
|
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
|
msgid "&Keep terminal window open after executing program"
|
|
msgstr "&Konsolenfenster offen lassen, wenn der Vorgang abgeschlossen ist"
|
|
|
|
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
|
msgid "&Execute in terminal"
|
|
msgstr "In Konsol&enfenster ausführen"
|
|
|
|
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
|
msgid "&Use external program"
|
|
msgstr "Externes Programm ben&utzen"
|
|
|
|
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
|
msgid "A&dditional parameters"
|
|
msgstr "Zus&ätzliche Parameter"
|
|
|
|
#: tfrmoptionstoolbase.lbltoolspath.caption
|
|
msgid "&Path to program to execute"
|
|
msgstr "&Pfad zum ausführbaren Programm"
|
|
|
|
#: tfrmoptionstooltips.btnaddfields.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "&Hinzufügen"
|
|
|
|
#: tfrmoptionstooltips.btnapplyfields.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "&Übernehmen"
|
|
|
|
#: tfrmoptionstooltips.btndeletefields.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
|
|
msgid "D&elete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmoptionstooltips.btnfieldslist.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
|
msgid "Template..."
|
|
msgstr "Vorlage..."
|
|
|
|
#: tfrmoptionstooltips.chkshowtooltip.caption
|
|
msgid "&Show tooltip for files in the file panel"
|
|
msgstr "Zeige Tooltips (Hinweistexte) für Dateien im Panel"
|
|
|
|
#: tfrmoptionstooltips.gbcustomfields.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
|
|
msgid "Custom fields by file type"
|
|
msgstr "Angepasste Felder nach Dateityp"
|
|
|
|
#: tfrmoptionstooltips.lblfieldslist.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
|
|
msgid "Category &hint:"
|
|
msgstr "Kategorie-&Hinweis:"
|
|
|
|
#: tfrmoptionstooltips.lblfieldsmask.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
|
msgid "Category &mask:"
|
|
msgstr "Kategorie&maske"
|
|
|
|
#: tfrmoptionstooltips.lblfieldsname.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
|
|
msgid "Category &name:"
|
|
msgstr "Kategorie&name"
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
|
msgid "With double-click on the bar on top of a file panel"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
|
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
|
msgid "With the menu and internal command"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
|
msgid "Double click in tree select and exit"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
|
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
|
|
msgid "With the menu and internal command"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
|
msgid "With double-click on a tab (if configured for it)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
|
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
|
msgid "Single mouse click in tree select and exit"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
|
msgid "Use it for Command Line History"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
|
msgid "Use it for the Dir History"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
|
msgid "Use it for the View History (Visited paths for active view)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
|
msgid "Behavior regarding selection:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
|
msgid "Tree View Menus related options:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
|
msgid "Where to use Tree View Menus:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblnote.caption
|
|
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
|
msgid "With Directory Hotlist:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
|
msgid "With Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
|
msgid "With History:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
|
msgid "Use and display keyboard shortcut for choosing items"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
|
msgid "Layout and colors options:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
|
msgid "Background color:"
|
|
msgstr "Hintergrundfarbe:"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
|
msgid "Cursor color:"
|
|
msgstr "Cursorfarbe:"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
|
msgid "Found text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
|
msgid "Found text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
|
msgid "Normal text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
|
msgid "Normal text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
|
msgid "Tree View Menu Preview:"
|
|
msgstr "Baumansicht Menü Vorschau:"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
|
msgid "Secondary text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
|
msgid "Secondary text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
|
msgid "Shortcut color:"
|
|
msgstr "Tastaturkürzel Farbe:"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
|
msgid "Shortcut under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
|
msgid "Unselectable text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
|
msgid "Unselectable under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
|
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
|
msgid "Viewer Book Mode"
|
|
msgstr "Buchartige Ansicht"
|
|
|
|
#: tfrmoptionsviewer.gbviewerexample.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
|
|
msgid "Example"
|
|
msgstr "Beispiel"
|
|
|
|
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
|
msgid "&Background color in book viewer"
|
|
msgstr "Hintergrundfarbe in der &buchartigen Ansicht"
|
|
|
|
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
|
msgid "&Font color in book viewer"
|
|
msgstr "Schri&ftfarbe in der buchartigen Ansicht"
|
|
|
|
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
|
msgid "&Number of columns in book viewer"
|
|
msgstr "A&nzahl der Spalten in der buchartigen Ansicht"
|
|
|
|
#: tfrmpackdlg.btnconfig.caption
|
|
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
|
msgid "Con&figure"
|
|
msgstr "Kon&figurieren"
|
|
|
|
#: tfrmpackdlg.caption
|
|
msgctxt "TFRMPACKDLG.CAPTION"
|
|
msgid "Pack files"
|
|
msgstr "Packe Dateien"
|
|
|
|
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
|
msgid "C&reate separate archives, one per selected file/dir"
|
|
msgstr "Für jede ausgewählte Datei/Verzeichnis ein seperates Archiv erstellen"
|
|
|
|
#: tfrmpackdlg.cbcreatesfx.caption
|
|
msgid "Create self e&xtracting archive"
|
|
msgstr "SF&X-Archiv erstellen"
|
|
|
|
#: tfrmpackdlg.cbencrypt.caption
|
|
msgid "Encr&ypt"
|
|
msgstr "Verschl&üsseln"
|
|
|
|
#: tfrmpackdlg.cbmovetoarchive.caption
|
|
msgid "Mo&ve to archive"
|
|
msgstr "In Archiv &verschieben"
|
|
|
|
#: tfrmpackdlg.cbmultivolume.caption
|
|
msgid "&Multiple disk archive"
|
|
msgstr "Archiv auf&teilen"
|
|
|
|
#: tfrmpackdlg.cbotherplugins.caption
|
|
msgid "=>"
|
|
msgstr "=>"
|
|
|
|
#: tfrmpackdlg.cbputintarfirst.caption
|
|
msgid "P&ut in the TAR archive first"
|
|
msgstr "Z&uerst in einem TAR-Archiv zusammenfassen"
|
|
|
|
#: tfrmpackdlg.cbstoredir.caption
|
|
msgid "Also &pack path names (only recursed)"
|
|
msgstr "Pfadnamen &mitspeichern (nur abwärts)"
|
|
|
|
#: tfrmpackdlg.lblprompt.caption
|
|
msgid "Pack file(s) to the file:"
|
|
msgstr "Packe Datei(en) in Archiv"
|
|
|
|
#: tfrmpackdlg.rgpacker.caption
|
|
msgid "Packer"
|
|
msgstr "Packer"
|
|
|
|
#: tfrmpackinfodlg.btnclose.caption
|
|
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
|
msgid "Unpack &all and execute"
|
|
msgstr "&Alle entpacken und ausführen"
|
|
|
|
#: tfrmpackinfodlg.btnunpackandexec.caption
|
|
msgid "&Unpack and execute"
|
|
msgstr "&Entpacken und ausführen"
|
|
|
|
#: tfrmpackinfodlg.caption
|
|
msgctxt "TFRMPACKINFODLG.CAPTION"
|
|
msgid "Properties of packed file"
|
|
msgstr "Eigenschaften der gepackten Datei(en)"
|
|
|
|
#: tfrmpackinfodlg.lblattributes.caption
|
|
msgid "Attributes:"
|
|
msgstr "Attribute:"
|
|
|
|
#: tfrmpackinfodlg.lblcompressionratio.caption
|
|
msgid "Compression ratio:"
|
|
msgstr "Kompressionsverhältnis:"
|
|
|
|
#: tfrmpackinfodlg.lbldate.caption
|
|
msgid "Date:"
|
|
msgstr "Datum:"
|
|
|
|
#: tfrmpackinfodlg.lblmethod.caption
|
|
msgid "Method:"
|
|
msgstr "Methode:"
|
|
|
|
#: tfrmpackinfodlg.lbloriginalsize.caption
|
|
msgid "Original size:"
|
|
msgstr "Originalgröße"
|
|
|
|
#: tfrmpackinfodlg.lblpackedfile.caption
|
|
msgid "File:"
|
|
msgstr "Datei:"
|
|
|
|
#: tfrmpackinfodlg.lblpackedsize.caption
|
|
msgid "Packed size:"
|
|
msgstr "Gepackte Größe:"
|
|
|
|
#: tfrmpackinfodlg.lblpacker.caption
|
|
msgid "Packer:"
|
|
msgstr "Packer:"
|
|
|
|
#: tfrmpackinfodlg.lbltime.caption
|
|
msgid "Time:"
|
|
msgstr "Zeit:"
|
|
|
|
#: tfrmquicksearch.btncancel.caption
|
|
msgctxt "tfrmquicksearch.btncancel.caption"
|
|
msgid "X"
|
|
msgstr "X"
|
|
|
|
#: tfrmquicksearch.btncancel.hint
|
|
msgid "Close filter panel"
|
|
msgstr "Filter-Panel schließen"
|
|
|
|
#: tfrmquicksearch.edtsearch.hint
|
|
msgid "Enter text to search for or filter by"
|
|
msgstr "Text eingeben, nach dem gesucht oder gefiltert werden soll"
|
|
|
|
#: tfrmquicksearch.sbcasesensitive.caption
|
|
msgid "Aa"
|
|
msgstr ""
|
|
|
|
#: tfrmquicksearch.sbcasesensitive.hint
|
|
msgid "Case Sensitive"
|
|
msgstr "Abhängig von der Schreibweise"
|
|
|
|
#: tfrmquicksearch.sbdirectories.caption
|
|
msgid "D"
|
|
msgstr ""
|
|
|
|
#: tfrmquicksearch.sbdirectories.hint
|
|
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
|
msgid "Directories"
|
|
msgstr "Verzeichnisse"
|
|
|
|
#: tfrmquicksearch.sbfiles.caption
|
|
msgid "F"
|
|
msgstr ""
|
|
|
|
#: tfrmquicksearch.sbfiles.hint
|
|
msgctxt "tfrmquicksearch.sbfiles.hint"
|
|
msgid "Files"
|
|
msgstr "Dateien"
|
|
|
|
#: tfrmquicksearch.sbmatchbeginning.caption
|
|
msgid "{"
|
|
msgstr ""
|
|
|
|
#: tfrmquicksearch.sbmatchbeginning.hint
|
|
msgid "Match Beginning"
|
|
msgstr "Entspricht dem Anfang"
|
|
|
|
#: tfrmquicksearch.sbmatchending.caption
|
|
msgid "}"
|
|
msgstr ""
|
|
|
|
#: tfrmquicksearch.sbmatchending.hint
|
|
msgid "Match Ending"
|
|
msgstr "Entspricht der Endung"
|
|
|
|
#: tfrmquicksearch.tglfilter.caption
|
|
msgctxt "tfrmquicksearch.tglfilter.caption"
|
|
msgid "Filter"
|
|
msgstr "Filter"
|
|
|
|
#: tfrmquicksearch.tglfilter.hint
|
|
msgid "Toggle between search or filter"
|
|
msgstr "Umschalten zwischen Suchen und Filtern"
|
|
|
|
#: tfrmsearchplugin.btnadd.caption
|
|
msgid "&More rules"
|
|
msgstr "&Mehr Regeln"
|
|
|
|
#: tfrmsearchplugin.btndelete.caption
|
|
msgid "L&ess rules"
|
|
msgstr "W&eniger Regeln"
|
|
|
|
#: tfrmsearchplugin.chkuseplugins.caption
|
|
msgid "Use &content plugins, combine with:"
|
|
msgstr "Nutze Inhalt-Plugins, kombiniere mit:"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[0].text
|
|
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
|
|
msgid "Plugin"
|
|
msgstr "Plugin"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[1].text
|
|
msgid "Field"
|
|
msgstr "Feld"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[2].text
|
|
msgid "Operator"
|
|
msgstr "Operator"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[3].text
|
|
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
|
msgid "Value"
|
|
msgstr "Wert"
|
|
|
|
#: tfrmsearchplugin.rband.caption
|
|
msgid "&AND (all match)"
|
|
msgstr "&UND (alles stimmt überein)"
|
|
|
|
#: tfrmsearchplugin.rbor.caption
|
|
msgid "&OR (any match)"
|
|
msgstr "&ODER (irgendeine Übereinstimmung)"
|
|
|
|
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Abbrechen"
|
|
|
|
#: tfrmselecttextrange.btppanel.closebutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "&Hilfe"
|
|
|
|
#: tfrmselecttextrange.btppanel.okbutton.caption
|
|
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmselecttextrange.lblselecttext.caption
|
|
msgid "&Select the characters to insert:"
|
|
msgstr "Zeichen zum Einfügen au&swählen:"
|
|
|
|
#: tfrmsetfileproperties.btncancel.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmsetfileproperties.btnok.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmsetfileproperties.caption
|
|
msgid "Change attributes"
|
|
msgstr "Ändern von Dateieigenschaften"
|
|
|
|
#: tfrmsetfileproperties.cbsgid.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmsetfileproperties.cbsticky.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Dauerhaft"
|
|
|
|
#: tfrmsetfileproperties.cbsuid.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmsetfileproperties.chkarchive.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
|
|
msgid "Archive"
|
|
msgstr "Archiv"
|
|
|
|
#: tfrmsetfileproperties.chkcreationtime.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
|
|
msgid "Created:"
|
|
msgstr "Erstellt:"
|
|
|
|
#: tfrmsetfileproperties.chkhidden.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
|
|
msgid "Hidden"
|
|
msgstr "Versteckt"
|
|
|
|
#: tfrmsetfileproperties.chklastaccesstime.caption
|
|
msgid "Accessed:"
|
|
msgstr "Zugriff:"
|
|
|
|
#: tfrmsetfileproperties.chklastwritetime.caption
|
|
msgid "Modified:"
|
|
msgstr "Geändert"
|
|
|
|
#: tfrmsetfileproperties.chkreadonly.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
|
|
msgid "Read only"
|
|
msgstr "Schreibgeschützt"
|
|
|
|
#: tfrmsetfileproperties.chkrecursive.caption
|
|
msgid "Including subfolders"
|
|
msgstr "Auch Unterverzeichnisse"
|
|
|
|
#: tfrmsetfileproperties.chksystem.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
|
|
msgid "System"
|
|
msgstr "System"
|
|
|
|
#: tfrmsetfileproperties.gbtimesamp.caption
|
|
msgid "Timestamp properties"
|
|
msgstr "Zeitstempel-Eigenschaften"
|
|
|
|
#: tfrmsetfileproperties.gbunixattributes.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Attribute"
|
|
|
|
#: tfrmsetfileproperties.gbwinattributes.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Attribute"
|
|
|
|
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bits:"
|
|
|
|
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Gruppe"
|
|
|
|
#: tfrmsetfileproperties.lblattrinfo.caption
|
|
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
|
msgid "(gray field means unchanged value)"
|
|
msgstr "(Ein graues Feld bedeutet, dass ein Wert unverändert bleibt)"
|
|
|
|
#: tfrmsetfileproperties.lblattrotherstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Andere"
|
|
|
|
#: tfrmsetfileproperties.lblattrownerstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Besitzer"
|
|
|
|
#: tfrmsetfileproperties.lblattrtext.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
|
msgid "-----------"
|
|
msgstr "-----------"
|
|
|
|
#: tfrmsetfileproperties.lblattrtextstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
|
msgid "Text:"
|
|
msgstr "Darstellung im Text"
|
|
|
|
#: tfrmsetfileproperties.lblexec.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Ausführen"
|
|
|
|
#: tfrmsetfileproperties.lblmodeinfo.caption
|
|
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
|
|
msgid "(gray field means unchanged value)"
|
|
msgstr "(Ein graues Feld bedeutet, dass ein Wert unverändert bleibt)"
|
|
|
|
#: tfrmsetfileproperties.lbloctal.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
|
msgid "Octal:"
|
|
msgstr "Oktal:"
|
|
|
|
#: tfrmsetfileproperties.lblread.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Lesen"
|
|
|
|
#: tfrmsetfileproperties.lblwrite.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Schreiben"
|
|
|
|
#: tfrmsplitter.btncancel.caption
|
|
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Ende"
|
|
|
|
#: tfrmsplitter.btnftchoice.caption
|
|
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmsplitter.btnok.caption
|
|
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmsplitter.btnrelativeftchoice.hint
|
|
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Einige Funktionen um angemessene Pfade zu wählen"
|
|
|
|
#: tfrmsplitter.caption
|
|
msgctxt "TFRMSPLITTER.CAPTION"
|
|
msgid "Splitter"
|
|
msgstr "Teiler"
|
|
|
|
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
|
msgid "Require a CRC32 verification file"
|
|
msgstr "Benötigt eine CRC32-Datei zum Verifizieren"
|
|
|
|
#: tfrmsplitter.cmbxsize.text
|
|
msgid "1457664B - 3.5\""
|
|
msgstr "1457664B - 3.5\""
|
|
|
|
#: tfrmsplitter.grbxfile.caption
|
|
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Dateiname"
|
|
|
|
#: tfrmsplitter.grbxsize.caption
|
|
msgid "Size and number of parts"
|
|
msgstr "Größe und Anzahl der Teilstücke"
|
|
|
|
#: tfrmsplitter.lbdirtarget.caption
|
|
msgid "Directory &target"
|
|
msgstr "&Zielverzeichnis"
|
|
|
|
#: tfrmsplitter.lbfilesource.caption
|
|
msgid "File &source"
|
|
msgstr "Datei&quelle"
|
|
|
|
#: tfrmsplitter.lblnumberparts.caption
|
|
msgid "&Number of parts"
|
|
msgstr "A&nzahl der Teile"
|
|
|
|
#: tfrmsplitter.rbtnbyte.caption
|
|
msgid "&Bytes"
|
|
msgstr "&Bytes"
|
|
|
|
#: tfrmsplitter.rbtngigab.caption
|
|
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
|
|
msgid "&Gigabytes"
|
|
msgstr "&Gigabytes"
|
|
|
|
#: tfrmsplitter.rbtnkilob.caption
|
|
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
|
|
msgid "&Kilobytes"
|
|
msgstr "&Kilobytes"
|
|
|
|
#: tfrmsplitter.rbtnmegab.caption
|
|
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
|
|
msgid "&Megabytes"
|
|
msgstr "&Megabytes"
|
|
|
|
#: tfrmstartingsplash.caption
|
|
msgctxt "tfrmstartingsplash.caption"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmstartingsplash.lblbuild.caption
|
|
msgctxt "tfrmstartingsplash.lblbuild.caption"
|
|
msgid "Build"
|
|
msgstr "Build"
|
|
|
|
#: tfrmstartingsplash.lblfreepascalver.caption
|
|
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
|
|
msgid "Free Pascal"
|
|
msgstr "Free Pascal"
|
|
|
|
#: tfrmstartingsplash.lbllazarusver.caption
|
|
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: tfrmstartingsplash.lbloperatingsystem.caption
|
|
msgid "Operating System"
|
|
msgstr "Betriebssystem"
|
|
|
|
#: tfrmstartingsplash.lblplatform.caption
|
|
msgid "Platform"
|
|
msgstr "Maschinen-Typ"
|
|
|
|
#: tfrmstartingsplash.lblrevision.caption
|
|
msgctxt "tfrmstartingsplash.lblrevision.caption"
|
|
msgid "Revision"
|
|
msgstr "Revision"
|
|
|
|
#: tfrmstartingsplash.lbltitle.caption
|
|
msgctxt "tfrmstartingsplash.lbltitle.caption"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmstartingsplash.lblversion.caption
|
|
msgctxt "tfrmstartingsplash.lblversion.caption"
|
|
msgid "Version"
|
|
msgstr "Version"
|
|
|
|
#: tfrmstartingsplash.lblwidgetsetver.caption
|
|
msgid "WidgetsetVer"
|
|
msgstr ""
|
|
|
|
#: tfrmsymlink.btncancel.caption
|
|
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Abbrechen"
|
|
|
|
#: tfrmsymlink.btnok.caption
|
|
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmsymlink.caption
|
|
msgid "Create symbolic link"
|
|
msgstr "Erstelle symb. Link"
|
|
|
|
#: tfrmsymlink.lblexistingfile.caption
|
|
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
|
msgid "&Destination that the link will point to"
|
|
msgstr "Bestehen&des Ziel, auf das die Verknüpfung zeigen soll"
|
|
|
|
#: tfrmsymlink.lbllinktocreate.caption
|
|
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
|
msgid "&Link name"
|
|
msgstr "&Verknüpfungsname"
|
|
|
|
#: tfrmsyncdirsdlg.btnclose.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
|
|
msgid "Close"
|
|
msgstr "Schließen"
|
|
|
|
#: tfrmsyncdirsdlg.btncompare.caption
|
|
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
|
|
msgid "Compare"
|
|
msgstr "Vergleiche"
|
|
|
|
#: tfrmsyncdirsdlg.btnseldir1.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmsyncdirsdlg.btnseldir2.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
|
msgid "Synchronize"
|
|
msgstr "Synchronisiere"
|
|
|
|
#: tfrmsyncdirsdlg.caption
|
|
msgid "Synchronize directories"
|
|
msgstr "Synchronisiere Verzeichnisse"
|
|
|
|
#: tfrmsyncdirsdlg.cbextfilter.text
|
|
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
|
|
msgid "*.*"
|
|
msgstr "*"
|
|
|
|
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
|
msgid "asymmetric"
|
|
msgstr "asymetrisch"
|
|
|
|
#: tfrmsyncdirsdlg.chkbycontent.caption
|
|
msgid "by content"
|
|
msgstr "nach Inhalt"
|
|
|
|
#: tfrmsyncdirsdlg.chkignoredate.caption
|
|
msgid "ignore date"
|
|
msgstr "ignoriere Datum"
|
|
|
|
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
|
msgid "only selected"
|
|
msgstr "nur ausgewählte"
|
|
|
|
#: tfrmsyncdirsdlg.chksubdirs.caption
|
|
msgid "Subdirs"
|
|
msgstr "Unterverzeichnisse"
|
|
|
|
#: tfrmsyncdirsdlg.groupbox1.caption
|
|
msgid "Show:"
|
|
msgstr "Zeige:"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
|
|
msgid "Name"
|
|
msgstr "Name"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
|
|
msgid "Size"
|
|
msgstr "Größe"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
|
|
msgid "Date"
|
|
msgstr "Datum"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
|
msgid "<=>"
|
|
msgstr "<=>"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
|
|
msgid "Date"
|
|
msgstr "Datum"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
|
|
msgid "Size"
|
|
msgstr "Größe"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
|
|
msgid "Name"
|
|
msgstr "Name"
|
|
|
|
#: tfrmsyncdirsdlg.label1.caption
|
|
msgid "(in main window)"
|
|
msgstr "(im Hauptfenster)"
|
|
|
|
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
|
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
|
|
msgid "Compare"
|
|
msgstr "Vergleiche"
|
|
|
|
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
|
msgid "View left"
|
|
msgstr "Ansicht links"
|
|
|
|
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
|
msgid "View right"
|
|
msgstr "Ansicht rechts"
|
|
|
|
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
|
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
|
|
msgid "<"
|
|
msgstr "<"
|
|
|
|
#: tfrmsyncdirsdlg.sbcopyright.caption
|
|
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
|
|
msgid ">"
|
|
msgstr ">"
|
|
|
|
#: tfrmsyncdirsdlg.sbduplicates.caption
|
|
msgid "duplicates"
|
|
msgstr "Duplikate"
|
|
|
|
#: tfrmsyncdirsdlg.sbequal.caption
|
|
msgid "="
|
|
msgstr "="
|
|
|
|
#: tfrmsyncdirsdlg.sbnotequal.caption
|
|
msgid "!="
|
|
msgstr "!="
|
|
|
|
#: tfrmsyncdirsdlg.sbsingles.caption
|
|
msgid "singles"
|
|
msgstr "Einzelne"
|
|
|
|
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
|
msgid "Please press \"Compare\" to start"
|
|
msgstr "Bitte \"Vergleiche\" anklicken um zu beginnen"
|
|
|
|
#: tfrmsyncdirsperformdlg.caption
|
|
msgctxt "tfrmsyncdirsperformdlg.caption"
|
|
msgid "Synchronize"
|
|
msgstr "Synchronisieren"
|
|
|
|
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
|
msgid "Confirm overwrites"
|
|
msgstr "Überschreiben bestätigen"
|
|
|
|
#: tfrmtreeviewmenu.caption
|
|
msgctxt "tfrmtreeviewmenu.caption"
|
|
msgid "Tree View Menu"
|
|
msgstr "Baumansicht Menü"
|
|
|
|
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
|
msgid "Select your hot directory:"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
|
msgid "Search is case sensitive"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
|
msgid "Full collapse"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmifullexpand.caption
|
|
msgid "Full expand"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
|
msgid "Search ignore accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
|
msgid "Search is not case sensitive"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
|
msgid "Search is strict regarding accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
|
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
|
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
|
msgid "Close Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
|
|
msgid "Configuration of Tree View Menu"
|
|
msgstr "Konfiguration Baumansicht Menü"
|
|
|
|
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
|
|
msgid "Configuration of Tree View Menu Colors"
|
|
msgstr "Konfiguration Baumansicht Menü Farben"
|
|
|
|
#: tfrmtweakplugin.btnadd.caption
|
|
msgid "A&dd new"
|
|
msgstr "&Neue hinzufügen"
|
|
|
|
#: tfrmtweakplugin.btncancel.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "A&bbruch"
|
|
|
|
#: tfrmtweakplugin.btnchange.caption
|
|
msgid "C&hange"
|
|
msgstr "&Ändern"
|
|
|
|
#: tfrmtweakplugin.btndefault.caption
|
|
msgid "De&fault"
|
|
msgstr "&Standard"
|
|
|
|
#: tfrmtweakplugin.btnok.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmtweakplugin.btnremove.caption
|
|
msgctxt "tfrmtweakplugin.btnremove.caption"
|
|
msgid "&Remove"
|
|
msgstr "Entfe&rnen"
|
|
|
|
#: tfrmtweakplugin.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
|
|
msgid "Tweak plugin"
|
|
msgstr "Anpass-PlugIn"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
|
msgid "De&tect archive type by content"
|
|
msgstr "Archiv&typ am Inhalt erkennen"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
|
msgid "Can de&lete files"
|
|
msgstr "Kann Dateien &löschen"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
|
msgid "Supports e&ncryption"
|
|
msgstr "U&nterstützt Verschlüsselung"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
|
msgid "Sho&w as normal files (hide packer icon)"
|
|
msgstr "A&ls normale Dateien zeigen (Packer-Symbol verstecken)"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
|
msgid "Supports pac&king in memory"
|
|
msgstr "Unterstützt &Kompression im Arbeitsspeicher"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
|
msgid "Can &modify existing archives"
|
|
msgstr "Ka&nn bestehende Archive verändern"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
|
msgid "&Archive can contain multiple files"
|
|
msgstr "&Archive können mehrere Dateien enthalten"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_new.caption
|
|
msgid "Can create new archi&ves"
|
|
msgstr "Kann neue Archi&ve erstellen"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_options.caption
|
|
msgid "S&upports the options dialogbox"
|
|
msgstr "&Unterstützt die Optionen-Dialogbox"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
|
msgid "Allow searchin&g for text in archives"
|
|
msgstr "Suche von Te&xt in Archiven erlauben"
|
|
|
|
#: tfrmtweakplugin.lbldescription.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
|
|
msgid "&Description:"
|
|
msgstr "&Beschreibung:"
|
|
|
|
#: tfrmtweakplugin.lbldetectstr.caption
|
|
msgid "D&etect string:"
|
|
msgstr "&Erkenne String:"
|
|
|
|
#: tfrmtweakplugin.lblextension.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
|
|
msgid "&Extension:"
|
|
msgstr "&Endung:"
|
|
|
|
#: tfrmtweakplugin.lblflags.caption
|
|
msgid "Flags:"
|
|
msgstr "Flags:"
|
|
|
|
#: tfrmtweakplugin.lblname.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
|
|
msgid "&Name:"
|
|
msgstr "&Name:"
|
|
|
|
#: tfrmtweakplugin.lblplugin.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
|
msgid "&Plugin:"
|
|
msgstr "&Plugin:"
|
|
|
|
#: tfrmtweakplugin.lblplugin1.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
|
|
msgid "&Plugin:"
|
|
msgstr "&Plugin:"
|
|
|
|
#: tfrmviewer.actabout.caption
|
|
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
|
|
msgid "About Viewer..."
|
|
msgstr "Über den Be&trachter..."
|
|
|
|
#: tfrmviewer.actabout.hint
|
|
msgid "Displays the About message"
|
|
msgstr "Zeigt den 'Über'-Dialog"
|
|
|
|
#: tfrmviewer.actchangeencoding.caption
|
|
msgid "Change encoding"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actcopyfile.caption
|
|
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
|
msgid "Copy File"
|
|
msgstr "Datei kopieren"
|
|
|
|
#: tfrmviewer.actcopyfile.hint
|
|
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
|
msgid "Copy File"
|
|
msgstr "Datei kopieren"
|
|
|
|
#: tfrmviewer.actcopytoclipboard.caption
|
|
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
|
msgid "Copy To Clipboard"
|
|
msgstr "In &Zwischenablage kopieren"
|
|
|
|
#: tfrmviewer.actcopytoclipboardformatted.caption
|
|
msgid "Copy To Clipboard Formatted"
|
|
msgstr "In Zwischenablage kopieren mit &Format"
|
|
|
|
#: tfrmviewer.actdeletefile.caption
|
|
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
|
msgid "Delete File"
|
|
msgstr "Datei löschen"
|
|
|
|
#: tfrmviewer.actdeletefile.hint
|
|
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
|
msgid "Delete File"
|
|
msgstr "Datei löschen"
|
|
|
|
#: tfrmviewer.actexitviewer.caption
|
|
msgctxt "tfrmviewer.actexitviewer.caption"
|
|
msgid "E&xit"
|
|
msgstr "&Beenden"
|
|
|
|
#: tfrmviewer.actfind.caption
|
|
msgctxt "tfrmviewer.actfind.caption"
|
|
msgid "Find"
|
|
msgstr "Finde"
|
|
|
|
#: tfrmviewer.actfindnext.caption
|
|
msgctxt "tfrmviewer.actfindnext.caption"
|
|
msgid "Find next"
|
|
msgstr "Finde nächste"
|
|
|
|
#: tfrmviewer.actfindprev.caption
|
|
msgctxt "tfrmviewer.actfindprev.caption"
|
|
msgid "Find previous"
|
|
msgstr "Finde vorherige"
|
|
|
|
#: tfrmviewer.actfullscreen.caption
|
|
msgctxt "tfrmviewer.actfullscreen.caption"
|
|
msgid "Full Screen"
|
|
msgstr "Ganzer Bildschirm"
|
|
|
|
#: tfrmviewer.actimagecenter.caption
|
|
msgctxt "tfrmviewer.actimagecenter.caption"
|
|
msgid "Center"
|
|
msgstr "Zentrieren"
|
|
|
|
#: tfrmviewer.actloadnextfile.caption
|
|
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
|
|
msgid "&Next"
|
|
msgstr "&Nächste"
|
|
|
|
#: tfrmviewer.actloadnextfile.hint
|
|
msgid "Load Next File"
|
|
msgstr "Nächste Datei laden"
|
|
|
|
#: tfrmviewer.actloadprevfile.caption
|
|
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
|
|
msgid "&Previous"
|
|
msgstr "&Vorherige"
|
|
|
|
#: tfrmviewer.actloadprevfile.hint
|
|
msgid "Load Previous File"
|
|
msgstr "Vorherige Datei laden"
|
|
|
|
#: tfrmviewer.actmirrorhorz.caption
|
|
msgid "Mirror Horizontally"
|
|
msgstr "Horizontal spiegeln"
|
|
|
|
#: tfrmviewer.actmirrorhorz.hint
|
|
msgctxt "tfrmviewer.actmirrorhorz.hint"
|
|
msgid "Mirror"
|
|
msgstr "Spiegeln"
|
|
|
|
#: tfrmviewer.actmirrorvert.caption
|
|
msgid "Mirror Vertically"
|
|
msgstr "Vertikal spiegeln"
|
|
|
|
#: tfrmviewer.actmovefile.caption
|
|
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
|
msgid "Move File"
|
|
msgstr "Datei verschieben"
|
|
|
|
#: tfrmviewer.actmovefile.hint
|
|
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
|
msgid "Move File"
|
|
msgstr "Datei verschieben"
|
|
|
|
#: tfrmviewer.actpreview.caption
|
|
msgctxt "tfrmviewer.actpreview.caption"
|
|
msgid "Preview"
|
|
msgstr "Vorschau"
|
|
|
|
#: tfrmviewer.actreload.caption
|
|
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
|
msgid "Reload"
|
|
msgstr "Neu &laden"
|
|
|
|
#: tfrmviewer.actreload.hint
|
|
msgid "Reload current file"
|
|
msgstr "Aktuelle Datei neu laden"
|
|
|
|
#: tfrmviewer.actrotate180.caption
|
|
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
|
|
msgid "+ 180"
|
|
msgstr "+ 180"
|
|
|
|
#: tfrmviewer.actrotate180.hint
|
|
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
|
|
msgid "Rotate 180 degrees"
|
|
msgstr "Um 180 Grad drehen"
|
|
|
|
#: tfrmviewer.actrotate270.caption
|
|
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
|
|
msgid "- 90"
|
|
msgstr "- 90"
|
|
|
|
#: tfrmviewer.actrotate270.hint
|
|
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
|
|
msgid "Rotate -90 degrees"
|
|
msgstr "-90 Grad drehen"
|
|
|
|
#: tfrmviewer.actrotate90.caption
|
|
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
|
|
msgid "+ 90"
|
|
msgstr "Um 90 Grad drehen"
|
|
|
|
#: tfrmviewer.actrotate90.hint
|
|
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
|
|
msgid "Rotate +90 degrees"
|
|
msgstr "Um +90 Grad drehen"
|
|
|
|
#: tfrmviewer.actsave.caption
|
|
msgctxt "tfrmviewer.actsave.caption"
|
|
msgid "Save"
|
|
msgstr "Speichern"
|
|
|
|
#: tfrmviewer.actsaveas.caption
|
|
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
|
|
msgid "Save As..."
|
|
msgstr "Speichern unter..."
|
|
|
|
#: tfrmviewer.actsaveas.hint
|
|
msgid "Save File As..."
|
|
msgstr "Datei speichern unter..."
|
|
|
|
#: tfrmviewer.actscreenshot.caption
|
|
msgctxt "tfrmviewer.actscreenshot.caption"
|
|
msgid "Screenshot"
|
|
msgstr "Anzeige als Bild kopieren (Screenshot)"
|
|
|
|
#: tfrmviewer.actscreenshotdelay3sec.caption
|
|
msgid "Delay 3 sec"
|
|
msgstr "3 Sekunden verzögern"
|
|
|
|
#: tfrmviewer.actscreenshotdelay5sec.caption
|
|
msgid "Delay 5 sec"
|
|
msgstr "5 Sekunden verzögern"
|
|
|
|
#: tfrmviewer.actselectall.caption
|
|
msgctxt "tfrmviewer.actselectall.caption"
|
|
msgid "Select All"
|
|
msgstr "Alle mar&kieren"
|
|
|
|
#: tfrmviewer.actshowasbin.caption
|
|
msgctxt "tfrmviewer.actshowasbin.caption"
|
|
msgid "Show as &Bin"
|
|
msgstr "Bin&är anzeigen"
|
|
|
|
#: tfrmviewer.actshowasbook.caption
|
|
msgctxt "tfrmviewer.actshowasbook.caption"
|
|
msgid "Show as B&ook"
|
|
msgstr "Wie ein &Buch anzeigen"
|
|
|
|
#: tfrmviewer.actshowasdec.caption
|
|
msgid "Show as &Dec"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actshowashex.caption
|
|
msgctxt "tfrmviewer.actshowashex.caption"
|
|
msgid "Show as &Hex"
|
|
msgstr "Als He&x anzeigen"
|
|
|
|
#: tfrmviewer.actshowastext.caption
|
|
msgctxt "tfrmviewer.actshowastext.caption"
|
|
msgid "Show as &Text"
|
|
msgstr "A&ls Text anzeigen"
|
|
|
|
#: tfrmviewer.actshowaswraptext.caption
|
|
msgctxt "tfrmviewer.actshowaswraptext.caption"
|
|
msgid "Show as &Wrap text"
|
|
msgstr "&Zeilenumbruch"
|
|
|
|
#: tfrmviewer.actshowgraphics.caption
|
|
msgctxt "tfrmviewer.actshowgraphics.caption"
|
|
msgid "Graphics"
|
|
msgstr "Bilder"
|
|
|
|
#: tfrmviewer.actshowplugins.caption
|
|
msgctxt "tfrmviewer.actshowplugins.caption"
|
|
msgid "Plugins"
|
|
msgstr "Plugins"
|
|
|
|
#: tfrmviewer.actstretchimage.caption
|
|
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
|
|
msgid "Stretch"
|
|
msgstr "Strecken"
|
|
|
|
#: tfrmviewer.actstretchimage.hint
|
|
msgid "Stretch Image"
|
|
msgstr "Bild strecken"
|
|
|
|
#: tfrmviewer.actstretchonlylarge.caption
|
|
msgctxt "tfrmviewer.actstretchonlylarge.caption"
|
|
msgid "Stretch only large"
|
|
msgstr "Nur große strecken"
|
|
|
|
#: tfrmviewer.actzoom.caption
|
|
msgid "Zoom"
|
|
msgstr "Vergrössern"
|
|
|
|
#: tfrmviewer.actzoomin.caption
|
|
msgctxt "tfrmviewer.actzoomin.caption"
|
|
msgid "Zoom In"
|
|
msgstr "Größer darstellen"
|
|
|
|
#: tfrmviewer.actzoomout.caption
|
|
msgctxt "tfrmviewer.actzoomout.caption"
|
|
msgid "Zoom Out"
|
|
msgstr "Kleiner darstellen"
|
|
|
|
#: tfrmviewer.btncopyfile.hint
|
|
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmviewer.btncopyfile1.hint
|
|
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: tfrmviewer.btncuttuimage.hint
|
|
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
|
|
msgid "Crop"
|
|
msgstr "Beschneiden"
|
|
|
|
#: tfrmviewer.btndeletefile.hint
|
|
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmviewer.btndeletefile1.hint
|
|
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: tfrmviewer.btnfullscreen.hint
|
|
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
|
msgid "Full Screen"
|
|
msgstr "Ganzer Bildschirm"
|
|
|
|
#: tfrmviewer.btngifmove.caption
|
|
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
|
msgid "||"
|
|
msgstr "||"
|
|
|
|
#: tfrmviewer.btngiftobmp.caption
|
|
msgid "S"
|
|
msgstr "S"
|
|
|
|
#: tfrmviewer.btnhightlight.hint
|
|
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
|
msgid "Highlight"
|
|
msgstr "Markieren"
|
|
|
|
#: tfrmviewer.btnmovefile.hint
|
|
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
|
|
msgid "Move"
|
|
msgstr "Verschieben"
|
|
|
|
#: tfrmviewer.btnmovefile1.hint
|
|
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
|
|
msgid "Move"
|
|
msgstr "Verschieben"
|
|
|
|
#: tfrmviewer.btnnextgifframe.caption
|
|
msgid "||>"
|
|
msgstr "||>"
|
|
|
|
#: tfrmviewer.btnpaint.hint
|
|
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
|
msgid "Paint"
|
|
msgstr "Malen"
|
|
|
|
#: tfrmviewer.btnprevgifframe.caption
|
|
msgid "<||"
|
|
msgstr "<||"
|
|
|
|
#: tfrmviewer.btnredeye.hint
|
|
msgid "Red Eyes"
|
|
msgstr "Rote Augen"
|
|
|
|
#: tfrmviewer.btnresize.hint
|
|
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
|
|
msgid "Resize"
|
|
msgstr "Größe ändern"
|
|
|
|
#: tfrmviewer.btnundo.hint
|
|
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
|
msgid "Undo"
|
|
msgstr "Rückgängig machen"
|
|
|
|
#: tfrmviewer.caption
|
|
msgctxt "tfrmviewer.caption"
|
|
msgid "Viewer"
|
|
msgstr "Schnellansicht"
|
|
|
|
#: tfrmviewer.cbslideshow.caption
|
|
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
|
msgid "Slide Show"
|
|
msgstr "Bilder automatisch nacheinander anzeigen (Slideshow)"
|
|
|
|
#: tfrmviewer.comboboxpaint.text
|
|
msgid "Pen"
|
|
msgstr "Stift"
|
|
|
|
#: tfrmviewer.comboboxwidth.text
|
|
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmviewer.gboxhightlight.caption
|
|
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
|
msgid "Highlight"
|
|
msgstr "Markieren"
|
|
|
|
#: tfrmviewer.gboxpaint.caption
|
|
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
|
msgid "Paint"
|
|
msgstr "Malen"
|
|
|
|
#: tfrmviewer.gboxslideshow.caption
|
|
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
|
msgid "Slide Show"
|
|
msgstr "Bilder automatisch nacheinander anzeigen (Slideshow)"
|
|
|
|
#: tfrmviewer.gboxview.caption
|
|
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
|
msgid "View"
|
|
msgstr "Betrachten"
|
|
|
|
#: tfrmviewer.lblhightlight.caption
|
|
msgid "0x0"
|
|
msgstr "0x0"
|
|
|
|
#: tfrmviewer.miabout.caption
|
|
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "&Über"
|
|
|
|
#: tfrmviewer.midiv1.caption
|
|
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.midiv2.caption
|
|
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.midiv3.caption
|
|
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.midiv4.caption
|
|
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.midiv5.caption
|
|
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.miedit.caption
|
|
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Bearbeiten"
|
|
|
|
#: tfrmviewer.miencoding.caption
|
|
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
|
msgid "En&coding"
|
|
msgstr "&Kodierung"
|
|
|
|
#: tfrmviewer.mifile.caption
|
|
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
|
msgid "&File"
|
|
msgstr "&Datei"
|
|
|
|
#: tfrmviewer.miimage.caption
|
|
msgid "&Image"
|
|
msgstr "B&ild"
|
|
|
|
#: tfrmviewer.miprint.caption
|
|
msgid "Print..."
|
|
msgstr "Drucken..."
|
|
|
|
#: tfrmviewer.mirotate.caption
|
|
msgid "Rotate"
|
|
msgstr "Drehen"
|
|
|
|
#: tfrmviewer.miscreenshot.caption
|
|
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
|
msgid "Screenshot"
|
|
msgstr "Anzeige kopieren (Screenshot)"
|
|
|
|
#: tfrmviewer.miseparator.caption
|
|
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.miview.caption
|
|
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
|
msgid "&View"
|
|
msgstr "&Anzeigen"
|
|
|
|
#: tfrmviewer.pmiselectall.caption
|
|
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
|
msgid "Select All"
|
|
msgstr "Alle mar&kieren"
|
|
|
|
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
|
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
|
|
msgid "When file exists"
|
|
msgstr "Wenn die Datei vorhanden ist"
|
|
|
|
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
|
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
|
|
msgid "When file exists"
|
|
msgstr "Wenn die Datei vorhanden ist"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
|
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
|
|
msgid "Copy d&ate/time"
|
|
msgstr "D&atum/Zeit kopieren"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
|
msgid "Work in background (separate connection)"
|
|
msgstr "Im Hintergrund ausführen (eigene Verbindung)"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When file exists"
|
|
msgstr "Wenn Datei vorhanden"
|
|
|
|
#: uexifreader.rsdatetimeoriginal
|
|
msgid "Date taken"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsimageheight
|
|
#, fuzzy
|
|
msgctxt "uexifreader.rsimageheight"
|
|
msgid "Height"
|
|
msgstr "Höhe"
|
|
|
|
#: uexifreader.rsimagewidth
|
|
#, fuzzy
|
|
msgctxt "uexifreader.rsimagewidth"
|
|
msgid "Width"
|
|
msgstr "Breite"
|
|
|
|
#: uexifreader.rsmake
|
|
msgid "Manufacturer"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsmodel
|
|
msgid "Camera model"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsorientation
|
|
msgid "Orientation"
|
|
msgstr ""
|
|
|
|
#: ulng.msgtrytolocatecrcfile
|
|
msgid ""
|
|
"This file cannot be found and could help to validate final combination of files:\n"
|
|
"%s\n"
|
|
"\n"
|
|
"Could you make it available and press \"OK\" when ready,\n"
|
|
"or press \"CANCEL\" to continue without it?\n"
|
|
msgstr ""
|
|
"Die Datei konnte nicht gefunden werden, aber könnte helfen die vorhandenen zu prüfen:\n"
|
|
"%s\n"
|
|
"\n"
|
|
"Kann sie manuell zur Verfügung gestellt werden? Dann bitte \"Ok\" klicken,\n"
|
|
"oder \"Abbrechen\" klicken um ohne sie fortzusetzen.\n"
|
|
|
|
#: ulng.rscancelfilter
|
|
msgid "Cancel Quick Filter"
|
|
msgstr "Schnell-Filter abbrechen"
|
|
|
|
#: ulng.rscanceloperation
|
|
msgid "Cancel Current Operation"
|
|
msgstr "Aktuellen Vorgang abbrechen"
|
|
|
|
#: ulng.rscaptionforaskingfilename
|
|
msgid "Enter filename, with extension, for dropped text"
|
|
msgstr "Dateinamen eingeben, mit Endung, für gezogenen Text"
|
|
|
|
#: ulng.rscaptionfortextformattoimport
|
|
msgid "Text format to import"
|
|
msgstr "Zu importierendes Textformat"
|
|
|
|
#: ulng.rschecksumverifybroken
|
|
msgid "Broken:"
|
|
msgstr "Kompromitiert:"
|
|
|
|
#: ulng.rschecksumverifygeneral
|
|
msgid "General:"
|
|
msgstr "Allgemein:"
|
|
|
|
#: ulng.rschecksumverifymissing
|
|
msgid "Missing:"
|
|
msgstr "Fehlend:"
|
|
|
|
#: ulng.rschecksumverifyreaderror
|
|
msgid "Read error:"
|
|
msgstr "Lesefehler:"
|
|
|
|
#: ulng.rschecksumverifysuccess
|
|
msgid "Success:"
|
|
msgstr "Erfolg:"
|
|
|
|
#: ulng.rschecksumverifytext
|
|
msgid "Enter checksum and select algorithm:"
|
|
msgstr "Prüfsumme eingeben und Algorithmus auswählen"
|
|
|
|
#: ulng.rschecksumverifytitle
|
|
msgid "Verify checksum"
|
|
msgstr "Checksum verifizieren"
|
|
|
|
#: ulng.rschecksumverifytotal
|
|
msgid "Total:"
|
|
msgstr "Gesamt:"
|
|
|
|
#: ulng.rsclearfiltersornot
|
|
msgid "Do you want to clear filters for this new search?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
|
msgid "Clipboard doesn't contain any valid toolbar data."
|
|
msgstr "Die Zwischenablage enthält keine gültigen Daten für die Werkzeugleiste."
|
|
|
|
#: ulng.rscmdcategorylistinorder
|
|
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
|
msgstr "Alle;aktives Panel;Linkes Panel;rechtes Panel;Datei-Operationen;Konfiguration;Netzwerk;Verschiedenes;Paralleler Anschluss;Druck;Markierung;Sicherheit;Zwischenablage;FTP;Navigation;Hilfe;Fenster;Befehlszeile;Werkzeuge;Ansicht;Benutzer;Tabs;Sortierung;Log"
|
|
|
|
#: ulng.rscmdkindofsort
|
|
msgid "Legacy sorted;A-Z sorted"
|
|
msgstr "Ablauf sortiert;A-Z sortiert"
|
|
|
|
#: ulng.rscolattr
|
|
msgid "Attr"
|
|
msgstr "Attribute"
|
|
|
|
#: ulng.rscoldate
|
|
msgctxt "ulng.rscoldate"
|
|
msgid "Date"
|
|
msgstr "Datum"
|
|
|
|
#: ulng.rscolext
|
|
msgid "Ext"
|
|
msgstr "Erw."
|
|
|
|
#: ulng.rscolname
|
|
msgctxt "ulng.rscolname"
|
|
msgid "Name"
|
|
msgstr "Name"
|
|
|
|
#: ulng.rscolsize
|
|
msgctxt "ulng.rscolsize"
|
|
msgid "Size"
|
|
msgstr "Größe"
|
|
|
|
#: ulng.rsconfcolalign
|
|
msgid "Align"
|
|
msgstr "Ausrichten"
|
|
|
|
#: ulng.rsconfcolcaption
|
|
msgid "Caption"
|
|
msgstr "Überschrift"
|
|
|
|
#: ulng.rsconfcoldelete
|
|
msgctxt "ulng.rsconfcoldelete"
|
|
msgid "Delete"
|
|
msgstr "&Löschen"
|
|
|
|
#: ulng.rsconfcolfieldcont
|
|
msgid "Field contents"
|
|
msgstr "Feldinhalt"
|
|
|
|
#: ulng.rsconfcolmove
|
|
msgctxt "ulng.rsconfcolmove"
|
|
msgid "Move"
|
|
msgstr "Verschieben"
|
|
|
|
#: ulng.rsconfcolwidth
|
|
msgctxt "ulng.rsconfcolwidth"
|
|
msgid "Width"
|
|
msgstr "Breite"
|
|
|
|
#: ulng.rsconfcustheader
|
|
msgid "Customize column"
|
|
msgstr "Spalten anpassen"
|
|
|
|
#: ulng.rsconfigurationfileassociation
|
|
msgid "Configure file association"
|
|
msgstr "Dateiverknüpfungen konfigurieren"
|
|
|
|
#: ulng.rsconfirmexecution
|
|
msgid "Confirming command line and parameters"
|
|
msgstr "Befehlszeile und Parameter bestätigen"
|
|
|
|
#: ulng.rscopynametemplate
|
|
msgid "Copy (%d) %s"
|
|
msgstr "Kopie (%d) %s"
|
|
|
|
#: ulng.rsdefaultimporteddctoolbarhint
|
|
msgid "Imported DC toolbar"
|
|
msgstr "Importierte DC-Toolbar"
|
|
|
|
#: ulng.rsdefaultimportedtctoolbarhint
|
|
msgid "Imported TC toolbar"
|
|
msgstr "Importierte TC-Toolbar"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtext
|
|
msgid "_DroppedText"
|
|
msgstr "_Gezogener Text"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
|
msgid "_DroppedHTMLtext"
|
|
msgstr "_Gezogener HTML-Text"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
|
msgid "_DroppedRichtext"
|
|
msgstr "_Gezogener RichText"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
|
msgid "_DroppedSimpleText"
|
|
msgstr "_Gezogener einfacher Text"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
|
msgid "_DroppedUnicodeUTF16text"
|
|
msgstr "_Gezogener UnicodeUTF16-Text"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
|
msgid "_DroppedUnicodeUTF8text"
|
|
msgstr "_Gezogener UnicodeUTF8-Text"
|
|
|
|
#: ulng.rsdiffadds
|
|
msgid " Adds: "
|
|
msgstr " Fügt hinzu: "
|
|
|
|
#: ulng.rsdiffdeletes
|
|
msgid " Deletes: "
|
|
msgstr " Löscht: "
|
|
|
|
#: ulng.rsdifffilesidentical
|
|
msgid "The two files are identical!"
|
|
msgstr "Die Dateien sind identisch!"
|
|
|
|
#: ulng.rsdiffmatches
|
|
msgid " Matches: "
|
|
msgstr " Entspricht: "
|
|
|
|
#: ulng.rsdiffmodifies
|
|
msgid " Modifies: "
|
|
msgstr " Verändert: "
|
|
|
|
#: ulng.rsdlgbuttonabort
|
|
msgid "Ab&ort"
|
|
msgstr "&Unterbrechen"
|
|
|
|
#: ulng.rsdlgbuttonall
|
|
msgctxt "ulng.rsdlgbuttonall"
|
|
msgid "A&ll"
|
|
msgstr "A&lle"
|
|
|
|
#: ulng.rsdlgbuttonappend
|
|
msgid "A&ppend"
|
|
msgstr "An&hängen"
|
|
|
|
#: ulng.rsdlgbuttonautorenamesource
|
|
msgid "A&uto-rename source files"
|
|
msgstr "Quelldateien a&utomatisch umbenennen"
|
|
|
|
#: ulng.rsdlgbuttoncancel
|
|
msgctxt "ulng.rsdlgbuttoncancel"
|
|
msgid "&Cancel"
|
|
msgstr "Abbru&ch"
|
|
|
|
#: ulng.rsdlgbuttoncontinue
|
|
msgid "&Continue"
|
|
msgstr "Fortset&zen"
|
|
|
|
#: ulng.rsdlgbuttoncopyinto
|
|
#, fuzzy
|
|
#| msgid "Copy &Into"
|
|
msgid "&Merge"
|
|
msgstr "Zunächst nur d&ieses Verzeichnis kopieren"
|
|
|
|
#: ulng.rsdlgbuttoncopyintoall
|
|
#, fuzzy
|
|
#| msgid "Copy Into &All"
|
|
msgid "Mer&ge All"
|
|
msgstr "&Alle bestehenden Verzeichnisse kopieren"
|
|
|
|
#: ulng.rsdlgbuttonexitprogram
|
|
msgid "E&xit program"
|
|
msgstr "&Programm beenden"
|
|
|
|
#: ulng.rsdlgbuttonignore
|
|
msgid "Ig&nore"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttonignoreall
|
|
msgid "I&gnore All"
|
|
msgstr "Alle i&gnorieren"
|
|
|
|
#: ulng.rsdlgbuttonno
|
|
msgid "&No"
|
|
msgstr "&Nein"
|
|
|
|
#: ulng.rsdlgbuttonnone
|
|
msgid "Non&e"
|
|
msgstr "&Keine"
|
|
|
|
#: ulng.rsdlgbuttonok
|
|
msgctxt "ulng.rsdlgbuttonok"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: ulng.rsdlgbuttonother
|
|
msgid "Ot&her"
|
|
msgstr "A&ndere"
|
|
|
|
#: ulng.rsdlgbuttonoverwrite
|
|
msgid "&Overwrite"
|
|
msgstr "&Überschreiben"
|
|
|
|
#: ulng.rsdlgbuttonoverwriteall
|
|
msgid "Overwrite &All"
|
|
msgstr "Alle &vorhandenen Dateien überschreiben"
|
|
|
|
#: ulng.rsdlgbuttonoverwritelarger
|
|
msgid "Overwrite All &Larger"
|
|
msgstr "A&lle größeren Dateien überschreiben"
|
|
|
|
#: ulng.rsdlgbuttonoverwriteolder
|
|
msgid "Overwrite All Ol&der"
|
|
msgstr "Alle älteren &Dateien überschreiben"
|
|
|
|
#: ulng.rsdlgbuttonoverwritesmaller
|
|
msgid "Overwrite All S&maller"
|
|
msgstr "Alle &kleineren Dateien überschreiben"
|
|
|
|
#: ulng.rsdlgbuttonrename
|
|
msgctxt "ulng.rsdlgbuttonrename"
|
|
msgid "R&ename"
|
|
msgstr "Umb&enennen"
|
|
|
|
#: ulng.rsdlgbuttonresume
|
|
msgid "&Resume"
|
|
msgstr "Fo&rtsetzen"
|
|
|
|
#: ulng.rsdlgbuttonretry
|
|
msgid "Re&try"
|
|
msgstr "&Wiederholen"
|
|
|
|
#: ulng.rsdlgbuttonretryadmin
|
|
msgid "As Ad&ministrator"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttonskip
|
|
msgid "&Skip"
|
|
msgstr "Übe&rspringen"
|
|
|
|
#: ulng.rsdlgbuttonskipall
|
|
msgid "S&kip All"
|
|
msgstr "Übers&pringe alle"
|
|
|
|
#: ulng.rsdlgbuttonyes
|
|
msgid "&Yes"
|
|
msgstr "&Ja"
|
|
|
|
#: ulng.rsdlgcp
|
|
msgctxt "ulng.rsdlgcp"
|
|
msgid "Copy file(s)"
|
|
msgstr "Datei(en) kopieren"
|
|
|
|
#: ulng.rsdlgmv
|
|
msgid "Move file(s)"
|
|
msgstr "Datei(en) verschieben"
|
|
|
|
#: ulng.rsdlgoppause
|
|
msgctxt "ulng.rsdlgoppause"
|
|
msgid "Pau&se"
|
|
msgstr "Pau&se"
|
|
|
|
#: ulng.rsdlgopstart
|
|
msgctxt "ulng.rsdlgopstart"
|
|
msgid "&Start"
|
|
msgstr "&Starten"
|
|
|
|
#: ulng.rsdlgqueue
|
|
msgctxt "ulng.rsdlgqueue"
|
|
msgid "Queue"
|
|
msgstr "Warteschlange"
|
|
|
|
#: ulng.rsdlgspeed
|
|
msgid "Speed %s/s"
|
|
msgstr "Geschwindigkeit %s/s"
|
|
|
|
#: ulng.rsdlgspeedtime
|
|
msgid "Speed %s/s, time remaining %s"
|
|
msgstr "Geschwindigkeit %s/s, verbleibende Zeit %s"
|
|
|
|
#: ulng.rsdraganddroptextformat
|
|
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdrivenolabel
|
|
msgid "<no label>"
|
|
msgstr "<keine Bezeichnung>"
|
|
|
|
#: ulng.rsdrivenomedia
|
|
msgid "<no media>"
|
|
msgstr "<kein Medium>"
|
|
|
|
#: ulng.rseditabouttext
|
|
msgid "Internal Editor of Double Commander."
|
|
msgstr "Interner Text-Editor von Double Commander"
|
|
|
|
#: ulng.rseditgotolinequery
|
|
msgid "Goto line:"
|
|
msgstr "Gehe zu Zeile:"
|
|
|
|
#: ulng.rseditgotolinetitle
|
|
msgctxt "ulng.rseditgotolinetitle"
|
|
msgid "Goto Line"
|
|
msgstr "Gehe zu Zeile"
|
|
|
|
#: ulng.rseditnewfile
|
|
msgid "new.txt"
|
|
msgstr "Neu.txt"
|
|
|
|
#: ulng.rseditnewfilename
|
|
msgid "Filename:"
|
|
msgstr "Dateiname:"
|
|
|
|
#: ulng.rseditnewopen
|
|
msgid "Open file"
|
|
msgstr "Öffne Datei"
|
|
|
|
#: ulng.rseditsearchback
|
|
msgid "&Backward"
|
|
msgstr "&Zurück"
|
|
|
|
#: ulng.rseditsearchcaption
|
|
msgctxt "ulng.rseditsearchcaption"
|
|
msgid "Search"
|
|
msgstr "Suchen"
|
|
|
|
#: ulng.rseditsearchfrw
|
|
msgid "&Forward"
|
|
msgstr "&Vorwärts"
|
|
|
|
#: ulng.rseditsearchreplace
|
|
msgctxt "ulng.rseditsearchreplace"
|
|
msgid "Replace"
|
|
msgstr "Ersetzen"
|
|
|
|
#: ulng.rseditwithexternaleditor
|
|
msgid "with external editor"
|
|
msgstr "Mit externem Editor"
|
|
|
|
#: ulng.rseditwithinternaleditor
|
|
msgid "with internal editor"
|
|
msgstr "Mit internem Editor"
|
|
|
|
#: ulng.rsexecuteviashell
|
|
msgctxt "ulng.rsexecuteviashell"
|
|
msgid "Execute via shell"
|
|
msgstr "Auf der Befehlszeile ausführen"
|
|
|
|
#: ulng.rsexecuteviaterminalclose
|
|
msgctxt "ulng.rsexecuteviaterminalclose"
|
|
msgid "Execute via terminal and close"
|
|
msgstr "Im Terminal ausführen und schließen"
|
|
|
|
#: ulng.rsexecuteviaterminalstayopen
|
|
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
|
msgid "Execute via terminal and stay open"
|
|
msgstr "Im Terminal ausführen und offen lassen"
|
|
|
|
#: ulng.rsfavtabspanelsideselection
|
|
msgid "Left;Right;Active;Inactive;Both;None"
|
|
msgstr "Links;Rechts;Aktiv;Inaktiv;Beide;Nichts"
|
|
|
|
#: ulng.rsfavtabssavedirhistory
|
|
msgid "No;Yes"
|
|
msgstr "Ja;Nein"
|
|
|
|
#: ulng.rsfilenameexportedtcbarprefix
|
|
msgid "Exported_from_DC"
|
|
msgstr "Exportiert_aus_DC"
|
|
|
|
#: ulng.rsfileopdirectoryexistsoptions
|
|
#, fuzzy
|
|
#| msgid "Ask;Overwrite;Copy into;Skip"
|
|
msgid "Ask;Merge;Skip"
|
|
msgstr "Fragen;Überschreiben;Hinein kopieren;Überspringen"
|
|
|
|
#: ulng.rsfileopfileexistsoptions
|
|
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
|
msgstr "Fragen;Überschreiben;Ältere überschreiben;Überspringen"
|
|
|
|
#: ulng.rsfileopsetpropertyerroroptions
|
|
msgctxt "ulng.rsfileopsetpropertyerroroptions"
|
|
msgid "Ask;Don't set anymore;Ignore errors"
|
|
msgstr "Fragen;Niemals setzen;Fehler ignorieren"
|
|
|
|
#: ulng.rsfilterstatus
|
|
msgid "FILTER"
|
|
msgstr "Filter"
|
|
|
|
#: ulng.rsfinddefinetemplate
|
|
msgid "Define template"
|
|
msgstr "Vorlage definieren"
|
|
|
|
#: ulng.rsfinddepth
|
|
msgid "%s level(s)"
|
|
msgstr "%s Level(s)"
|
|
|
|
#: ulng.rsfinddepthall
|
|
msgid "all (unlimited depth)"
|
|
msgstr "Alle (Verzeichnistiefe unbegrenzt)"
|
|
|
|
#: ulng.rsfinddepthcurdir
|
|
msgid "current dir only"
|
|
msgstr "Nur das aktuelle Verzeichnis"
|
|
|
|
#: ulng.rsfinddirnoex
|
|
msgid "Directory %s does not exist!"
|
|
msgstr "Verzeichnis %s existiert nicht!"
|
|
|
|
#: ulng.rsfindfound
|
|
msgid "Found: %d"
|
|
msgstr "Gefunden: %d"
|
|
|
|
#: ulng.rsfindsavetemplatecaption
|
|
msgid "Save search template"
|
|
msgstr "Suche als Vorlage speichern"
|
|
|
|
#: ulng.rsfindsavetemplatetitle
|
|
msgid "Template name:"
|
|
msgstr "Vorlagen-Name"
|
|
|
|
#: ulng.rsfindscanned
|
|
msgid "Scanned: %d"
|
|
msgstr "Gelesen: %d"
|
|
|
|
#: ulng.rsfindscanning
|
|
msgid "Scanning"
|
|
msgstr "Suche"
|
|
|
|
#: ulng.rsfindsearchfiles
|
|
msgctxt "ulng.rsfindsearchfiles"
|
|
msgid "Find files"
|
|
msgstr "Dateien suchen"
|
|
|
|
#: ulng.rsfindtimeofscan
|
|
msgid "Time of scan: "
|
|
msgstr "Zeit des Scans:"
|
|
|
|
#: ulng.rsfindwherebeg
|
|
msgid "Begin at"
|
|
msgstr "Starte bei"
|
|
|
|
#: ulng.rsfreemsg
|
|
msgid "Free %s from %s bytes"
|
|
msgstr "%s Byte von %s frei"
|
|
|
|
#: ulng.rsfreemsgshort
|
|
msgid "%s bytes free"
|
|
msgstr "%s Bytes frei"
|
|
|
|
#: ulng.rsfuncatime
|
|
msgid "Access date/time"
|
|
msgstr "Datum/Zeit des letzten Zugriffs"
|
|
|
|
#: ulng.rsfuncattr
|
|
msgctxt "ulng.rsfuncattr"
|
|
msgid "Attributes"
|
|
msgstr "Attribute"
|
|
|
|
#: ulng.rsfunccomment
|
|
msgctxt "ulng.rsfunccomment"
|
|
msgid "Comment"
|
|
msgstr "Kommentar"
|
|
|
|
#: ulng.rsfunccompressedsize
|
|
msgid "Compressed size"
|
|
msgstr "Komprimierte Größe"
|
|
|
|
#: ulng.rsfuncctime
|
|
msgid "Creation date/time"
|
|
msgstr "Datum/Zeit der Erstellung"
|
|
|
|
#: ulng.rsfuncext
|
|
msgid "Extension"
|
|
msgstr "Endung"
|
|
|
|
#: ulng.rsfuncgroup
|
|
msgctxt "ulng.rsfuncgroup"
|
|
msgid "Group"
|
|
msgstr "Gruppe"
|
|
|
|
#: ulng.rsfunchtime
|
|
msgid "Change date/time"
|
|
msgstr "Datum/Zeit ändern"
|
|
|
|
#: ulng.rsfunclinkto
|
|
msgid "Link to"
|
|
msgstr "Vernüpfung mit"
|
|
|
|
#: ulng.rsfuncmtime
|
|
msgid "Modification date/time"
|
|
msgstr "Datum/Zeit der letzten Änderung"
|
|
|
|
#: ulng.rsfuncname
|
|
msgctxt "ulng.rsfuncname"
|
|
msgid "Name"
|
|
msgstr "Name"
|
|
|
|
#: ulng.rsfuncnamenoext
|
|
msgid "Name without extension"
|
|
msgstr "Name ohne Endung"
|
|
|
|
#: ulng.rsfuncowner
|
|
msgctxt "ulng.rsfuncowner"
|
|
msgid "Owner"
|
|
msgstr "Besitzer"
|
|
|
|
#: ulng.rsfuncpath
|
|
msgctxt "ulng.rsfuncpath"
|
|
msgid "Path"
|
|
msgstr "Pfad"
|
|
|
|
#: ulng.rsfuncsize
|
|
msgctxt "ulng.rsfuncsize"
|
|
msgid "Size"
|
|
msgstr "Größe"
|
|
|
|
#: ulng.rsfunctype
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: ulng.rsharderrcreate
|
|
msgid "Error creating hardlink."
|
|
msgstr "Fehler beim Erstellen des Hardlink."
|
|
|
|
#: ulng.rshotdirforcesortingorderchoices
|
|
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
|
msgstr "nichts;Name a-z;Name, z-a;Endung, a-z;Endung, z-a;Größe 9-0;Größe 0-9;Datum 9-0;Datum 0-9"
|
|
|
|
#: ulng.rshotdirwarningabortrestorebackup
|
|
msgid ""
|
|
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
|
"\n"
|
|
"Are you sure you want to proceed?\n"
|
|
msgstr ""
|
|
"Warnung! Wenn eine \"Hotlist\" Backupdatei restauriert wird, wird die existierende durch das Backup ersetzt\n"
|
|
"Sicher, dass weiter gemacht werden soll?\n"
|
|
|
|
#: ulng.rshotkeycategorycopymovedialog
|
|
msgid "Copy/Move Dialog"
|
|
msgstr "Kopieren/Verschieben-Dialog"
|
|
|
|
#: ulng.rshotkeycategorydiffer
|
|
msgctxt "ulng.rshotkeycategorydiffer"
|
|
msgid "Differ"
|
|
msgstr "Vergleichsprogramm"
|
|
|
|
#: ulng.rshotkeycategoryeditcommentdialog
|
|
msgid "Edit Comment Dialog"
|
|
msgstr "Bearbeite Kommentar-Dialog"
|
|
|
|
#: ulng.rshotkeycategoryeditor
|
|
msgctxt "ulng.rshotkeycategoryeditor"
|
|
msgid "Editor"
|
|
msgstr "Editor"
|
|
|
|
#: ulng.rshotkeycategoryfindfiles
|
|
msgctxt "ulng.rshotkeycategoryfindfiles"
|
|
msgid "Find files"
|
|
msgstr "Dateien suchen"
|
|
|
|
#: ulng.rshotkeycategorymain
|
|
msgid "Main"
|
|
msgstr "Haupt-Fenster"
|
|
|
|
#: ulng.rshotkeycategoryviewer
|
|
msgctxt "ulng.rshotkeycategoryviewer"
|
|
msgid "Viewer"
|
|
msgstr "Schnellansicht"
|
|
|
|
#: ulng.rshotkeyfilealreadyexists
|
|
msgid ""
|
|
"A setup with that name already exists.\n"
|
|
"Do you want to overwrite it?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileconfirmdefault
|
|
msgid "Are you sure you want to restore default?"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileconfirmerasure
|
|
msgid "Are you sure you want to erase setup \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilecopyof
|
|
msgid "Copy of %s"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileinputnewname
|
|
msgid "Input your new name"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilemustkeepone
|
|
msgid "You must keep at least one shortcut file."
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilenewname
|
|
msgid "New name"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilesavemodified
|
|
msgid ""
|
|
"\"%s\" setup has been modified.\n"
|
|
"Do you want to save it now?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeynoscenter
|
|
msgid "No shortcut with \"ENTER\""
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeysortorder
|
|
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsimporttoolbarproblem
|
|
msgid "Cannot find reference to default bar file"
|
|
msgstr "Kann Bezug zur Standard Bar-Datei nicht finden"
|
|
|
|
#: ulng.rslistoffindfileswindows
|
|
msgid "List of \"Find files\" windows"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmarkminus
|
|
msgid "Unselect mask"
|
|
msgstr "Maske abwählen"
|
|
|
|
#: ulng.rsmarkplus
|
|
msgid "Select mask"
|
|
msgstr "Wähle Maske"
|
|
|
|
#: ulng.rsmaskinput
|
|
msgid "Input mask:"
|
|
msgstr "Eingabemaske:"
|
|
|
|
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
|
msgid "A columns view with that name already exists."
|
|
msgstr "Eine Spaltenansicht mit diesem Namen besteht bereits."
|
|
|
|
#: ulng.rsmenuconfigurecolumnssavetochange
|
|
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
|
msgstr "Um das aktuelle Bearbeiten der Spaltenansicht zu verändern, die aktuelle entweder SPEICHERN, KOPIEREN oder LÖSCHEN"
|
|
|
|
#: ulng.rsmenuconfigurecustomcolumns
|
|
msgid "Configure custom columns"
|
|
msgstr "Bearbeite angepasste Spalten"
|
|
|
|
#: ulng.rsmenuconfigureentercustomcolumnname
|
|
msgid "Enter new custom columns name"
|
|
msgstr "Neuen angepassten Namen für die Spaltenansicht angeben"
|
|
|
|
#: ulng.rsmnuactions
|
|
msgctxt "ulng.rsmnuactions"
|
|
msgid "Actions"
|
|
msgstr "Aktionen"
|
|
|
|
#: ulng.rsmnucontentdefault
|
|
msgid "<Default>"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnucontentoctal
|
|
msgid "Octal"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnucopynetnamestoclip
|
|
msgid "Copy names with UNC path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnudisconnectnetworkdrive
|
|
msgid "Disconnect Network Drive..."
|
|
msgstr "Netzwerklaufwerk trennen..."
|
|
|
|
#: ulng.rsmnuedit
|
|
msgctxt "ulng.rsmnuedit"
|
|
msgid "Edit"
|
|
msgstr "Bea&rbeiten"
|
|
|
|
#: ulng.rsmnueject
|
|
msgid "Eject"
|
|
msgstr "Auswerfen"
|
|
|
|
#: ulng.rsmnuextracthere
|
|
msgid "Extract here..."
|
|
msgstr "Archiv hier entpacken..."
|
|
|
|
#: ulng.rsmnumapnetworkdrive
|
|
msgid "Map Network Drive..."
|
|
msgstr "Netzwerklaufwerk mappen..."
|
|
|
|
#: ulng.rsmnumount
|
|
msgid "Mount"
|
|
msgstr "Einbinden"
|
|
|
|
#: ulng.rsmnunew
|
|
msgctxt "ulng.rsmnunew"
|
|
msgid "New"
|
|
msgstr "Neu"
|
|
|
|
#: ulng.rsmnunomedia
|
|
msgid "No media available"
|
|
msgstr "Kein Datenträger verfügbar"
|
|
|
|
#: ulng.rsmnuopen
|
|
msgctxt "ulng.rsmnuopen"
|
|
msgid "Open"
|
|
msgstr "Öffnen"
|
|
|
|
#: ulng.rsmnuopenwith
|
|
msgid "Open with"
|
|
msgstr "Öffnen mit..."
|
|
|
|
#: ulng.rsmnuopenwithother
|
|
msgctxt "ulng.rsmnuopenwithother"
|
|
msgid "Other..."
|
|
msgstr "Andere..."
|
|
|
|
#: ulng.rsmnupackhere
|
|
msgid "Pack here..."
|
|
msgstr "Archiv hier erstellen..."
|
|
|
|
#: ulng.rsmnusortby
|
|
msgid "Sort by"
|
|
msgstr "Sortieren"
|
|
|
|
#: ulng.rsmnuumount
|
|
msgid "Unmount"
|
|
msgstr "Einbindung lösen"
|
|
|
|
#: ulng.rsmnuview
|
|
msgctxt "ulng.rsmnuview"
|
|
msgid "View"
|
|
msgstr "Betrachten"
|
|
|
|
#: ulng.rsmsgaccount
|
|
msgid "Account:"
|
|
msgstr "Zugang:"
|
|
|
|
#: ulng.rsmsgalldcintcmds
|
|
msgid "All Double Commander internal commands"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgarchivercustomparams
|
|
msgid "Additional parameters for archiver command-line:"
|
|
msgstr "Zusätzliche Parameter für die Befehlszeile des Packers:"
|
|
|
|
#: ulng.rsmsgaskquoteornot
|
|
msgid "Do you want to enclose between quotes?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgbadcrc32
|
|
msgid ""
|
|
"Bad CRC32 for resulting file:\n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Do you want to keep the resulting corrupted file anyway?\n"
|
|
msgstr ""
|
|
"Falscher CRC32-Wert für entstehende Datei:\n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Soll die entstehende korrupte Datei trotzdem behalten werden?\n"
|
|
|
|
#: ulng.rsmsgcannotcopymoveitself
|
|
msgid "You can not copy/move a file \"%s\" to itself!"
|
|
msgstr "Die Datei \"%s\" kann nicht über sich selbst kopiert/verschoben werden!"
|
|
|
|
#: ulng.rsmsgcannotdeletedirectory
|
|
msgid "Cannot delete directory %s"
|
|
msgstr "Kann Verzeichnis %s nicht löschen."
|
|
|
|
#: ulng.rsmsgcannotoverwritedirectory
|
|
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgchdirfailed
|
|
msgid "ChDir to [%s] failed!"
|
|
msgstr "Verzeichniswechsel nach [%s] fehlgeschlagen"
|
|
|
|
#: ulng.rsmsgcloseallinactivetabs
|
|
msgid "Remove all inactive tabs?"
|
|
msgstr "Alle in-aktiven Tabs entfernen?"
|
|
|
|
#: ulng.rsmsgcloselockedtab
|
|
msgid "This tab (%s) is locked! Close anyway?"
|
|
msgstr "Dieser Tab (%s) ist gesperrt! Trotzdem schließen?"
|
|
|
|
#: ulng.rsmsgcofirmuserparam
|
|
msgid "Confirmation of parameter"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgconfirmquit
|
|
msgid "Are you sure you want to quit?"
|
|
msgstr "Double Commander wirklich beenden?"
|
|
|
|
#: ulng.rsmsgcopybackward
|
|
msgid "The file %s has changed. Do you want to copy it backward?"
|
|
msgstr "Die Datei %s wurde verändert. Soll sie zurückkopiert werden?"
|
|
|
|
#: ulng.rsmsgcouldnotcopybackward
|
|
msgid "Could not copy backward - do you want to keep the changed file?"
|
|
msgstr "Zurückkopieren nicht möglich - ssoll die veränderte Datei behalten werden?"
|
|
|
|
#: ulng.rsmsgcpfldr
|
|
msgid "Copy %d selected files/directories?"
|
|
msgstr "%d markierte Datei(en)/Verzeichnis(se) kopieren?"
|
|
|
|
#: ulng.rsmsgcpsel
|
|
msgid "Copy selected \"%s\"?"
|
|
msgstr "Markierte \"%s\" kopieren?"
|
|
|
|
#: ulng.rsmsgcreateanewfiletype
|
|
msgid "< Create a new file type \"%s files\" >"
|
|
msgstr "< Neuen Dateityp erstellen \"%s Dateien\" >"
|
|
|
|
#: ulng.rsmsgdctoolbarwheretosave
|
|
msgid "Enter location and filename where to save a DC Toolbar file"
|
|
msgstr "Speicherort und Namen unter dem die Toolbar-Datei gespeichert werden soll"
|
|
|
|
#: ulng.rsmsgdefaultcustomactionname
|
|
msgid "Custom action"
|
|
msgstr "Angepasste Aktion"
|
|
|
|
#: ulng.rsmsgdeletepartiallycopied
|
|
msgid "Delete the partially copied file ?"
|
|
msgstr "Teilweise kopierte Datei löschen?"
|
|
|
|
#: ulng.rsmsgdelfldr
|
|
msgid "Delete %d selected files/directories?"
|
|
msgstr "Löschen von %d ausgewählten Dateien/Verzeichnissen?"
|
|
|
|
#: ulng.rsmsgdelfldrt
|
|
msgid "Delete %d selected files/directories into trash can?"
|
|
msgstr "%d markierte Dateien/Verzeichnisse in den Papierkorb verschieben?"
|
|
|
|
#: ulng.rsmsgdelsel
|
|
msgid "Delete selected \"%s\"?"
|
|
msgstr "Markierte \"%s\" löschen?"
|
|
|
|
#: ulng.rsmsgdelselt
|
|
msgid "Delete selected \"%s\" into trash can?"
|
|
msgstr "Markierte \"%s\" in den Papierkorb verschieben?"
|
|
|
|
#: ulng.rsmsgdeltotrashforce
|
|
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
|
msgstr "Kann \"%s\" nicht in den Papierkorb verschieben! Endgültig löschen?"
|
|
|
|
#: ulng.rsmsgdisknotavail
|
|
msgid "Disk is not available"
|
|
msgstr "Laufwerk steht nicht zur Verfügung"
|
|
|
|
#: ulng.rsmsgentercustomaction
|
|
msgid "Enter custom action name:"
|
|
msgstr "Namen für die angepasste Aktion angeben:"
|
|
|
|
#: ulng.rsmsgenterfileext
|
|
msgid "Enter file extension:"
|
|
msgstr "Dateiendung eingeben:"
|
|
|
|
#: ulng.rsmsgentername
|
|
msgid "Enter name:"
|
|
msgstr "Namen eingeben:"
|
|
|
|
#: ulng.rsmsgenternewfiletypename
|
|
msgid "Enter name of new file type to create for extension \"%s\""
|
|
msgstr "Bitte Namen für die neue Dateiendung \"%s\" angeben"
|
|
|
|
#: ulng.rsmsgerrbadarchive
|
|
msgid "CRC error in archive data"
|
|
msgstr "CRC-Fehler in der Archivdatei"
|
|
|
|
#: ulng.rsmsgerrbaddata
|
|
msgid "Data is bad"
|
|
msgstr "Datenfehler"
|
|
|
|
#: ulng.rsmsgerrcannotconnect
|
|
msgid "Can not connect to server: \"%s\""
|
|
msgstr "Kann nicht mit dem Server \"%s\" verbinden"
|
|
|
|
#: ulng.rsmsgerrcannotcopyfile
|
|
msgid "Cannot copy file %s to %s"
|
|
msgstr "Kann die Datei %s nicht zu %s kopieren"
|
|
|
|
#: ulng.rsmsgerrcreatefiledirectoryexists
|
|
msgid "There already exists a directory named \"%s\"."
|
|
msgstr "Ein Verzeichnis mit Namen \"%s\" besteht bereits."
|
|
|
|
#: ulng.rsmsgerrdatenotsupported
|
|
msgid "Date %s is not supported"
|
|
msgstr "Datum %s wird nicht nicht unterstützt"
|
|
|
|
#: ulng.rsmsgerrdirexists
|
|
msgid "Directory %s exists!"
|
|
msgstr "Verzeichnis %s besteht bereits!"
|
|
|
|
#: ulng.rsmsgerreaborted
|
|
msgid "Function aborted by user"
|
|
msgstr "Abbruch durch Benutzer"
|
|
|
|
#: ulng.rsmsgerreclose
|
|
msgid "Error closing file"
|
|
msgstr "Kann Datei nicht schliessen"
|
|
|
|
#: ulng.rsmsgerrecreate
|
|
msgid "Cannot create file"
|
|
msgstr "Kann Datei nicht erstellen"
|
|
|
|
#: ulng.rsmsgerrendarchive
|
|
msgid "No more files in archive"
|
|
msgstr "Keine weiteren Dateien im Archiv"
|
|
|
|
#: ulng.rsmsgerreopen
|
|
msgid "Cannot open existing file"
|
|
msgstr "Kann bestehende Datei nicht öffnen"
|
|
|
|
#: ulng.rsmsgerreread
|
|
msgid "Error reading from file"
|
|
msgstr "Kann Datei nicht lesen"
|
|
|
|
#: ulng.rsmsgerrewrite
|
|
msgid "Error writing to file"
|
|
msgstr "Kann Datei nicht erstellen"
|
|
|
|
#: ulng.rsmsgerrforcedir
|
|
msgid "Can not create directory %s!"
|
|
msgstr "Verzeichnis %s kann nicht erstellt werden!"
|
|
|
|
#: ulng.rsmsgerrinvalidlink
|
|
msgid "Invalid link"
|
|
msgstr "Ungültige Verknüpfung"
|
|
|
|
#: ulng.rsmsgerrnofiles
|
|
msgid "No files found"
|
|
msgstr "Keine Dateien gefunden"
|
|
|
|
#: ulng.rsmsgerrnomemory
|
|
msgid "Not enough memory"
|
|
msgstr "Nicht genügend Arbeitsspeicher"
|
|
|
|
#: ulng.rsmsgerrnotsupported
|
|
msgid "Function not supported!"
|
|
msgstr "Funktion wird nicht unterstützt!"
|
|
|
|
#: ulng.rsmsgerrorincontextmenucommand
|
|
msgid "Error in context menu command"
|
|
msgstr "Fehler im Befehl des Kontextmenü"
|
|
|
|
#: ulng.rsmsgerrorloadingconfiguration
|
|
msgid "Error when loading configuration"
|
|
msgstr "Fehler beim Laden der Konfiguration"
|
|
|
|
#: ulng.rsmsgerrregexpsyntax
|
|
msgid "Syntax error in regular expression!"
|
|
msgstr "Syntaxfehler im regulären Ausdruck!"
|
|
|
|
#: ulng.rsmsgerrrename
|
|
msgid "Cannot rename file %s to %s"
|
|
msgstr "Kann Datei %s nicht zu %s umbenennen"
|
|
|
|
#: ulng.rsmsgerrsaveassociation
|
|
msgid "Can not save association!"
|
|
msgstr "Kann Verknüpfung nicht festlegen"
|
|
|
|
#: ulng.rsmsgerrsavefile
|
|
msgid "Cannot save file"
|
|
msgstr "Kann Datei nicht speichern"
|
|
|
|
#: ulng.rsmsgerrsetattribute
|
|
msgid "Can not set attributes for \"%s\""
|
|
msgstr "Kann Attribut für \"%s\" nicht setzen"
|
|
|
|
#: ulng.rsmsgerrsetdatetime
|
|
msgid "Can not set date/time for \"%s\""
|
|
msgstr "Kann Datum/Zeit für \"%s\" nicht setzen"
|
|
|
|
#: ulng.rsmsgerrsetownership
|
|
msgid "Can not set owner/group for \"%s\""
|
|
msgstr "Kann Besitzer/Gruppe für \"%s\" nicht erstellen"
|
|
|
|
#: ulng.rsmsgerrsetpermissions
|
|
msgid "Can not set permissions for \"%s\""
|
|
msgstr "Berechtigungen für \"%s\" können nicht gesetzt werden"
|
|
|
|
#: ulng.rsmsgerrsmallbuf
|
|
msgid "Buffer too small"
|
|
msgstr "Puffer zu klein"
|
|
|
|
#: ulng.rsmsgerrtoomanyfiles
|
|
msgid "Too many files to pack"
|
|
msgstr "Zuviel Dateien zum Packen"
|
|
|
|
#: ulng.rsmsgerrunknownformat
|
|
msgid "Archive format unknown"
|
|
msgstr "Archivformat unbekannt"
|
|
|
|
#: ulng.rsmsgfavoritetabsdeleteallentries
|
|
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
|
msgstr "Wirklich alle Einträge vom Favoriten-Tab entfernen? (Es gibt keine Möglichkeit dies \"rückgängig\" zu machen!)"
|
|
|
|
#: ulng.rsmsgfavoritetabsdraghereentry
|
|
msgid "Drag here other entries"
|
|
msgstr "Andere Einträge hierher ziehen"
|
|
|
|
#: ulng.rsmsgfavoritetabsentername
|
|
msgid "Enter a name this Favorite Tabs entry"
|
|
msgstr "Namen für diesen Favoriten-Tab-Eintrag eingeben"
|
|
|
|
#: ulng.rsmsgfavoritetabsenternametitle
|
|
msgid "Saving a new Favorite Tabs entry"
|
|
msgstr "Speichere einen Favoriten-Tab-Eintrag"
|
|
|
|
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
|
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
|
msgstr "Anzahl der exportierten Favoriten-Tabs erfolgreich: %d in %d"
|
|
|
|
#: ulng.rsmsgfavoritetabsextramode
|
|
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
|
msgstr "Standard extra Einstellung für Verzeichnisverlauf für neue Favoriten-Tabs:"
|
|
|
|
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
|
msgid "Number of file(s) imported successfully: %d on %d"
|
|
msgstr "Anzahl der erfolgreich importierten Datei(en): %d auf %d"
|
|
|
|
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
|
msgid "Legacy tabs imported"
|
|
msgstr "Veraltete importierte Tabs"
|
|
|
|
#: ulng.rsmsgfavoritetabsimporttitle
|
|
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
|
msgstr ".tab-Datei(en) zum Importieren auswählen (kann mehr als eine gleichzeitig sein!)"
|
|
|
|
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
|
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
|
msgstr "Letzte Änderung der Favoriten-Tabs wurde noch nicht geändert. Vor dem Fortsetzen speichern?"
|
|
|
|
#: ulng.rsmsgfavoritetabssimplemode
|
|
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
|
msgid "Keep saving dir history with Favorite Tabs:"
|
|
msgstr "Verlauf weiter speichern mit Favoriten-Tabs:"
|
|
|
|
#: ulng.rsmsgfavoritetabssubmenuname
|
|
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
|
msgid "Submenu name"
|
|
msgstr "Name des Untermenüs"
|
|
|
|
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
|
msgid "This will load the Favorite Tabs: \"%s\""
|
|
msgstr "Dies wird die Favoriten-Tabs \"%s\" laden"
|
|
|
|
#: ulng.rsmsgfavortietabssaveoverexisting
|
|
msgid "Save current tabs over existing Favorite Tabs entry"
|
|
msgstr "Aktuellen Tab oberhalb des bestehenden Favoriten-Tabs speichern"
|
|
|
|
#: ulng.rsmsgfilechangedsave
|
|
msgid "File %s changed, save?"
|
|
msgstr "Datei %s wurde geändert, speichern?"
|
|
|
|
#: ulng.rsmsgfileexistsfileinfo
|
|
msgid "%s bytes, %s"
|
|
msgstr "%s Bytes, %s"
|
|
|
|
#: ulng.rsmsgfileexistsoverwrite
|
|
msgid "Overwrite:"
|
|
msgstr "Überschreiben:"
|
|
|
|
#: ulng.rsmsgfileexistsrwrt
|
|
msgid "File %s exists, overwrite?"
|
|
msgstr "Datei %s existiert bereits. Überschreiben?"
|
|
|
|
#: ulng.rsmsgfileexistswithfile
|
|
msgid "With file:"
|
|
msgstr "Mit Datei:"
|
|
|
|
#: ulng.rsmsgfilenotfound
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Datei \"%s\" nicht gefunden."
|
|
|
|
#: ulng.rsmsgfileoperationsactive
|
|
msgid "File operations active"
|
|
msgstr "Aktive Datei-Operationen"
|
|
|
|
#: ulng.rsmsgfileoperationsactivelong
|
|
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
|
msgstr "Es gibt Datei-Operationen, die noch nicht beendet sind. Das Schliessen von Double Commander kann deshalb zu Datenverlust führen!"
|
|
|
|
#: ulng.rsmsgfilepathovermaxpath
|
|
msgid ""
|
|
"The target name length (%d) is more than %d characters!\n"
|
|
"%s\n"
|
|
"Most programs will not be able to access a file/directory with such a long name!\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfilereadonly
|
|
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
|
msgstr "Datei %s ist als schreibgeschützt/versteckt/System markiert. Soll sie gelöscht werden?"
|
|
|
|
#: ulng.rsmsgfilesizetoobig
|
|
msgid "The file size of \"%s\" is too big for destination file system!"
|
|
msgstr "Die Größe der Datei \"%s\" ist zu groß für das Dateisystem des Ziel-Laufwerks!"
|
|
|
|
#: ulng.rsmsgfolderexistsrwrt
|
|
#, fuzzy
|
|
#| msgid "Folder %s exists, overwrite?"
|
|
msgid "Folder %s exists, merge?"
|
|
msgstr "Verzeichnis %s besteht bereits. Bitte eine Auswahl treffen:"
|
|
|
|
#: ulng.rsmsgfollowsymlink
|
|
msgid "Follow symlink \"%s\"?"
|
|
msgstr "Sym-Link \"%s\" folgen?"
|
|
|
|
#: ulng.rsmsgfortextformattoimport
|
|
msgid "Select the text format to import"
|
|
msgstr "Textformat zum Importieren auswählen"
|
|
|
|
#: ulng.rsmsghotdiraddselecteddirectories
|
|
msgid "Add %d selected dirs"
|
|
msgstr "Füge %d markierte Verzeichnisse hinzu"
|
|
|
|
#: ulng.rsmsghotdiraddselecteddirectory
|
|
msgid "Add selected dir: "
|
|
msgstr "Füge ausgewähltes Verzeichnis hinzu:"
|
|
|
|
#: ulng.rsmsghotdiraddthisdirectory
|
|
msgid "Add current dir: "
|
|
msgstr "Füge aktuelles Verzeichnis hinzu"
|
|
|
|
#: ulng.rsmsghotdircommandname
|
|
msgid "Do command"
|
|
msgstr "Führe Befehl aus"
|
|
|
|
#: ulng.rsmsghotdircommandsample
|
|
msgid "cm_somthing"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsghotdirconfighotlist
|
|
msgctxt "ulng.rsmsghotdirconfighotlist"
|
|
msgid "Configuration of Directory Hotlist"
|
|
msgstr "Konfiguration der Verzeichnis-Hotlist"
|
|
|
|
#: ulng.rsmsghotdirdeleteallentries
|
|
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
|
msgstr "Sicher, dass alle Einträge aus der Verzeichnis-Hotlist entfernt werden sollen? (Es gibt keine Möglichkeit dies \"rückgängig\" zu machen!)"
|
|
|
|
#: ulng.rsmsghotdirdemocommand
|
|
msgid "This will execute the following command:"
|
|
msgstr "Dies wird den folgenden Befehl ausführen:"
|
|
|
|
#: ulng.rsmsghotdirdemoname
|
|
msgid "This is hot dir named "
|
|
msgstr "So wird das Verzeichnis benannt"
|
|
|
|
#: ulng.rsmsghotdirdemopath
|
|
msgid "This will change active frame to the following path:"
|
|
msgstr "Dies wird den aktiven Rahmen in den folgenden Pfad ändern:"
|
|
|
|
#: ulng.rsmsghotdirdemotarget
|
|
msgid "And inactive frame would change to the following path:"
|
|
msgstr "Und der inaktive Rahmen wird in den folgenden Pfad geändert:"
|
|
|
|
#: ulng.rsmsghotdirerrorbackuping
|
|
msgid "Error backuping entries..."
|
|
msgstr "Fehler bei Sichern der Einträge..."
|
|
|
|
#: ulng.rsmsghotdirerrorexporting
|
|
msgid "Error exporting entries..."
|
|
msgstr "Fehler bei Export der Einträge..."
|
|
|
|
#: ulng.rsmsghotdirexportall
|
|
msgid "Export all!"
|
|
msgstr "Exportiere alle"
|
|
|
|
#: ulng.rsmsghotdirexporthotlist
|
|
msgid "Export Directory Hotlist - Select the entries you want to export"
|
|
msgstr "Exportiere Verzeichnis-Hotlist - Wähle Einträge die exportiert werden sollen"
|
|
|
|
#: ulng.rsmsghotdirexportsel
|
|
msgid "Export selected"
|
|
msgstr "Exportiere ausgewählte"
|
|
|
|
#: ulng.rsmsghotdirimportall
|
|
msgctxt "ulng.rsmsghotdirimportall"
|
|
msgid "Import all!"
|
|
msgstr "Alle importieren!"
|
|
|
|
#: ulng.rsmsghotdirimporthotlist
|
|
msgid "Import Directory Hotlist - Select the entries you want to import"
|
|
msgstr "Importiere Verzeichnis-Hotlist - Wähle die Einträge die importiert werden sollen"
|
|
|
|
#: ulng.rsmsghotdirimportsel
|
|
msgctxt "ulng.rsmsghotdirimportsel"
|
|
msgid "Import selected"
|
|
msgstr "Ausgewählte importieren"
|
|
|
|
#: ulng.rsmsghotdirjustpath
|
|
msgctxt "ulng.rsmsghotdirjustpath"
|
|
msgid "&Path:"
|
|
msgstr "Pfad"
|
|
|
|
#: ulng.rsmsghotdirlocatehotlistfile
|
|
msgid "Locate \".hotlist\" file to import"
|
|
msgstr "Finde \".hotlist\" Datei zum Importieren"
|
|
|
|
#: ulng.rsmsghotdirname
|
|
msgid "Hotdir name"
|
|
msgstr "Name für HotDir"
|
|
|
|
#: ulng.rsmsghotdirnbnewentries
|
|
msgid "Number of new entries: %d"
|
|
msgstr "Zahl neuer Einträge: %d"
|
|
|
|
#: ulng.rsmsghotdirnothingtoexport
|
|
msgid "Nothing selected to export!"
|
|
msgstr "Nichts zum Exportieren ausgewählt!"
|
|
|
|
#: ulng.rsmsghotdirpath
|
|
msgid "Hotdir path"
|
|
msgstr "HotDir-Pfad"
|
|
|
|
#: ulng.rsmsghotdirreaddselecteddirectory
|
|
msgid "Re-Add selected dir: "
|
|
msgstr "Gewähltes Verzeichnis erneut hinzufügen"
|
|
|
|
#: ulng.rsmsghotdirreaddthisdirectory
|
|
msgid "Re-Add current dir: "
|
|
msgstr "Aktuelles Verzeichnis erneut hinzufügen"
|
|
|
|
#: ulng.rsmsghotdirrestorewhat
|
|
msgid "Enter location and filename of Directory Hotlist to restore"
|
|
msgstr "Speicherort und Dateinamen der Verzeichnis-Hotlist eigeben, die wiederhergestellt werden soll"
|
|
|
|
#: ulng.rsmsghotdirsimplecommand
|
|
msgctxt "ulng.rsmsghotdirsimplecommand"
|
|
msgid "Command:"
|
|
msgstr "Befehl"
|
|
|
|
#: ulng.rsmsghotdirsimpleendofmenu
|
|
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
|
msgid "(end of sub menu)"
|
|
msgstr "(Ende des Untermenüs)"
|
|
|
|
#: ulng.rsmsghotdirsimplemenu
|
|
msgctxt "ulng.rsmsghotdirsimplemenu"
|
|
msgid "Menu &name:"
|
|
msgstr "Name des Menüs"
|
|
|
|
#: ulng.rsmsghotdirsimplename
|
|
msgctxt "ulng.rsmsghotdirsimplename"
|
|
msgid "&Name:"
|
|
msgstr "Name:"
|
|
|
|
#: ulng.rsmsghotdirsimpleseparator
|
|
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
|
msgid "(separator)"
|
|
msgstr "(Unterteilung)"
|
|
|
|
#: ulng.rsmsghotdirsubmenuname
|
|
msgctxt "ulng.rsmsghotdirsubmenuname"
|
|
msgid "Submenu name"
|
|
msgstr "Name des Untermenüs"
|
|
|
|
#: ulng.rsmsghotdirtarget
|
|
msgid "Hotdir target"
|
|
msgstr "Ziel der HotDir"
|
|
|
|
#: ulng.rsmsghotdirtiporderpath
|
|
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
|
msgstr "Entscheidung ob der aktive Frame in einer bestimmten Weise sortiert werdensoll, nachdem das Verzeichnis gewechselt wurde"
|
|
|
|
#: ulng.rsmsghotdirtipordertarget
|
|
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
|
msgstr "Entscheide, ob der nicht-aktive Frame in einer bestimmten Art und Weise sortiert werden soll nach dem Wechsel des Verzeichnisses"
|
|
|
|
#: ulng.rsmsghotdirtipspecialdirbut
|
|
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
|
msgstr "Einige Funktionen zum Wählen eines relativen Pfades, absoluten Pfades, spezieler Ordner, etc."
|
|
|
|
#: ulng.rsmsghotdirtotalbackuped
|
|
msgid ""
|
|
"Total entries saved: %d\n"
|
|
"\n"
|
|
"Backup filename: %s\n"
|
|
msgstr ""
|
|
"Anzahl aller gespeicherter Einträge: %d\n"
|
|
"\n"
|
|
"Name des Backups: %s\n"
|
|
|
|
#: ulng.rsmsghotdirtotalexported
|
|
msgid "Total entries exported: "
|
|
msgstr "Gesamtzahl der exportierten Einträge"
|
|
|
|
#: ulng.rsmsghotdirwhattodelete
|
|
msgid ""
|
|
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
|
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
|
msgstr ""
|
|
"Sollen alle Elemente innerhalb der Untermenüs gelöscht werden [%s]?\n"
|
|
"NEIN als Antwort löscht nur Unterteilungen innerhalb der Untermenüs, Elemente in den Untermenüs bleiben erhalten.\n"
|
|
|
|
#: ulng.rsmsghotdirwheretosave
|
|
msgid "Enter location and filename where to save a Directory Hotlist file"
|
|
msgstr "Speicherort und Dateiname zum Speichern der Verzeichnis-Hotlist"
|
|
|
|
#: ulng.rsmsgincorrectfilelength
|
|
msgid "Incorrect resulting filelength for file : \"%s\""
|
|
msgstr "Falsches Ergebnis der Dateilänge für: \"%s\""
|
|
|
|
#: ulng.rsmsginsertnextdisk
|
|
msgid ""
|
|
"Please insert next disk or something similar.\n"
|
|
"\n"
|
|
"It is to allow writing this file:\n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Number of bytes still to write: %d\n"
|
|
msgstr ""
|
|
"Bitte nächste Disk oder ähnliches einlegen.\n"
|
|
"\n"
|
|
"Damit diese Datei geschrieben werden kann:\n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Anzahl der noch zu schreibenden Bytes: %d\n"
|
|
|
|
#: ulng.rsmsginvalidcommandline
|
|
msgid "Error in command line"
|
|
msgstr "Fehler in der Befehlszeile"
|
|
|
|
#: ulng.rsmsginvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Ungültiger Dateiname"
|
|
|
|
#: ulng.rsmsginvalidformatofconfigurationfile
|
|
msgid "Invalid format of configuration file"
|
|
msgstr "Ungültiges Format der Konfigurationsdatei"
|
|
|
|
#: ulng.rsmsginvalidpath
|
|
msgid "Invalid path"
|
|
msgstr "Ungültiger Pfad"
|
|
|
|
#: ulng.rsmsginvalidpathlong
|
|
msgid "Path %s contains forbidden characters."
|
|
msgstr "Pfad %s enthält ungültige Zeichen."
|
|
|
|
#: ulng.rsmsginvalidplugin
|
|
msgid "This is not a valid plugin!"
|
|
msgstr "Dies ist kein akzeptables Plugin"
|
|
|
|
#: ulng.rsmsginvalidpluginarchitecture
|
|
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
|
msgstr "Dieses Plugin wurde für Double Commander für %s erstellt.%sEs kann nicht für %s verwendet werden!"
|
|
|
|
#: ulng.rsmsginvalidquoting
|
|
msgid "Invalid quoting"
|
|
msgstr "Ungültiges Zitat"
|
|
|
|
#: ulng.rsmsginvalidselection
|
|
msgid "Invalid selection."
|
|
msgstr "Ungültige Auswahl"
|
|
|
|
#: ulng.rsmsgloadingfilelist
|
|
msgid "Loading file list..."
|
|
msgstr "Lade Dateiliste..."
|
|
|
|
#: ulng.rsmsglocatetcconfiguation
|
|
msgid "Locate TC configuration file (wincmd.ini)"
|
|
msgstr "TC-Konfigurationsdatei (wincmd.ini) finden"
|
|
|
|
#: ulng.rsmsglocatetcexecutable
|
|
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
|
msgstr "TC.exe (totalcmd.exe oder totalcmd64.exe) finden"
|
|
|
|
#: ulng.rsmsglogcopy
|
|
msgid "Copy file %s"
|
|
msgstr "Kopiere Datei %s"
|
|
|
|
#: ulng.rsmsglogdelete
|
|
msgid "Delete file %s"
|
|
msgstr "Lösche Datei %s"
|
|
|
|
#: ulng.rsmsglogerror
|
|
msgid "Error: "
|
|
msgstr "Fehler:"
|
|
|
|
#: ulng.rsmsglogextcmdlaunch
|
|
msgid "Launch external"
|
|
msgstr "Externen laden"
|
|
|
|
#: ulng.rsmsglogextcmdresult
|
|
msgid "Result external"
|
|
msgstr "Externes Ergebnis"
|
|
|
|
#: ulng.rsmsglogextract
|
|
msgid "Extract file %s"
|
|
msgstr "Entpacke Datei(en) %s"
|
|
|
|
#: ulng.rsmsgloginfo
|
|
msgid "Info: "
|
|
msgstr "Info"
|
|
|
|
#: ulng.rsmsgloglink
|
|
msgid "Create link %s"
|
|
msgstr "Erstelle Verknüpfung %s"
|
|
|
|
#: ulng.rsmsglogmkdir
|
|
msgid "Create directory %s"
|
|
msgstr "Erstelle Verzeichnis %s"
|
|
|
|
#: ulng.rsmsglogmove
|
|
msgid "Move file %s"
|
|
msgstr "Verschiebe Datei(en) %s"
|
|
|
|
#: ulng.rsmsglogpack
|
|
msgid "Pack to file %s"
|
|
msgstr "Packe in Datei %s"
|
|
|
|
#: ulng.rsmsglogrmdir
|
|
msgid "Remove directory %s"
|
|
msgstr "Verzeichnis %s entfernen"
|
|
|
|
#: ulng.rsmsglogsuccess
|
|
msgid "Done: "
|
|
msgstr "Fertig:"
|
|
|
|
#: ulng.rsmsglogsymlink
|
|
msgid "Create symlink %s"
|
|
msgstr "Erstelle symb. Link für %s"
|
|
|
|
#: ulng.rsmsglogtest
|
|
msgid "Test file integrity %s"
|
|
msgstr "Teste Dateiintegrität von %s"
|
|
|
|
#: ulng.rsmsglogwipe
|
|
msgid "Wipe file %s"
|
|
msgstr "Lösche Datei %s"
|
|
|
|
#: ulng.rsmsglogwipedir
|
|
msgid "Wipe directory %s"
|
|
msgstr "Lösche Verzeichnis %s"
|
|
|
|
#: ulng.rsmsgmasterpassword
|
|
msgid "Master Password"
|
|
msgstr "Master-Passwort"
|
|
|
|
#: ulng.rsmsgmasterpasswordenter
|
|
msgid "Please enter the master password:"
|
|
msgstr "Bitte Master-Passwort eingeben"
|
|
|
|
#: ulng.rsmsgnewfile
|
|
msgid "New file"
|
|
msgstr "Neue Datei"
|
|
|
|
#: ulng.rsmsgnextvolunpack
|
|
msgid "Next volume will be unpacked"
|
|
msgstr "Nächster Teil wird entpackt"
|
|
|
|
#: ulng.rsmsgnofiles
|
|
msgid "No files"
|
|
msgstr "Keine Dateien"
|
|
|
|
#: ulng.rsmsgnofilesselected
|
|
msgid "No files selected."
|
|
msgstr "Keine Dateien ausgewählt."
|
|
|
|
#: ulng.rsmsgnofreespacecont
|
|
msgid "No enough free space on target drive, Continue?"
|
|
msgstr "Nicht genügend Speicherplatz auf dem Ziellaufwerk. Trotzdem fortfahren?"
|
|
|
|
#: ulng.rsmsgnofreespaceretry
|
|
msgid "No enough free space on target drive, Retry?"
|
|
msgstr "Nicht genügend Speicherplatz auf dem Ziellaufwerk. Erneut versuchen?"
|
|
|
|
#: ulng.rsmsgnotdelete
|
|
msgid "Can not delete file %s"
|
|
msgstr "Kann Datei %s nicht löschen"
|
|
|
|
#: ulng.rsmsgnotimplemented
|
|
msgid "Not implemented."
|
|
msgstr "Nicht möglich."
|
|
|
|
#: ulng.rsmsgobjectnotexists
|
|
msgid "Object does not exist!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgpanelpreview
|
|
msgctxt "ulng.rsmsgpanelpreview"
|
|
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
|
msgstr "Unten ist eine Vorschau zu sehen. Der Cursor kann bewegt werden und Dateien markiert werden um einen Eindruck von den verschiedenen Einstellungen zu bekommen."
|
|
|
|
#: ulng.rsmsgpassword
|
|
msgid "Password:"
|
|
msgstr "Passwort"
|
|
|
|
#: ulng.rsmsgpassworddiff
|
|
msgid "Passwords are different!"
|
|
msgstr "Die zwei Passwort-Eingaben stimmen nicht überein!"
|
|
|
|
#: ulng.rsmsgpasswordenter
|
|
msgid "Please enter the password:"
|
|
msgstr "Bitte Passwort eingeben:"
|
|
|
|
#: ulng.rsmsgpasswordfirewall
|
|
msgid "Password (Firewall):"
|
|
msgstr "Passwort (Firewall):"
|
|
|
|
#: ulng.rsmsgpasswordverify
|
|
msgid "Please re-enter the password for verification:"
|
|
msgstr "Bitte das Passwort zum Verifizieren erneut eingeben!"
|
|
|
|
#: ulng.rsmsgpopuphotdelete
|
|
msgid "&Delete %s"
|
|
msgstr "&Lösche %s"
|
|
|
|
#: ulng.rsmsgpresetalreadyexists
|
|
msgid "Preset \"%s\" already exists. Overwrite?"
|
|
msgstr "Voreinstellung \"%s\" besteht bereits. Überschreiben?"
|
|
|
|
#: ulng.rsmsgproblemexecutingcommand
|
|
msgid "Problem executing command (%s)"
|
|
msgstr "Problem beim Ausführen des Befehls (%s)"
|
|
|
|
#: ulng.rsmsgpromptaskingfilename
|
|
msgid "Filename for dropped text:"
|
|
msgstr "Dateiname für gezogenen Text:"
|
|
|
|
#: ulng.rsmsgprovidethisfile
|
|
msgid "Please, make this file available. Retry?"
|
|
msgstr "Bitte diese Datei zur Verfügung stellen. Nochmal versuchen?"
|
|
|
|
#: ulng.rsmsgrenamefavtabs
|
|
msgid "Enter new friendly name for this Favorite Tabs"
|
|
msgstr "Neuen guten Namen für diesen Favoriten-Tab eingeben"
|
|
|
|
#: ulng.rsmsgrenamefavtabsmenu
|
|
msgid "Enter new name for this menu"
|
|
msgstr "Neuen Namen für dieses Menü eingeben"
|
|
|
|
#: ulng.rsmsgrenfldr
|
|
msgid "Rename/move %d selected files/directories?"
|
|
msgstr "%d markierte Dateien/Verzeichnisse umbenennen/verschieben?"
|
|
|
|
#: ulng.rsmsgrensel
|
|
msgid "Rename/move selected \"%s\"?"
|
|
msgstr "Datei/Verzeichnis \"%s\" kopieren/verschieben?"
|
|
|
|
#: ulng.rsmsgrestartforapplychanges
|
|
msgid "Please, restart Double Commander in order to apply changes"
|
|
msgstr "Bitte Double Commander neustarten um die Änderungen zu übernehmen"
|
|
|
|
#: ulng.rsmsgsekectfiletype
|
|
msgid "Select to which file type to add extension \"%s\""
|
|
msgstr "Bitte angeben welcher Dateityp die Endung \"%s\" bekommen soll"
|
|
|
|
#: ulng.rsmsgselectedinfo
|
|
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
|
msgstr "Ausgewählt: %s von %s, Dateien: %d von %d, Verzeichnisse: %d von %d"
|
|
|
|
#: ulng.rsmsgselectexecutablefile
|
|
msgid "Select executable file for"
|
|
msgstr "Ausführbare Datei auswählen"
|
|
|
|
#: ulng.rsmsgselectonlychecksumfiles
|
|
msgid "Please select only checksum files!"
|
|
msgstr "Bitte nur Prüfsummen-Dateien auswählen!"
|
|
|
|
#: ulng.rsmsgsellocnextvol
|
|
msgid "Please select location of next volume"
|
|
msgstr "Speicherort des nächsten Teils angeben"
|
|
|
|
#: ulng.rsmsgsetvolumelabel
|
|
msgid "Set volume label"
|
|
msgstr "Laufwerksbezeichnung angeben"
|
|
|
|
#: ulng.rsmsgspecialdir
|
|
msgid "Special Dirs"
|
|
msgstr "Besondere Verzeichnisse"
|
|
|
|
#: ulng.rsmsgspecialdiraddacti
|
|
msgid "Add path from active frame"
|
|
msgstr "Pfad aus dem aktiven Frame hinzufügen"
|
|
|
|
#: ulng.rsmsgspecialdiraddnonacti
|
|
msgid "Add path from inactive frame"
|
|
msgstr "Pfad aus dem inaktiven Frame hinzufügen"
|
|
|
|
#: ulng.rsmsgspecialdirbrowssel
|
|
msgid "Browse and use selected path"
|
|
msgstr "Durchsuche und benutze den gewählten Pfad"
|
|
|
|
#: ulng.rsmsgspecialdirenvvar
|
|
msgid "Use environment variable..."
|
|
msgstr "Benutze Umgebungsvariable..."
|
|
|
|
#: ulng.rsmsgspecialdirgotodc
|
|
msgid "Go to Double Commander special path..."
|
|
msgstr "Gehe zu besonderem Double Commander Pfad..."
|
|
|
|
#: ulng.rsmsgspecialdirgotoenvvar
|
|
msgid "Go to environment variable..."
|
|
msgstr "Gehe zu Umgebungsvariable..."
|
|
|
|
#: ulng.rsmsgspecialdirgotoother
|
|
msgid "Go to other Windows special folder..."
|
|
msgstr "Gehe zu anderem besonderen Windows-Pfad..."
|
|
|
|
#: ulng.rsmsgspecialdirgototc
|
|
msgid "Go to Windows special folder (TC)..."
|
|
msgstr "Gehe zu besonderem Windows-Verzeichnis (TC)"
|
|
|
|
#: ulng.rsmsgspecialdirmakereltohotdir
|
|
msgid "Make relative to hotdir path"
|
|
msgstr "Relativ zum HotDir-Pfad machen"
|
|
|
|
#: ulng.rsmsgspecialdirmkabso
|
|
msgid "Make path absolute"
|
|
msgstr "Mache Pfad absolut"
|
|
|
|
#: ulng.rsmsgspecialdirmkdcrel
|
|
msgid "Make relative to Double Commander special path..."
|
|
msgstr "Mache Pfad relativ zu Double Commander..."
|
|
|
|
#: ulng.rsmsgspecialdirmkenvrel
|
|
msgid "Make relative to environment variable..."
|
|
msgstr "Mache Pfad relativ zur Umgebungsvariable..."
|
|
|
|
#: ulng.rsmsgspecialdirmktctel
|
|
msgid "Make relative to Windows special folder (TC)..."
|
|
msgstr "Mache Pfad relativ zum besonderen Windows-Verzeichnis (TC)..."
|
|
|
|
#: ulng.rsmsgspecialdirmkwnrel
|
|
msgid "Make relative to other Windows special folder..."
|
|
msgstr "Mache Pfda relativ zu anderem besonderen Windows-Verzeichnis..."
|
|
|
|
#: ulng.rsmsgspecialdirusedc
|
|
msgid "Use Double Commander special path..."
|
|
msgstr "Nutze besonderen Double Commander-Pfad..."
|
|
|
|
#: ulng.rsmsgspecialdirusehotdir
|
|
msgid "Use hotdir path"
|
|
msgstr "Nutze HotDir-Pfad"
|
|
|
|
#: ulng.rsmsgspecialdiruseother
|
|
msgid "Use other Windows special folder..."
|
|
msgstr "Nutze anderes besonderes Windows-Verzeichnis..."
|
|
|
|
#: ulng.rsmsgspecialdirusetc
|
|
msgid "Use Windows special folder (TC)..."
|
|
msgstr "Nutze besonderes Windows-Verzeichnis (TC)..."
|
|
|
|
#: ulng.rsmsgtabforopeninginnewtab
|
|
msgid "This tab (%s) is locked! Open directory in another tab?"
|
|
msgstr "Dieser Tab (%s) ist gesperrt! Verzeichnis in anderem Tab öffnen?"
|
|
|
|
#: ulng.rsmsgtabrenamecaption
|
|
msgid "Rename tab"
|
|
msgstr "Tab umbenennen"
|
|
|
|
#: ulng.rsmsgtabrenameprompt
|
|
msgid "New tab name:"
|
|
msgstr "Neuer Tab-Name"
|
|
|
|
#: ulng.rsmsgtargetdir
|
|
msgid "Target path:"
|
|
msgstr "Zielpfad"
|
|
|
|
#: ulng.rsmsgtcconfignotfound
|
|
msgid ""
|
|
"Error! Cannot find the TC configuration file:\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
"Fehler! Kann die TC-Konfigurationsdatei nicht finden:\n"
|
|
"%s\n"
|
|
|
|
#: ulng.rsmsgtcexecutablenotfound
|
|
msgid ""
|
|
"Error! Cannot find the TC configuration executable:\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
"Fehler! Die ausführbare Datei für die TC-Konfiguration kann nicht gefunden werden:\n"
|
|
"%s\n"
|
|
|
|
#: ulng.rsmsgtcisrunning
|
|
msgid ""
|
|
"Error! TC is still running but it should be closed for this operation.\n"
|
|
"Close it and press OK or press CANCEL to abort.\n"
|
|
msgstr ""
|
|
"Fehler! TC läuft noch, sollte aber für diese Aktion geschlossen werden.\n"
|
|
"Bitte schließen und OK klicken oder ABBRUCH zum abbrechen.\n"
|
|
|
|
#: ulng.rsmsgtctoolbarnotfound
|
|
msgid ""
|
|
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
|
"%s\n"
|
|
msgstr "Fehler! Kann den angegebenen gewünschten TC-Toolbar Ausgabeordner nicht finden: %s"
|
|
|
|
#: ulng.rsmsgtctoolbarwheretosave
|
|
msgid "Enter location and filename where to save a TC Toolbar file"
|
|
msgstr "Speicherort und Datinamen angeben unter dem die TC-Toolbardatei gespeichert werden soll"
|
|
|
|
#: ulng.rsmsgthisisnowinclipboard
|
|
msgid "\"%s\" is now in the clipboard"
|
|
msgstr "\"%s\" ist jetzt in der Zwischenablage"
|
|
|
|
#: ulng.rsmsgtitleextnotinfiletype
|
|
msgid "Extension of selected file is not in any recognized file types"
|
|
msgstr "Endung der gewählten Datei gehört nicht zu den bekannten Dateitypen"
|
|
|
|
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
|
msgid "Locate \".toolbar\" file to import"
|
|
msgstr "\".toolbar\"-Datei angeben zum Importieren"
|
|
|
|
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
|
msgid "Locate \".BAR\" file to import"
|
|
msgstr "\".BAR\"-Datei angeben zum Importieren"
|
|
|
|
#: ulng.rsmsgtoolbarrestorewhat
|
|
msgid "Enter location and filename of Toolbar to restore"
|
|
msgstr "Speicherort und Dateinamen der Toolbar zum Wiederherstellen angeben"
|
|
|
|
#: ulng.rsmsgtoolbarsaved
|
|
msgid ""
|
|
"Saved!\n"
|
|
"Toolbar filename: %s\n"
|
|
msgstr ""
|
|
"Gespeichert!\n"
|
|
"Name der Toolbar: %s\n"
|
|
|
|
#: ulng.rsmsgtoomanyfilesselected
|
|
msgid "Too many files selected."
|
|
msgstr "Zuviele Dateien ausgewählt."
|
|
|
|
#: ulng.rsmsgundeterminednumberoffile
|
|
msgid "Undetermined"
|
|
msgstr "Unbestimmt"
|
|
|
|
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
|
msgid "ERROR: Unexpected Tree View Menu usage!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgurl
|
|
msgid "URL:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsguserdidnotsetextension
|
|
msgid "<NO EXT>"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsguserdidnotsetname
|
|
msgid "<NO NAME>"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgusername
|
|
msgid "User name:"
|
|
msgstr "Nutzername:"
|
|
|
|
#: ulng.rsmsgusernamefirewall
|
|
msgid "User name (Firewall):"
|
|
msgstr "Nutzername (Firewall):"
|
|
|
|
#: ulng.rsmsgvolumelabel
|
|
msgid "Volume label:"
|
|
msgstr "Laufwerksbezeichnung:"
|
|
|
|
#: ulng.rsmsgvolumesizeenter
|
|
msgid "Please enter the volume size:"
|
|
msgstr "Bitte Volume-Größe eingeben:"
|
|
|
|
#: ulng.rsmsgwipefldr
|
|
msgid "Wipe %d selected files/directories?"
|
|
msgstr "%d markierte Dateien/Ordner sicher löschen?"
|
|
|
|
#: ulng.rsmsgwipesel
|
|
msgid "Wipe selected \"%s\"?"
|
|
msgstr "Markierte \"%s\" sicher löschen?"
|
|
|
|
#: ulng.rsmsgwithactionwith
|
|
msgid "with"
|
|
msgstr "mit"
|
|
|
|
#: ulng.rsmulrenautorename
|
|
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmulrenfilenamestylelist
|
|
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
|
msgstr "Keine Änderung;GROSSBUCHSTABEN;alles klein;Erster Buchstabe groß;Erster Buchstabe in jedem Wort groß;"
|
|
|
|
#: ulng.rsmulrenwarningduplicate
|
|
msgid "Warning, duplicate names!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmulrenwronglinesnumber
|
|
msgid "File contains wrong number of lines: %d, should be %d!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnewsearchclearfilteroptions
|
|
msgid "Keep;Clear;Prompt"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnoequivalentinternalcommand
|
|
msgid "No internal equivalent command"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnofindfileswindowyet
|
|
msgid "Sorry, no \"Find files\" window yet..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsnootherfindfileswindowtoclose
|
|
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsoperaborted
|
|
msgid "Aborted"
|
|
msgstr "Abgebrochen"
|
|
|
|
#: ulng.rsopercalculatingchecksum
|
|
msgid "Calculating checksum"
|
|
msgstr "Berechne Prüfsumme"
|
|
|
|
#: ulng.rsopercalculatingchecksumin
|
|
msgid "Calculating checksum in \"%s\""
|
|
msgstr "Berechne Prüfsumme in \"%s\""
|
|
|
|
#: ulng.rsopercalculatingchecksumof
|
|
msgid "Calculating checksum of \"%s\""
|
|
msgstr "Berechne Prüfsumme von \"%s\""
|
|
|
|
#: ulng.rsopercalculatingstatictics
|
|
msgctxt "ulng.rsopercalculatingstatictics"
|
|
msgid "Calculating"
|
|
msgstr "Berechne"
|
|
|
|
#: ulng.rsopercalculatingstatisticsin
|
|
msgid "Calculating \"%s\""
|
|
msgstr "Berechne \"%s\""
|
|
|
|
#: ulng.rsopercombining
|
|
msgid "Joining"
|
|
msgstr "Verschmelze"
|
|
|
|
#: ulng.rsopercombiningfromto
|
|
msgid "Joining files in \"%s\" to \"%s\""
|
|
msgstr "Verschmelze Dateien in \"%s\" nach\"%s\""
|
|
|
|
#: ulng.rsopercopying
|
|
msgid "Copying"
|
|
msgstr "Kopiere"
|
|
|
|
#: ulng.rsopercopyingfromto
|
|
msgid "Copying from \"%s\" to \"%s\""
|
|
msgstr "Kopiere von \"%s\" nach \"%s\""
|
|
|
|
#: ulng.rsopercopyingsomethingto
|
|
msgid "Copying \"%s\" to \"%s\""
|
|
msgstr "Kopiere \"%s\" nach \"%s\""
|
|
|
|
#: ulng.rsopercreatingdirectory
|
|
msgid "Creating directory"
|
|
msgstr "Erstelle Verzeichnis"
|
|
|
|
#: ulng.rsopercreatingsomedirectory
|
|
msgid "Creating directory \"%s\""
|
|
msgstr "Erstelle Verzeichnis \"%s\""
|
|
|
|
#: ulng.rsoperdeleting
|
|
msgctxt "ulng.rsoperdeleting"
|
|
msgid "Deleting"
|
|
msgstr "Lösche"
|
|
|
|
#: ulng.rsoperdeletingin
|
|
msgid "Deleting in \"%s\""
|
|
msgstr "Lösche in \"%s\""
|
|
|
|
#: ulng.rsoperdeletingsomething
|
|
msgid "Deleting \"%s\""
|
|
msgstr "Lösche \"%s\""
|
|
|
|
#: ulng.rsoperexecuting
|
|
msgid "Executing"
|
|
msgstr "Führe aus"
|
|
|
|
#: ulng.rsoperexecutingsomething
|
|
msgid "Executing \"%s\""
|
|
msgstr "Führe \"%s\" aus"
|
|
|
|
#: ulng.rsoperextracting
|
|
msgid "Extracting"
|
|
msgstr "Entpacke"
|
|
|
|
#: ulng.rsoperextractingfromto
|
|
msgid "Extracting from \"%s\" to \"%s\""
|
|
msgstr "Entpacke von \"%s\" nach \"%s\""
|
|
|
|
#: ulng.rsoperfinished
|
|
msgid "Finished"
|
|
msgstr "Beendet"
|
|
|
|
#: ulng.rsoperlisting
|
|
msgid "Listing"
|
|
msgstr "Liste auf"
|
|
|
|
#: ulng.rsoperlistingin
|
|
msgid "Listing \"%s\""
|
|
msgstr "Liste \"%s\" auf"
|
|
|
|
#: ulng.rsopermoving
|
|
msgid "Moving"
|
|
msgstr "Verschiebe"
|
|
|
|
#: ulng.rsopermovingfromto
|
|
msgid "Moving from \"%s\" to \"%s\""
|
|
msgstr "Verschiebe von \"%s\" nach \"%s\""
|
|
|
|
#: ulng.rsopermovingsomethingto
|
|
msgid "Moving \"%s\" to \"%s\""
|
|
msgstr "Verschiebe \"%s\" nach \"%s\""
|
|
|
|
#: ulng.rsopernotstarted
|
|
msgid "Not started"
|
|
msgstr "Nicht gestartet"
|
|
|
|
#: ulng.rsoperpacking
|
|
msgid "Packing"
|
|
msgstr "Packe"
|
|
|
|
#: ulng.rsoperpackingfromto
|
|
msgid "Packing from \"%s\" to \"%s\""
|
|
msgstr "Packe von \"%s\" nach \"%s\""
|
|
|
|
#: ulng.rsoperpackingsomethingto
|
|
msgid "Packing \"%s\" to \"%s\""
|
|
msgstr "Packe \"%s\" nach \"%s\""
|
|
|
|
#: ulng.rsoperpaused
|
|
msgid "Paused"
|
|
msgstr "Pausiert"
|
|
|
|
#: ulng.rsoperpausing
|
|
msgid "Pausing"
|
|
msgstr "Pause"
|
|
|
|
#: ulng.rsoperrunning
|
|
msgid "Running"
|
|
msgstr "Wird ausgeführt"
|
|
|
|
#: ulng.rsopersettingproperty
|
|
msgid "Setting property"
|
|
msgstr "Stelle Eigenschaften ein"
|
|
|
|
#: ulng.rsopersettingpropertyin
|
|
msgid "Setting property in \"%s\""
|
|
msgstr "Setze Eigenschaften in \"%s\""
|
|
|
|
#: ulng.rsopersettingpropertyof
|
|
msgid "Setting property of \"%s\""
|
|
msgstr "Setze Eigenschaft von \"%s\""
|
|
|
|
#: ulng.rsopersplitting
|
|
msgid "Splitting"
|
|
msgstr "Teile"
|
|
|
|
#: ulng.rsopersplittingfromto
|
|
msgid "Splitting \"%s\" to \"%s\""
|
|
msgstr "Teile \"%s\" nach \"%s\""
|
|
|
|
#: ulng.rsoperstarting
|
|
msgid "Starting"
|
|
msgstr "Wird gestartet"
|
|
|
|
#: ulng.rsoperstopped
|
|
msgid "Stopped"
|
|
msgstr "Gestoppt"
|
|
|
|
#: ulng.rsoperstopping
|
|
msgid "Stopping"
|
|
msgstr "Stoppe"
|
|
|
|
#: ulng.rsopertesting
|
|
msgid "Testing"
|
|
msgstr "Test"
|
|
|
|
#: ulng.rsopertestingin
|
|
msgid "Testing in \"%s\""
|
|
msgstr "Teste in \"%s\""
|
|
|
|
#: ulng.rsopertestingsomething
|
|
msgid "Testing \"%s\""
|
|
msgstr "Teste \"%s\""
|
|
|
|
#: ulng.rsoperverifyingchecksum
|
|
msgid "Verifying checksum"
|
|
msgstr "Verifiziere Prüfsumme"
|
|
|
|
#: ulng.rsoperverifyingchecksumin
|
|
msgid "Verifying checksum in \"%s\""
|
|
msgstr "Verifiziere Prüfsumme in \"%s\""
|
|
|
|
#: ulng.rsoperverifyingchecksumof
|
|
msgid "Verifying checksum of \"%s\""
|
|
msgstr "Verifiziere Prüfsumme von \"%s\""
|
|
|
|
#: ulng.rsoperwaitingforconnection
|
|
msgid "Waiting for access to file source"
|
|
msgstr "Warte auf Zugriff auf Datei-Quelle"
|
|
|
|
#: ulng.rsoperwaitingforfeedback
|
|
msgid "Waiting for user response"
|
|
msgstr "Warte auf Benutzereingabe"
|
|
|
|
#: ulng.rsoperwiping
|
|
msgid "Wiping"
|
|
msgstr "Lösche sicher"
|
|
|
|
#: ulng.rsoperwipingin
|
|
msgid "Wiping in \"%s\""
|
|
msgstr "Lösche sicher in \"%s\""
|
|
|
|
#: ulng.rsoperwipingsomething
|
|
msgid "Wiping \"%s\""
|
|
msgstr "Lösche \"%s\" sicher"
|
|
|
|
#: ulng.rsoperworking
|
|
msgid "Working"
|
|
msgstr "Führe aus"
|
|
|
|
#: ulng.rsoptaddfrommainpanel
|
|
msgid "Add at &beginning;Add at the end;Smart add"
|
|
msgstr "Am Anfang anfügen;Am Ende anfügen;Smart hinzufügen"
|
|
|
|
#: ulng.rsoptarchivedelete
|
|
msgctxt "ulng.rsoptarchivedelete"
|
|
msgid "Delete:"
|
|
msgstr "Lösche:"
|
|
|
|
#: ulng.rsoptarchiveextractwithoutpath
|
|
msgid "Extract without path:"
|
|
msgstr "Ohne gespeicherten Pfad entpacken:"
|
|
|
|
#: ulng.rsoptarchiveformmode
|
|
msgid "Format parsing mode:"
|
|
msgstr "Format Analyse-Modus:"
|
|
|
|
#: ulng.rsoptarchiveid
|
|
msgctxt "ulng.rsoptarchiveid"
|
|
msgid "ID:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveidpos
|
|
msgctxt "ulng.rsoptarchiveidpos"
|
|
msgid "ID Position:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveidseekrange
|
|
msgid "ID Seek Range:"
|
|
msgstr "ID Such-Bereich:"
|
|
|
|
#: ulng.rsoptarchiveparam
|
|
msgid "Parameter"
|
|
msgstr "Parameter"
|
|
|
|
#: ulng.rsoptarchivepasswordquery
|
|
msgid "Password query string:"
|
|
msgstr "Passwortabfrage:"
|
|
|
|
#: ulng.rsoptarchiveselfextract
|
|
msgctxt "ulng.rsoptarchiveselfextract"
|
|
msgid "Create self extracting archive:"
|
|
msgstr "Selbstentpackendes Archiv (Sfx) erstellen:"
|
|
|
|
#: ulng.rsoptarchivetest
|
|
msgctxt "ulng.rsoptarchivetest"
|
|
msgid "Test:"
|
|
msgstr "Teste:"
|
|
|
|
#: ulng.rsoptarchivetypename
|
|
msgid "Archive type name:"
|
|
msgstr "Name des Archiv-Typs:"
|
|
|
|
#: ulng.rsoptarchivevalue
|
|
msgctxt "ulng.rsoptarchivevalue"
|
|
msgid "Value"
|
|
msgstr "Wert"
|
|
|
|
#: ulng.rsoptassocpluginwith
|
|
msgid "Associate plugin \"%s\" with:"
|
|
msgstr "Verknüpfe PlugIn \"%s\" mit:"
|
|
|
|
#: ulng.rsoptautosizecolumn
|
|
msgid "First;Last;"
|
|
msgstr "Erste;Letzte;"
|
|
|
|
#: ulng.rsoptconfigsortorder
|
|
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
|
msgstr "Klassisch, Vermächtnis-Reihenfolge, Alphabetische Reihenfolge (aber Sprache immer zuerst)"
|
|
|
|
#: ulng.rsoptdifferframeposition
|
|
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
|
msgstr "Aktiver Frame-Panel links, inaktiver rechts (Vermächtnis);Linker Frame-Panel links, rechts auf der rechten Seite"
|
|
|
|
#: ulng.rsoptdisable
|
|
msgid "Disable"
|
|
msgstr "Deaktivieren"
|
|
|
|
#: ulng.rsoptenable
|
|
msgctxt "ulng.rsoptenable"
|
|
msgid "Enable"
|
|
msgstr "Aktivieren"
|
|
|
|
#: ulng.rsoptenterext
|
|
msgid "Enter extension"
|
|
msgstr "Endung eingeben"
|
|
|
|
#: ulng.rsoptfavoritetabswheretoaddinlist
|
|
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
|
msgstr "Am Anfang hinzufügen;Am Ende hinzufügen;Alphabetisch sortieren"
|
|
|
|
#: ulng.rsoptfileoperationsprogresskind
|
|
msgid "separate window;minimized separate window;operations panel"
|
|
msgstr "eigenes Fenster;minimiertes eigenes Fenster;Operationsfenster"
|
|
|
|
#: ulng.rsoptfilesizeformat
|
|
msgid "float;B;K;M;G"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopthotkeysadddeleteshortcutlong
|
|
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
|
msgstr "Tastaturkürzel %s für cm_delete wird registriert, damit die Änderung rückgängig gemacht werden kann."
|
|
|
|
#: ulng.rsopthotkeysaddhotkey
|
|
msgid "Add hotkey for %s"
|
|
msgstr "Füge Tastaturkürzel für %s hinzu"
|
|
|
|
#: ulng.rsopthotkeysaddshortcutbutton
|
|
msgid "Add shortcut"
|
|
msgstr "Tastaturkürzel erstellen"
|
|
|
|
#: ulng.rsopthotkeyscannotsetshortcut
|
|
msgid "Cannot set shortcut"
|
|
msgstr "Kann die Verknüpfung nicht erstellen"
|
|
|
|
#: ulng.rsopthotkeyschangeshortcut
|
|
msgid "Change shortcut"
|
|
msgstr "Verknüpfung ändern"
|
|
|
|
#: ulng.rsopthotkeyscommand
|
|
msgctxt "ulng.rsopthotkeyscommand"
|
|
msgid "Command"
|
|
msgstr "Befehle"
|
|
|
|
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
|
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
|
msgstr "Verknüpfung %s für cm_Delete hat Parameter, die diese Einstellung überschreiben. Soll dieser Parameter geändert werden, um die globale Einstellung zu verwenden?"
|
|
|
|
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
|
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
|
msgstr "Verknüpfung %s für cm_Delete muss einen Parameter geändert bekommen, um der Verknüpfung %s zu entsprechen. Soll der Parameter geändert werden?"
|
|
|
|
#: ulng.rsopthotkeysdescription
|
|
msgctxt "ulng.rsopthotkeysdescription"
|
|
msgid "Description"
|
|
msgstr "Beschreibung"
|
|
|
|
#: ulng.rsopthotkeysedithotkey
|
|
msgid "Edit hotkey for %s"
|
|
msgstr "Bearbeite Tastaturkürzel für %s"
|
|
|
|
#: ulng.rsopthotkeysfixparameter
|
|
msgid "Fix parameter"
|
|
msgstr "Parameter wiederherstellen"
|
|
|
|
#: ulng.rsopthotkeyshotkey
|
|
msgctxt "ulng.rsopthotkeyshotkey"
|
|
msgid "Hotkey"
|
|
msgstr "Tastaturkürzel"
|
|
|
|
#: ulng.rsopthotkeyshotkeys
|
|
msgctxt "ulng.rsopthotkeyshotkeys"
|
|
msgid "Hotkeys"
|
|
msgstr "Tastaturkürzel"
|
|
|
|
#: ulng.rsopthotkeysnohotkey
|
|
msgid "<none>"
|
|
msgstr "<leer>"
|
|
|
|
#: ulng.rsopthotkeysparameters
|
|
msgctxt "ulng.rsopthotkeysparameters"
|
|
msgid "Parameters"
|
|
msgstr "Parameter"
|
|
|
|
#: ulng.rsopthotkeyssetdeleteshortcut
|
|
msgid "Set shortcut to delete file"
|
|
msgstr "Verknüpfung festlegen um Dateien zu löschen"
|
|
|
|
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
|
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
|
msgstr "Damit diese Einstellung mit Verknüpfung %s funktioniert, muss %s cm_Delete zugewiesen werden, aber ist %s zugewiesen. Soll dies geändert werden?"
|
|
|
|
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
|
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
|
msgstr "Verknüpfung %s für cm_Delete ist eine Sequenz-Verknüpfung, für die ein Tastaturkürzel mit umgekehrter Umschalt-Taste nicht verwendet werden kann. Die Einstellung funktioniert wahrscheinlich so nicht."
|
|
|
|
#: ulng.rsopthotkeysshortcutused
|
|
msgid "Shortcut in use"
|
|
msgstr "Tastaturkürzel in Gebrauch"
|
|
|
|
#: ulng.rsopthotkeysshortcutusedtext1
|
|
msgid "Shortcut %s is already used."
|
|
msgstr "Tastaturkürzel %s wird bereits verwendet."
|
|
|
|
#: ulng.rsopthotkeysshortcutusedtext2
|
|
msgid "Change it to %s?"
|
|
msgstr "Verändern zu %s?"
|
|
|
|
#: ulng.rsopthotkeysusedby
|
|
msgid "used for %s in %s"
|
|
msgstr "Benutzt für %s in %s"
|
|
|
|
#: ulng.rsopthotkeysusedwithdifferentparams
|
|
msgid "used for this command but with different parameters"
|
|
msgstr "für diesen Befehl genutzt, aber mit unterschiedlichen Parametern"
|
|
|
|
#: ulng.rsoptionseditorarchivers
|
|
msgctxt "ulng.rsoptionseditorarchivers"
|
|
msgid "Archivers"
|
|
msgstr "Archivierer"
|
|
|
|
#: ulng.rsoptionseditorautorefresh
|
|
msgctxt "ulng.rsoptionseditorautorefresh"
|
|
msgid "Auto refresh"
|
|
msgstr "Automatisch auffrischen"
|
|
|
|
#: ulng.rsoptionseditorbehavior
|
|
msgctxt "ulng.rsoptionseditorbehavior"
|
|
msgid "Behaviors"
|
|
msgstr "Verhalten"
|
|
|
|
#: ulng.rsoptionseditorbriefview
|
|
msgctxt "ulng.rsoptionseditorbriefview"
|
|
msgid "Brief"
|
|
msgstr "Verkürzt"
|
|
|
|
#: ulng.rsoptionseditorcolors
|
|
msgctxt "ulng.rsoptionseditorcolors"
|
|
msgid "Colors"
|
|
msgstr "Farben"
|
|
|
|
#: ulng.rsoptionseditorcolumnsview
|
|
msgid "Columns"
|
|
msgstr "Spalten"
|
|
|
|
#: ulng.rsoptionseditorconfiguration
|
|
msgctxt "ulng.rsoptionseditorconfiguration"
|
|
msgid "Configuration"
|
|
msgstr "Einstellungen"
|
|
|
|
#: ulng.rsoptionseditorcustomcolumns
|
|
msgid "Custom columns"
|
|
msgstr "Benutzerdefinierte Spalten"
|
|
|
|
#: ulng.rsoptionseditordirectoryhotlist
|
|
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Verzeichnisfavoriten"
|
|
|
|
#: ulng.rsoptionseditordraganddrop
|
|
msgid "Drag & drop"
|
|
msgstr "Drag & Drop (ziehen und ablegen)"
|
|
|
|
#: ulng.rsoptionseditordriveslistbutton
|
|
msgid "Drives list button"
|
|
msgstr "Button für das Laufwerks-Drop-down-Menü"
|
|
|
|
#: ulng.rsoptionseditorfavoritetabs
|
|
msgid "Favorite Tabs"
|
|
msgstr "Favoriten-Tabs"
|
|
|
|
#: ulng.rsoptionseditorfileassicextra
|
|
msgid "File associations extra"
|
|
msgstr "Extra Optionen für Dateiverknüpfungen"
|
|
|
|
#: ulng.rsoptionseditorfileassoc
|
|
msgctxt "ulng.rsoptionseditorfileassoc"
|
|
msgid "File associations"
|
|
msgstr "Dateiverknüpfungen"
|
|
|
|
#: ulng.rsoptionseditorfilenewfiletypes
|
|
#, fuzzy
|
|
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
|
msgid "New"
|
|
msgstr "Neu"
|
|
|
|
#: ulng.rsoptionseditorfileoperations
|
|
msgctxt "ulng.rsoptionseditorfileoperations"
|
|
msgid "File operations"
|
|
msgstr "Dateioperationen"
|
|
|
|
#: ulng.rsoptionseditorfilepanels
|
|
msgctxt "ulng.rsoptionseditorfilepanels"
|
|
msgid "File panels"
|
|
msgstr "Dateifenster"
|
|
|
|
#: ulng.rsoptionseditorfilesearch
|
|
#, fuzzy
|
|
msgctxt "ulng.rsoptionseditorfilesearch"
|
|
msgid "File search"
|
|
msgstr "Dateisuche"
|
|
|
|
#: ulng.rsoptionseditorfilesviews
|
|
msgid "Files views"
|
|
msgstr "Datei-Ansicht"
|
|
|
|
#: ulng.rsoptionseditorfiletypes
|
|
msgctxt "ulng.rsoptionseditorfiletypes"
|
|
msgid "File types"
|
|
msgstr "Dateitypen"
|
|
|
|
#: ulng.rsoptionseditorfoldertabs
|
|
msgctxt "ulng.rsoptionseditorfoldertabs"
|
|
msgid "Folder tabs"
|
|
msgstr "Verzeichnis-Tabs"
|
|
|
|
#: ulng.rsoptionseditorfoldertabsextra
|
|
msgid "Folder tabs extra"
|
|
msgstr "Favoriten-Tabs extra"
|
|
|
|
#: ulng.rsoptionseditorfonts
|
|
msgctxt "ulng.rsoptionseditorfonts"
|
|
msgid "Fonts"
|
|
msgstr "Schriftart"
|
|
|
|
#: ulng.rsoptionseditorhighlighters
|
|
msgid "Highlighters"
|
|
msgstr "Hervorheber"
|
|
|
|
#: ulng.rsoptionseditorhotkeys
|
|
msgctxt "ulng.rsoptionseditorhotkeys"
|
|
msgid "Hot keys"
|
|
msgstr "Tastaturkürzel"
|
|
|
|
#: ulng.rsoptionseditoricons
|
|
msgctxt "ulng.rsoptionseditoricons"
|
|
msgid "Icons"
|
|
msgstr "Icons"
|
|
|
|
#: ulng.rsoptionseditorignorelist
|
|
msgctxt "ulng.rsoptionseditorignorelist"
|
|
msgid "Ignore list"
|
|
msgstr "Ausschlussliste"
|
|
|
|
#: ulng.rsoptionseditorkeyboard
|
|
msgid "Keys"
|
|
msgstr "Tasten"
|
|
|
|
#: ulng.rsoptionseditorlanguage
|
|
msgctxt "ulng.rsoptionseditorlanguage"
|
|
msgid "Language"
|
|
msgstr "Sprache"
|
|
|
|
#: ulng.rsoptionseditorlayout
|
|
msgctxt "ulng.rsoptionseditorlayout"
|
|
msgid "Layout"
|
|
msgstr "Layout"
|
|
|
|
#: ulng.rsoptionseditorlog
|
|
msgctxt "ulng.rsoptionseditorlog"
|
|
msgid "Log"
|
|
msgstr "Log"
|
|
|
|
#: ulng.rsoptionseditormiscellaneous
|
|
msgctxt "ulng.rsoptionseditormiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Verschiedenes"
|
|
|
|
#: ulng.rsoptionseditormouse
|
|
msgid "Mouse"
|
|
msgstr "Maus"
|
|
|
|
#: ulng.rsoptionseditoroptionschanged
|
|
msgid ""
|
|
"Options have changed in \"%s\"\n"
|
|
"\n"
|
|
"Do you want to save modifications?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptionseditorplugins
|
|
msgctxt "ulng.rsoptionseditorplugins"
|
|
msgid "Plugins"
|
|
msgstr "Plugins"
|
|
|
|
#: ulng.rsoptionseditorquicksearch
|
|
msgctxt "ulng.rsoptionseditorquicksearch"
|
|
msgid "Quick search/filter"
|
|
msgstr "Schnelle Suche/Filter"
|
|
|
|
#: ulng.rsoptionseditorterminal
|
|
msgctxt "ulng.rsoptionseditorterminal"
|
|
msgid "Terminal"
|
|
msgstr "Befehlszeilen-Interpreter"
|
|
|
|
#: ulng.rsoptionseditortoolbar
|
|
msgid "Toolbar"
|
|
msgstr "Werkzeugleiste"
|
|
|
|
#: ulng.rsoptionseditortools
|
|
msgctxt "ulng.rsoptionseditortools"
|
|
msgid "Tools"
|
|
msgstr "Tools"
|
|
|
|
#: ulng.rsoptionseditortooltips
|
|
msgctxt "ulng.rsoptionseditortooltips"
|
|
msgid "Tooltips"
|
|
msgstr "Tooltips"
|
|
|
|
#: ulng.rsoptionseditortreeviewmenu
|
|
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
|
msgid "Tree View Menu"
|
|
msgstr "Menü Baumansicht"
|
|
|
|
#: ulng.rsoptionseditortreeviewmenucolors
|
|
msgid "Tree View Menu Colors"
|
|
msgstr "Farben Menü Baumansicht"
|
|
|
|
#: ulng.rsoptletters
|
|
msgid "None;Command Line;Quick Search;Quick Filter"
|
|
msgstr "Kein;Befehlszeile;Schnellsuche;Schnellfilter"
|
|
|
|
#: ulng.rsoptmouseselectionbutton
|
|
msgid "Left button;Right button;"
|
|
msgstr "Linke Taste;Rechte Taste;"
|
|
|
|
#: ulng.rsoptnewfilesposition
|
|
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
|
msgstr "an den Beginn der Dateiliste;hinter die Verzeichnisse (wenn Verzeichnisse vor Dateien sortiert werden sollen);an festgelegte Position;ans Ende der Dateiliste"
|
|
|
|
#: ulng.rsoptpluginalreadyassigned
|
|
msgid "Plugin %s is already assigned for the following extensions:"
|
|
msgstr "Plugin %s ist bereits den folgenden Dateiendungen zugewiesen:"
|
|
|
|
#: ulng.rsoptpluginsactive
|
|
msgctxt "ulng.rsoptpluginsactive"
|
|
msgid "Active"
|
|
msgstr "Aktiv"
|
|
|
|
#: ulng.rsoptpluginsfilename
|
|
msgctxt "ulng.rsoptpluginsfilename"
|
|
msgid "File name"
|
|
msgstr "Dateiname"
|
|
|
|
#: ulng.rsoptpluginsname
|
|
msgctxt "ulng.rsoptpluginsname"
|
|
msgid "Name"
|
|
msgstr "Name"
|
|
|
|
#: ulng.rsoptpluginsregisteredfor
|
|
msgctxt "ulng.rsoptpluginsregisteredfor"
|
|
msgid "Registered for"
|
|
msgstr "Registriert für"
|
|
|
|
#: ulng.rsoptsearchcase
|
|
msgid "&Sensitive;&Insensitive"
|
|
msgstr "Genaue &Schreibweise;unabhängig von der Schreibwe&ise"
|
|
|
|
#: ulng.rsoptsearchitems
|
|
msgid "&Files;Di&rectories;Files a&nd Directories"
|
|
msgstr "&Dateien;Ve&rzeichnisse;Dateien u&nd Verzeichnisse"
|
|
|
|
#: ulng.rsoptsearchopt
|
|
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
|
msgstr "Verstecke Filterpanel wenn es nicht ausgewä&hlt ist;Einstellung Änderungen speichern für die nächste Sitzung"
|
|
|
|
#: ulng.rsoptsortcasesens
|
|
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
|
msgstr "Nicht abhängig von der Schreibweise; abhängig von den lokalen Einstellungen (aAbBcC); erst Groß, dann klein (ABCabc)"
|
|
|
|
#: ulng.rsoptsortfoldermode
|
|
msgid "sort by name and show first;sort like files and show first;sort like files"
|
|
msgstr "Nach Namen sortieren und ersten anzeigen;wie Dateien sortieren und erste anzeigen;wie Dateien sortieren"
|
|
|
|
#: ulng.rsoptsortmethod
|
|
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
|
msgstr "Alphabetisch;Akzentuierungen beachten;Natürliche Sortierung: alphabetisch und numerisch"
|
|
|
|
#: ulng.rsopttabsposition
|
|
msgid "Top;Bottom;"
|
|
msgstr "Oben;Unten;"
|
|
|
|
#: ulng.rsopttoolbarbuttontype
|
|
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
|
msgstr "Tr&ennendes Element;&Interner Befehl;E&xterner Befehl;Men&ü"
|
|
|
|
#: ulng.rsopttypeofduplicatedrename
|
|
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
|
msgstr "DC Vermächtnis - Kopiere (x) Dateiname.ext;Windows - Dateiname (x).ext;Andere - Dateiname(x).ext"
|
|
|
|
#: ulng.rsoptupdatedfilesposition
|
|
msgid "don't change position;use the same setting as for new files;to sorted position"
|
|
msgstr "Position nicht verändern;die gleiche Einstellung wie für neue Dateien nutzen;an festgelegte Position"
|
|
|
|
#: ulng.rspropscontains
|
|
msgid "Files: %d, folders: %d"
|
|
msgstr "Dateien: %d, Verzeichnisse: %d"
|
|
|
|
#: ulng.rspropserrchmod
|
|
msgid "Can not change access rights for \"%s\""
|
|
msgstr "Kann die Zugriffsrechte für die Datei \"%s\" nicht ändern"
|
|
|
|
#: ulng.rspropserrchown
|
|
msgid "Can not change owner for \"%s\""
|
|
msgstr "Kann den Besitzer für \"%s\" nicht ändern"
|
|
|
|
#: ulng.rspropsfile
|
|
msgctxt "ulng.rspropsfile"
|
|
msgid "File"
|
|
msgstr "Datei"
|
|
|
|
#: ulng.rspropsfolder
|
|
msgctxt "ulng.rspropsfolder"
|
|
msgid "Directory"
|
|
msgstr "Verzeichnis"
|
|
|
|
#: ulng.rspropsnmdpipe
|
|
msgid "Named pipe"
|
|
msgstr "Benannte Pipe"
|
|
|
|
#: ulng.rspropssocket
|
|
msgid "Socket"
|
|
msgstr "Socket"
|
|
|
|
#: ulng.rspropsspblkdev
|
|
msgid "Special block device"
|
|
msgstr "Spezielles Block-device"
|
|
|
|
#: ulng.rspropsspchrdev
|
|
msgid "Special character device"
|
|
msgstr "Spezielles Buchstaben-device"
|
|
|
|
#: ulng.rspropssymlink
|
|
msgid "Symbolic link"
|
|
msgstr "Symbolischer Link"
|
|
|
|
#: ulng.rspropsunknowntype
|
|
msgid "Unknown type"
|
|
msgstr "Unbekannter Typ"
|
|
|
|
#: ulng.rssearchresult
|
|
msgid "Search result"
|
|
msgstr "Suchergebnis"
|
|
|
|
#: ulng.rssearchstatus
|
|
msgid "SEARCH"
|
|
msgstr "SUCHE"
|
|
|
|
#: ulng.rssearchtemplateunnamed
|
|
msgid "<unnamed template>"
|
|
msgstr "<unbenannte Vorlage>"
|
|
|
|
#: ulng.rssearchwithdsxplugininprogress
|
|
msgid ""
|
|
"A file search using DSX plugin is already in progress.\n"
|
|
"We need that one to be completed before to launch a new one.\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rssearchwithwdxplugininprogress
|
|
msgid ""
|
|
"A file search using WDX plugin is already in progress.\n"
|
|
"We need that one to be completed before to launch a new one.\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsselectdir
|
|
msgid "Select a directory"
|
|
msgstr "Wähle ein Verzeichnis"
|
|
|
|
#: ulng.rsselectyoufindfileswindow
|
|
msgid "Select your window"
|
|
msgstr ""
|
|
|
|
#: ulng.rsshowhelpfor
|
|
msgid "&Show help for %s"
|
|
msgstr "&Zeige Hilfe zu %s"
|
|
|
|
#: ulng.rssimplewordall
|
|
msgctxt "ulng.rssimplewordall"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: ulng.rssimplewordcategory
|
|
msgctxt "ulng.rssimplewordcategory"
|
|
msgid "Category"
|
|
msgstr "Kategorie"
|
|
|
|
#: ulng.rssimplewordcolumnsingular
|
|
msgid "Column"
|
|
msgstr "Spalte"
|
|
|
|
#: ulng.rssimplewordcommand
|
|
msgctxt "ulng.rssimplewordcommand"
|
|
msgid "Command"
|
|
msgstr "Befehl"
|
|
|
|
#: ulng.rssimplewordfilename
|
|
msgid "Filename"
|
|
msgstr "Dateiname"
|
|
|
|
#: ulng.rssimplewordfiles
|
|
msgid "files"
|
|
msgstr "Dateien"
|
|
|
|
#: ulng.rssimplewordletter
|
|
msgid "Letter"
|
|
msgstr ""
|
|
|
|
#: ulng.rssimplewordparameter
|
|
msgid "Param"
|
|
msgstr "Parameter"
|
|
|
|
#: ulng.rssimplewordresult
|
|
msgid "Result"
|
|
msgstr "Ergebnis"
|
|
|
|
#: ulng.rssimplewordworkdir
|
|
msgid "WorkDir"
|
|
msgstr "Arbeitsverzeichnis"
|
|
|
|
#: ulng.rssizeunitbytes
|
|
msgid "Bytes"
|
|
msgstr "Bytes"
|
|
|
|
#: ulng.rssizeunitgbytes
|
|
msgctxt "ulng.rssizeunitgbytes"
|
|
msgid "Gigabytes"
|
|
msgstr "Gigabytes"
|
|
|
|
#: ulng.rssizeunitkbytes
|
|
msgctxt "ulng.rssizeunitkbytes"
|
|
msgid "Kilobytes"
|
|
msgstr "Kilobytes"
|
|
|
|
#: ulng.rssizeunitmbytes
|
|
msgctxt "ulng.rssizeunitmbytes"
|
|
msgid "Megabytes"
|
|
msgstr "Megabytes"
|
|
|
|
#: ulng.rssizeunittbytes
|
|
msgid "Terabytes"
|
|
msgstr "Terabytes"
|
|
|
|
#: ulng.rsspacemsg
|
|
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
|
msgstr "Dateien: %d, Verzeichnis: %d, Grösse: %s (%s byte)"
|
|
|
|
#: ulng.rsspliterrdirectory
|
|
msgid "Unable to create target directory!"
|
|
msgstr "Kann Zielverzeichnis nicht erstellen"
|
|
|
|
#: ulng.rsspliterrfilesize
|
|
msgid "Incorrect file size format!"
|
|
msgstr "Falsches Dateigrössenformat!"
|
|
|
|
#: ulng.rsspliterrsplitfile
|
|
msgid "Unable to split the file!"
|
|
msgstr "Kann Datei nicht teilen!"
|
|
|
|
#: ulng.rssplitmsgmanyparts
|
|
msgid "The number of parts is more than 100! Continue?"
|
|
msgstr "Die Anzahl der Teile ist grösser als 100! Fortfahren?"
|
|
|
|
#: ulng.rssplitpredefinedsizes
|
|
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
|
msgstr ""
|
|
|
|
#: ulng.rssplitseldir
|
|
msgid "Select directory:"
|
|
msgstr "Wähle Verzeichnis:"
|
|
|
|
#: ulng.rsstraccents
|
|
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstraccentsstripped
|
|
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewjustpreview
|
|
msgid "Just preview"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewothers
|
|
msgid "Others"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewsearchingletters
|
|
msgid "OU"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewsidenote
|
|
msgid "Side note"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched1
|
|
msgid "Flat"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched2
|
|
msgid "Limited"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched3
|
|
msgid "Simple"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched1
|
|
msgid "Fabulous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched2
|
|
msgid "Marvelous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched3
|
|
msgid "Tremendous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosedirhistory
|
|
msgid "Choose your directory from Dir History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefavoritetabs
|
|
msgid "Choose you Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
|
msgid "Choose your command from Command Line History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefrommainmenu
|
|
msgid "Choose your action from Main Menu"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefromtoolbar
|
|
msgid "Choose your action from Maintool bar"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosehotdirectory
|
|
msgid "Choose your directory from Hot Directory:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchooseviewhistory
|
|
msgid "Choose your directory from File View History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchooseyourfileordir
|
|
msgid "Choose your file or your directory"
|
|
msgstr ""
|
|
|
|
#: ulng.rssymerrcreate
|
|
msgid "Error creating symlink."
|
|
msgstr "Fehler beim Erstellen des symb. Link."
|
|
|
|
#: ulng.rssyndefaulttext
|
|
msgctxt "ulng.rssyndefaulttext"
|
|
msgid "Default text"
|
|
msgstr "Standardtext"
|
|
|
|
#: ulng.rssynlangplaintext
|
|
msgctxt "ulng.rssynlangplaintext"
|
|
msgid "Plain text"
|
|
msgstr "Reiner Text"
|
|
|
|
#: ulng.rstabsactionondoubleclickchoices
|
|
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
|
msgstr "Nichts tun;Tab schließen;Favoriten-Tabs;Tabs Popup-Menü"
|
|
|
|
#: ulng.rstimeunitday
|
|
msgctxt "ulng.rstimeunitday"
|
|
msgid "Day(s)"
|
|
msgstr "Tag(e)"
|
|
|
|
#: ulng.rstimeunithour
|
|
msgid "Hour(s)"
|
|
msgstr "Stunde(n)"
|
|
|
|
#: ulng.rstimeunitminute
|
|
msgid "Minute(s)"
|
|
msgstr "Minute(n)"
|
|
|
|
#: ulng.rstimeunitmonth
|
|
msgid "Month(s)"
|
|
msgstr "Monat(e)"
|
|
|
|
#: ulng.rstimeunitsecond
|
|
msgid "Second(s)"
|
|
msgstr "Sekunde(n)"
|
|
|
|
#: ulng.rstimeunitweek
|
|
msgid "Week(s)"
|
|
msgstr "Woche(n)"
|
|
|
|
#: ulng.rstimeunityear
|
|
msgid "Year(s)"
|
|
msgstr "Jahr(e)"
|
|
|
|
#: ulng.rstitlerenamefavtabs
|
|
msgid "Rename Favorite Tabs"
|
|
msgstr "Favoriten-Tabs umbenennen"
|
|
|
|
#: ulng.rstitlerenamefavtabsmenu
|
|
msgid "Rename Favorite Tabs sub-menu"
|
|
msgstr "Untermenü der Favoriten-Tabs umbenennen"
|
|
|
|
#: ulng.rstooldiffer
|
|
msgctxt "ulng.rstooldiffer"
|
|
msgid "Differ"
|
|
msgstr "Vergleichsprogramm"
|
|
|
|
#: ulng.rstooleditor
|
|
msgctxt "ulng.rstooleditor"
|
|
msgid "Editor"
|
|
msgstr "Text-Editor"
|
|
|
|
#: ulng.rstoolerroropeningdiffer
|
|
msgid "Error opening differ"
|
|
msgstr "Fehler beim Öffnen des Vergleichers"
|
|
|
|
#: ulng.rstoolerroropeningeditor
|
|
msgid "Error opening editor"
|
|
msgstr "Fehler beim Öffnen des Editors"
|
|
|
|
#: ulng.rstoolerroropeningterminal
|
|
msgid "Error opening terminal"
|
|
msgstr "Fehler beim Starten des Befehlszeilen-Interpreters"
|
|
|
|
#: ulng.rstoolerroropeningviewer
|
|
msgid "Error opening viewer"
|
|
msgstr "Fehler beim Öffnen des Betrachters"
|
|
|
|
#: ulng.rstoolterminal
|
|
msgctxt "ulng.rstoolterminal"
|
|
msgid "Terminal"
|
|
msgstr "Befehlszeilen-Interpreter"
|
|
|
|
#: ulng.rstoolviewer
|
|
msgctxt "ulng.rstoolviewer"
|
|
msgid "Viewer"
|
|
msgstr "Schnellansicht"
|
|
|
|
#: ulng.rsunhandledexceptionmessage
|
|
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
|
msgstr "Bitte diesen Fehler im Bug-Tracker melden, mit einer Beschreibung was Sie getan haben und der folgenden Datei:%s Klicken Sie auf %s zum Fortfahren oder %s zum Abbrechen."
|
|
|
|
#: ulng.rsvarbothpanelactivetoinactive
|
|
msgid "Both panels, from active to inactive"
|
|
msgstr "Beide Panels, von aktiv zu inaktiv"
|
|
|
|
#: ulng.rsvarbothpanellefttoright
|
|
msgid "Both panels, from left to right"
|
|
msgstr "Beide Panels, von links nach rechts"
|
|
|
|
#: ulng.rsvarcurrentpath
|
|
msgid "Path of panel"
|
|
msgstr "Pfad des Panels"
|
|
|
|
#: ulng.rsvarencloseelement
|
|
msgid "Enclose each name in brackets or what you want"
|
|
msgstr "Jeden Namen in Klammern schließen, oder nach Belieben"
|
|
|
|
#: ulng.rsvarfilenamenoext
|
|
msgid "Just filename, no extension"
|
|
msgstr "Nur Dateinamen, keine Endung"
|
|
|
|
#: ulng.rsvarfullpath
|
|
msgid "Complete filename (path+filename)"
|
|
msgstr "Kompletten Dateinamen (mit Pfad)"
|
|
|
|
#: ulng.rsvarhelpwith
|
|
msgid "Help with \"%\" variables"
|
|
msgstr "Hilfe mit \"%\" Variablen"
|
|
|
|
#: ulng.rsvarinputparam
|
|
msgid "Will request request user to enter a parameter with a default suggested value"
|
|
msgstr "Fordert Nutzer auf einen Parameter einzugeben, mit einem vorgeschlagenen Standardwert"
|
|
|
|
#: ulng.rsvarleftpanel
|
|
msgid "Left panel"
|
|
msgstr "Linkes Panel"
|
|
|
|
#: ulng.rsvarlistfilename
|
|
msgid "Temporary filename of list of filenames"
|
|
msgstr "Temporärer Dateiname aus Liste mit Dateinamen"
|
|
|
|
#: ulng.rsvarlistfullfilename
|
|
msgid "Temporary filename of list of complete filenames (path+filename)"
|
|
msgstr "Temporärer Dateiname aus Liste mit kompletten Dateinamen (Pfad und Dateiname)"
|
|
|
|
#: ulng.rsvarlistinutf16
|
|
msgid "Filenames in list in UTF-16 with BOM"
|
|
msgstr "Dateinamen in Liste in UTF-16 mit BOM"
|
|
|
|
#: ulng.rsvarlistinutf16quoted
|
|
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
|
msgstr "Dateinamen in Liste in UTF-16 mit BOM, in Anführungszeichen"
|
|
|
|
#: ulng.rsvarlistinutf8
|
|
msgid "Filenames in list in UTF-8"
|
|
msgstr "Dateinamen in Liste in UTF-8"
|
|
|
|
#: ulng.rsvarlistinutf8quoted
|
|
msgid "Filenames in list in UTF-8, inside double quotes"
|
|
msgstr "Dateinamen in Liste in UTF-8, in Anführungszeichen"
|
|
|
|
#: ulng.rsvarlistrelativefilename
|
|
msgid "Temporary filename of list of filenames with relative path"
|
|
msgstr "Temporärer Dateiname aus Liste mit Dateinamen mit relativem Pfad"
|
|
|
|
#: ulng.rsvaronlyextension
|
|
msgid "Only file extension"
|
|
msgstr "Nur Dateiendung"
|
|
|
|
#: ulng.rsvaronlyfilename
|
|
msgid "Only filename"
|
|
msgstr "Nur Dateiname"
|
|
|
|
#: ulng.rsvarotherexamples
|
|
msgid "Other example of what's possible"
|
|
msgstr "Anderes Beispiel für Möglichkeiten"
|
|
|
|
#: ulng.rsvarpath
|
|
#, fuzzy
|
|
#| msgid "Path, with ending delimiter"
|
|
msgid "Path, without ending delimiter"
|
|
msgstr "Pfad, mit Trennzeichen am Ende"
|
|
|
|
#: ulng.rsvarpercentchangetopound
|
|
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
|
msgstr "Von hier bis zum Ende der Zeile; die Prozent-Anzeige ist das \"#\" Zeichen"
|
|
|
|
#: ulng.rsvarpercentsign
|
|
msgid "Return the percent sign"
|
|
msgstr "Setze das Prozentzeichen zurück"
|
|
|
|
#: ulng.rsvarpoundchangetopercent
|
|
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
|
msgstr "Von hier bis zum Ende der Zeile; die Prozent-Anzeige ist hinter dem \"%\" Zeichen"
|
|
|
|
#: ulng.rsvarprependelement
|
|
msgid "Prepend each name with \"-a \" or what you want"
|
|
msgstr "Stelle jedem Namen \"-a\" voran, oder was auch immer"
|
|
|
|
#: ulng.rsvarpromptuserforparam
|
|
msgid "%[Prompt user for param;Default value proposed]"
|
|
msgstr "% [Frage den Nutzer nach Parameter;Standardwert wird vorgeschlagen]"
|
|
|
|
#: ulng.rsvarrelativepathandfilename
|
|
msgid "Filename with relative path"
|
|
msgstr "Dateiname mit relativem Pfad"
|
|
|
|
#: ulng.rsvarrightpanel
|
|
msgid "Right panel"
|
|
msgstr "Rechtes Panel"
|
|
|
|
#: ulng.rsvarsecondelementrightpanel
|
|
msgid "Full path of second selected file in right panel"
|
|
msgstr "Voller Pfad der zweiten gewählten Datei im rechten Panel"
|
|
|
|
#: ulng.rsvarshowcommandprior
|
|
msgid "Show command prior execute"
|
|
msgstr "Zeige Befehl vor der Ausführung"
|
|
|
|
#: ulng.rsvarsimplemessage
|
|
msgid "%[Simple message]"
|
|
msgstr "% [Einfache Nachricht]"
|
|
|
|
#: ulng.rsvarsimpleshowmessage
|
|
msgid "Will show a simple message"
|
|
msgstr "Zeigt eine einfache Nachricht"
|
|
|
|
#: ulng.rsvarsourcepanel
|
|
msgid "Active panel (source)"
|
|
msgstr "Aktives Panel (Quelle)"
|
|
|
|
#: ulng.rsvartargetpanel
|
|
msgid "Inactive panel (target)"
|
|
msgstr "Inaktives Panel (Ziel)"
|
|
|
|
#: ulng.rsvarwillbequoted
|
|
msgid "Filenames will be quoted from here (default)"
|
|
msgstr "Dateinamen werden von hier aus zitiert (Standard)."
|
|
|
|
#: ulng.rsvarwilldointerminal
|
|
msgid "Command will be done in terminal, remaining opened at the end"
|
|
msgstr "Befehle werden im Terminal ausgeführt. Dies bleibt am Ende geöffnet."
|
|
|
|
#: ulng.rsvarwillhaveendingdelimiter
|
|
msgid "Paths will have ending delimiter"
|
|
msgstr "Pfade werden am Ende ein trennendes Zeichen haben"
|
|
|
|
#: ulng.rsvarwillnotbequoted
|
|
msgid "Filenames will not be quoted from here"
|
|
msgstr "Dateinamen werden von hier aus nicht zitiert"
|
|
|
|
#: ulng.rsvarwillnotdointerminal
|
|
msgid "Command will be done in terminal, closed at the end"
|
|
msgstr "Befehl wird im Terminal ausgeführt. Dies wird nach der Ausführung geschlossen"
|
|
|
|
#: ulng.rsvarwillnothaveendingdelimiter
|
|
msgid "Paths will not have ending delimiter (default)"
|
|
msgstr "Pfade werden am Ende kein trennendes Zeichen haben (Standard)"
|
|
|
|
#: ulng.rsvfsnetwork
|
|
msgctxt "ulng.rsvfsnetwork"
|
|
msgid "Network"
|
|
msgstr "&Netzwerk"
|
|
|
|
#: ulng.rsviewabouttext
|
|
msgid "Internal Viewer of Double Commander."
|
|
msgstr "Interner Betrachter des Double Commander"
|
|
|
|
#: ulng.rsviewbadquality
|
|
msgid "Bad Quality"
|
|
msgstr "Schlechte Qualität"
|
|
|
|
#: ulng.rsviewencoding
|
|
msgctxt "ulng.rsviewencoding"
|
|
msgid "Encoding"
|
|
msgstr "Kodierung"
|
|
|
|
#: ulng.rsviewimagetype
|
|
msgid "Image Type"
|
|
msgstr "Bildtyp"
|
|
|
|
#: ulng.rsviewnewsize
|
|
msgctxt "ulng.rsviewnewsize"
|
|
msgid "New Size"
|
|
msgstr "Neue Grösse"
|
|
|
|
#: ulng.rsviewnotfound
|
|
msgid "%s not found!"
|
|
msgstr "%s nicht gefunden!"
|
|
|
|
#: ulng.rsviewwithexternalviewer
|
|
msgid "with external viewer"
|
|
msgstr "Mit externem Betrachter"
|
|
|
|
#: ulng.rsviewwithinternalviewer
|
|
msgid "with internal viewer"
|
|
msgstr "Mit internem Betrachter"
|
|
|
|
#: ulng.rsxreplacements
|
|
msgid "Number of replacement: %d"
|
|
msgstr "Anzahl der Ersetzungen: %d"
|
|
|
|
#: ulng.rszeroreplacement
|
|
msgid "No replacement took place."
|
|
msgstr "Nichts wurde ersetzt."
|
|
|