mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-28 10:02:14 +00:00
12013 lines
330 KiB
Text
12013 lines
330 KiB
Text
# Slovenian translations for double-commander.
|
||
# Copyright (C) YEAR THE PACKAGE'S COPYRIGHT HOLDER.
|
||
# This file is distributed under the same license as the double-commander package.
|
||
#
|
||
# Matej Urbančič <mateju@svn.gnome.org>, 2011–2016.
|
||
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: double-commander master\n"
|
||
"Report-Msgid-Bugs-To: \n"
|
||
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
|
||
"PO-Revision-Date: 2016-12-26 19:21+0100\n"
|
||
"Last-Translator: Matej Urbančič <mateju@svn.gnome.org>\n"
|
||
"Language-Team: Slovenian GNOME Translation Team <gnome-si@googlegroups.com>\n"
|
||
"Language: sl_SI\n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"Plural-Forms: nplurals=4; plural=(n%100==1 ? 1 : n%100==2 ? 2 : n%100==3 || n%100==4 ? 3 : 0);\n"
|
||
"X-Poedit-SourceCharset: utf-8\n"
|
||
"X-Generator: Poedit 1.8.9\n"
|
||
"X-Native-Language: Slovenščina\n"
|
||
|
||
#: fsyncdirsdlg.rscomparingpercent
|
||
msgid "Comparing... %d%% (ESC to cancel)"
|
||
msgstr "Poteka primerjava ... %d%% (s tipko ESC se opravilo prekliče)"
|
||
|
||
#: fsyncdirsdlg.rsdeleteright
|
||
msgid "Right: Delete %d file(s)"
|
||
msgstr "Desno: izbriši %d datotek"
|
||
|
||
#: fsyncdirsdlg.rsfilesfound
|
||
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
||
msgstr "Število najdenih datotek: %d (Enakih: %d, Različnih: %d, Različnih na levi: %d, Različnih na desni: %d)"
|
||
|
||
#: fsyncdirsdlg.rslefttorightcopy
|
||
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
||
msgstr "Z leve na desno: kopiraj %d datotek s skupno velikostjo %d bajtov"
|
||
|
||
#: fsyncdirsdlg.rsrighttoleftcopy
|
||
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
||
msgstr "Z desne na levo: kopiraj %d datotek s skupno velikostjo %d bajtov"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
||
msgid "Choose template..."
|
||
msgstr "Izbor predloge ..."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
||
msgid "C&heck free space"
|
||
msgstr "Preveri &zasedenost prostora"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
||
msgid "Cop&y attributes"
|
||
msgstr "&Kopiraj atribute"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
||
msgid "Copy o&wnership"
|
||
msgstr "Kopiraj &lastništvo"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
||
msgid "Copy &permissions"
|
||
msgstr "Kopiraj &dovoljenja"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Kopiraj &datum in čas"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
||
msgid "Correct lin&ks"
|
||
msgstr "Popravi &povezave"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
||
msgid "Drop readonly fla&g"
|
||
msgstr "Izpusti zastavico le za branje"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
||
msgid "E&xclude empty directories"
|
||
msgstr "Ne &upoštevaj praznih map"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
||
msgid "Fo&llow links"
|
||
msgstr "Sledi &povezavam"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
||
msgid "&Reserve space"
|
||
msgstr "&Zadrži prostor"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
||
msgid "&Verify"
|
||
msgstr "&Preveri"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
||
msgid "What to do when cannot set file time, attributes, etc."
|
||
msgstr "Kaj storiti, ko ni mogoče nastaviti časa datoteke, atributov ..."
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
||
msgid "Use file template"
|
||
msgstr "Uporabi predlogo datotek"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
||
msgid "When dir&ectory exists"
|
||
msgstr "Če mapa že obstaja"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
||
msgid "When &file exists"
|
||
msgstr "Če datoteka &že obstaja"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
||
msgid "When ca&nnot set property"
|
||
msgstr "Ko &lastnosti ni mogoče nastaviti"
|
||
|
||
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
||
msgid "<no template>"
|
||
msgstr "<brez predloge>"
|
||
|
||
#: tfrmabout.btnclose.caption
|
||
msgctxt "tfrmabout.btnclose.caption"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmabout.btncopytoclipboard.caption
|
||
msgid "Copy to clipboard"
|
||
msgstr "Kopiraj v odložišče"
|
||
|
||
#: tfrmabout.caption
|
||
msgctxt "tfrmabout.caption"
|
||
msgid "About"
|
||
msgstr "O programu"
|
||
|
||
#: tfrmabout.lblbuild.caption
|
||
msgctxt "tfrmabout.lblbuild.caption"
|
||
msgid "Build"
|
||
msgstr "Datum izgradnje"
|
||
|
||
#: tfrmabout.lblfreepascalver.caption
|
||
msgctxt "tfrmabout.lblfreepascalver.caption"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmabout.lblhomepage.caption
|
||
msgid "Home Page:"
|
||
msgstr "Domača stran:"
|
||
|
||
#: tfrmabout.lblhomepageaddress.caption
|
||
msgid "http://doublecmd.sourceforge.net"
|
||
msgstr "http://doublecmd.sourceforge.net"
|
||
|
||
#: tfrmabout.lbllazarusver.caption
|
||
msgctxt "tfrmabout.lbllazarusver.caption"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmabout.lblrevision.caption
|
||
msgctxt "tfrmabout.lblrevision.caption"
|
||
msgid "Revision"
|
||
msgstr "Predelava"
|
||
|
||
#: tfrmabout.lbltitle.caption
|
||
msgctxt "tfrmabout.lbltitle.caption"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmabout.lblversion.caption
|
||
msgctxt "tfrmabout.lblversion.caption"
|
||
msgid "Version"
|
||
msgstr "Različica"
|
||
|
||
#: tfrmattributesedit.btncancel.caption
|
||
msgctxt "tfrmattributesedit.btncancel.caption"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmattributesedit.btnok.caption
|
||
msgctxt "tfrmattributesedit.btnok.caption"
|
||
msgid "&OK"
|
||
msgstr "V &redu"
|
||
|
||
#: tfrmattributesedit.btnreset.caption
|
||
msgid "&Reset"
|
||
msgstr "&Ponastavi"
|
||
|
||
#: tfrmattributesedit.caption
|
||
msgid "Choose attributes"
|
||
msgstr "Izbor atributov"
|
||
|
||
#: tfrmattributesedit.cbarchive.caption
|
||
msgid "&Archive"
|
||
msgstr "&Arhiv"
|
||
|
||
#: tfrmattributesedit.cbcompressed.caption
|
||
msgid "Co&mpressed"
|
||
msgstr "&Stisnjeno"
|
||
|
||
#: tfrmattributesedit.cbdirectory.caption
|
||
msgid "&Directory"
|
||
msgstr "&Mapa"
|
||
|
||
#: tfrmattributesedit.cbencrypted.caption
|
||
msgid "&Encrypted"
|
||
msgstr "&Šifrirano"
|
||
|
||
#: tfrmattributesedit.cbhidden.caption
|
||
msgid "&Hidden"
|
||
msgstr "&Skrito"
|
||
|
||
#: tfrmattributesedit.cbreadonly.caption
|
||
msgid "Read o&nly"
|
||
msgstr "Le za &branje"
|
||
|
||
#: tfrmattributesedit.cbsgid.caption
|
||
msgctxt "tfrmattributesedit.cbsgid.caption"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmattributesedit.cbsparse.caption
|
||
msgid "S&parse"
|
||
msgstr "&Redko"
|
||
|
||
#: tfrmattributesedit.cbsticky.caption
|
||
msgctxt "tfrmattributesedit.cbsticky.caption"
|
||
msgid "Sticky"
|
||
msgstr "Lepljivo"
|
||
|
||
#: tfrmattributesedit.cbsuid.caption
|
||
msgctxt "tfrmattributesedit.cbsuid.caption"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmattributesedit.cbsymlink.caption
|
||
msgid "&Symlink"
|
||
msgstr "&Simbolna povezava"
|
||
|
||
#: tfrmattributesedit.cbsystem.caption
|
||
msgid "S&ystem"
|
||
msgstr "S&istem"
|
||
|
||
#: tfrmattributesedit.cbtemporary.caption
|
||
msgid "&Temporary"
|
||
msgstr "&Začasno"
|
||
|
||
#: tfrmattributesedit.gbntfsattributes.caption
|
||
msgid "NTFS attributes"
|
||
msgstr "Atributi NTFS"
|
||
|
||
#: tfrmattributesedit.gbwingeneral.caption
|
||
msgid "General attributes"
|
||
msgstr "Splošni atributi"
|
||
|
||
#: tfrmattributesedit.lblattrbitsstr.caption
|
||
msgctxt "tfrmattributesedit.lblattrbitsstr.caption"
|
||
msgid "Bits:"
|
||
msgstr "Biti:"
|
||
|
||
#: tfrmattributesedit.lblattrgroupstr.caption
|
||
msgctxt "tfrmattributesedit.lblattrgroupstr.caption"
|
||
msgid "Group"
|
||
msgstr "Skupina"
|
||
|
||
#: tfrmattributesedit.lblattrotherstr.caption
|
||
msgctxt "tfrmattributesedit.lblattrotherstr.caption"
|
||
msgid "Other"
|
||
msgstr "Drugo"
|
||
|
||
#: tfrmattributesedit.lblattrownerstr.caption
|
||
msgctxt "tfrmattributesedit.lblattrownerstr.caption"
|
||
msgid "Owner"
|
||
msgstr "Lastnik"
|
||
|
||
#: tfrmattributesedit.lblexec.caption
|
||
msgctxt "tfrmattributesedit.lblexec.caption"
|
||
msgid "Execute"
|
||
msgstr "Izvajanje"
|
||
|
||
#: tfrmattributesedit.lblread.caption
|
||
msgctxt "tfrmattributesedit.lblread.caption"
|
||
msgid "Read"
|
||
msgstr "Branje"
|
||
|
||
#: tfrmattributesedit.lbltextattrs.caption
|
||
msgid "As te&xt:"
|
||
msgstr "Kot &besedilo:"
|
||
|
||
#: tfrmattributesedit.lblwrite.caption
|
||
msgctxt "tfrmattributesedit.lblwrite.caption"
|
||
msgid "Write"
|
||
msgstr "Pisanje"
|
||
|
||
#: tfrmchecksumcalc.caption
|
||
msgctxt "tfrmchecksumcalc.caption"
|
||
msgid "Calculate checksum..."
|
||
msgstr "Izračun nadzornih vsot"
|
||
|
||
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
||
msgid "Open checksum file after job is completed"
|
||
msgstr "Po koncu izračunavanja odpri datoteko nadzorne vsote"
|
||
|
||
#: tfrmchecksumcalc.cbseparatefile.caption
|
||
msgid "C&reate separate checksum file for each file"
|
||
msgstr "Za vsako datoteko &ustvari ločeno datoteko nadzorne vsote"
|
||
|
||
#: tfrmchecksumcalc.lblsaveto.caption
|
||
msgid "&Save checksum file(s) to:"
|
||
msgstr "Shrani datoteke z nadzornimi &vsotami v:"
|
||
|
||
#: tfrmchecksumverify.btnclose.caption
|
||
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmchecksumverify.caption
|
||
msgctxt "tfrmchecksumverify.caption"
|
||
msgid "Verify checksum..."
|
||
msgstr "Preveri nadzo&rno vsoto ..."
|
||
|
||
#: tfrmconnectionmanager.btnadd.caption
|
||
msgctxt "tfrmconnectionmanager.btnadd.caption"
|
||
msgid "A&dd"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmconnectionmanager.btncancel.caption
|
||
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmconnectionmanager.btnconnect.caption
|
||
msgid "C&onnect"
|
||
msgstr "&Povezava"
|
||
|
||
#: tfrmconnectionmanager.btndelete.caption
|
||
msgctxt "tfrmconnectionmanager.btndelete.caption"
|
||
msgid "&Delete"
|
||
msgstr "&Izbriši"
|
||
|
||
#: tfrmconnectionmanager.btnedit.caption
|
||
msgctxt "tfrmconnectionmanager.btnedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "&Uredi"
|
||
|
||
#: tfrmconnectionmanager.caption
|
||
msgid "Connection manager"
|
||
msgstr "Upravljalnik povezav"
|
||
|
||
#: tfrmconnectionmanager.gbconnectto.caption
|
||
msgid "Connect to:"
|
||
msgstr "Povezava s strežnikom:"
|
||
|
||
#: tfrmcopydlg.btnaddtoqueue.caption
|
||
msgid "A&dd To Queue"
|
||
msgstr "&Dodaj v vrsto"
|
||
|
||
#: tfrmcopydlg.btncancel.caption
|
||
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmcopydlg.btnoptions.caption
|
||
msgid "O&ptions"
|
||
msgstr "&Možnosti"
|
||
|
||
#: tfrmcopydlg.btnsaveoptions.caption
|
||
msgid "Sa&ve these options as default"
|
||
msgstr "&Shrani trenutne možnosti kot privzete"
|
||
|
||
#: tfrmcopydlg.caption
|
||
msgctxt "tfrmcopydlg.caption"
|
||
msgid "Copy file(s)"
|
||
msgstr "Kopiraj datoteke"
|
||
|
||
#: tfrmcopydlg.mnunewqueue.caption
|
||
msgid "New queue"
|
||
msgstr "Nova čakalna vrsta"
|
||
|
||
#: tfrmcopydlg.mnuqueue1.caption
|
||
msgid "Queue 1"
|
||
msgstr "Vrsta 1"
|
||
|
||
#: tfrmcopydlg.mnuqueue2.caption
|
||
msgid "Queue 2"
|
||
msgstr "Vrsta 2"
|
||
|
||
#: tfrmcopydlg.mnuqueue3.caption
|
||
msgid "Queue 3"
|
||
msgstr "Vrsta 3"
|
||
|
||
#: tfrmcopydlg.mnuqueue4.caption
|
||
msgid "Queue 4"
|
||
msgstr "Vrsta 4"
|
||
|
||
#: tfrmcopydlg.mnuqueue5.caption
|
||
msgid "Queue 5"
|
||
msgstr "Vrsta 5"
|
||
|
||
#: tfrmdescredit.actsavedescription.caption
|
||
msgid "Save Description"
|
||
msgstr "Shrani opis"
|
||
|
||
#: tfrmdescredit.btncancel.caption
|
||
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmdescredit.btnok.caption
|
||
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: tfrmdescredit.caption
|
||
msgid "File/folder comment"
|
||
msgstr "Opomba datoteke ali mape"
|
||
|
||
#: tfrmdescredit.lbleditcommentfor.caption
|
||
msgid "E&dit comment for:"
|
||
msgstr "&Uredi opombo za:"
|
||
|
||
#: tfrmdescredit.lblencoding.caption
|
||
msgid "&Encoding:"
|
||
msgstr "&Kodni nabor:"
|
||
|
||
#: tfrmdescredit.lblfilename.caption
|
||
msgctxt "tfrmdescredit.lblfilename.caption"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmdiffer.actabout.caption
|
||
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "O programu"
|
||
|
||
#: tfrmdiffer.actautocompare.caption
|
||
msgid "Auto Compare"
|
||
msgstr "Samodejna primerjava"
|
||
|
||
#: tfrmdiffer.actbinarycompare.caption
|
||
msgid "Binary Mode"
|
||
msgstr "Dvojiški način"
|
||
|
||
#: tfrmdiffer.actcancelcompare.caption
|
||
msgctxt "tfrmdiffer.actcancelcompare.caption"
|
||
msgid "Cancel"
|
||
msgstr "Prekliči"
|
||
|
||
#: tfrmdiffer.actcancelcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
||
msgid "Cancel"
|
||
msgstr "Prekliči"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.caption
|
||
msgctxt "tfrmdiffer.actcopylefttoright.caption"
|
||
msgid "Copy Block Right"
|
||
msgstr "Kopiraj blok na desno"
|
||
|
||
#: tfrmdiffer.actcopylefttoright.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
||
msgid "Copy Block Right"
|
||
msgstr "Kopiraj blok na desno"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.caption
|
||
msgctxt "tfrmdiffer.actcopyrighttoleft.caption"
|
||
msgid "Copy Block Left"
|
||
msgstr "Kopiraj blok na levo"
|
||
|
||
#: tfrmdiffer.actcopyrighttoleft.hint
|
||
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
||
msgid "Copy Block Left"
|
||
msgstr "Kopiraj blok na levo"
|
||
|
||
#: tfrmdiffer.acteditcopy.caption
|
||
msgctxt "tfrmdiffer.acteditcopy.caption"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmdiffer.acteditcut.caption
|
||
msgctxt "tfrmdiffer.acteditcut.caption"
|
||
msgid "Cut"
|
||
msgstr "Izreži"
|
||
|
||
#: tfrmdiffer.acteditdelete.caption
|
||
msgctxt "tfrmdiffer.acteditdelete.caption"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmdiffer.acteditpaste.caption
|
||
msgctxt "tfrmdiffer.acteditpaste.caption"
|
||
msgid "Paste"
|
||
msgstr "Prilepi"
|
||
|
||
#: tfrmdiffer.acteditredo.caption
|
||
msgctxt "tfrmdiffer.acteditredo.caption"
|
||
msgid "Redo"
|
||
msgstr "Ponovno uveljavi"
|
||
|
||
#: tfrmdiffer.acteditselectall.caption
|
||
msgid "Select &All"
|
||
msgstr "Izberi &vse"
|
||
|
||
#: tfrmdiffer.acteditundo.caption
|
||
msgctxt "tfrmdiffer.acteditundo.caption"
|
||
msgid "Undo"
|
||
msgstr "Razveljavi"
|
||
|
||
#: tfrmdiffer.actexit.caption
|
||
msgctxt "tfrmdiffer.actexit.caption"
|
||
msgid "E&xit"
|
||
msgstr "&Končaj"
|
||
|
||
#: tfrmdiffer.actfirstdifference.caption
|
||
msgctxt "tfrmdiffer.actfirstdifference.caption"
|
||
msgid "First Difference"
|
||
msgstr "Prva razlika"
|
||
|
||
#: tfrmdiffer.actfirstdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
|
||
msgid "First Difference"
|
||
msgstr "Prva razlika"
|
||
|
||
#: tfrmdiffer.actignorecase.caption
|
||
msgid "Ignore Case"
|
||
msgstr "Prezri velikost črk"
|
||
|
||
#: tfrmdiffer.actignorewhitespace.caption
|
||
msgid "Ignore Blanks"
|
||
msgstr "Prezri prazne"
|
||
|
||
#: tfrmdiffer.actkeepscrolling.caption
|
||
msgid "Keep Scrolling"
|
||
msgstr "Nadaljuj drsenje"
|
||
|
||
#: tfrmdiffer.actlastdifference.caption
|
||
msgctxt "tfrmdiffer.actlastdifference.caption"
|
||
msgid "Last Difference"
|
||
msgstr "Zadnja razlika"
|
||
|
||
#: tfrmdiffer.actlastdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
|
||
msgid "Last Difference"
|
||
msgstr "Zadnja razlika"
|
||
|
||
#: tfrmdiffer.actlinedifferences.caption
|
||
msgid "Line Differences"
|
||
msgstr "Vrstične razlike"
|
||
|
||
#: tfrmdiffer.actnextdifference.caption
|
||
msgctxt "tfrmdiffer.actnextdifference.caption"
|
||
msgid "Next Difference"
|
||
msgstr "Naslednja razlika"
|
||
|
||
#: tfrmdiffer.actnextdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
|
||
msgid "Next Difference"
|
||
msgstr "Naslednja razlika"
|
||
|
||
#: tfrmdiffer.actopenleft.caption
|
||
msgid "Open Left..."
|
||
msgstr "Odpri levo ..."
|
||
|
||
#: tfrmdiffer.actopenright.caption
|
||
msgid "Open Right..."
|
||
msgstr "Odpri desno ..."
|
||
|
||
#: tfrmdiffer.actpaintbackground.caption
|
||
msgid "Paint Background"
|
||
msgstr "Obarvaj ozadje"
|
||
|
||
#: tfrmdiffer.actprevdifference.caption
|
||
msgctxt "tfrmdiffer.actprevdifference.caption"
|
||
msgid "Previous Difference"
|
||
msgstr "Predhodna razlika"
|
||
|
||
#: tfrmdiffer.actprevdifference.hint
|
||
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
|
||
msgid "Previous Difference"
|
||
msgstr "Predhodna razlika"
|
||
|
||
#: tfrmdiffer.actreload.caption
|
||
msgid "&Reload"
|
||
msgstr "&Ponovno naloži"
|
||
|
||
#: tfrmdiffer.actreload.hint
|
||
msgctxt "tfrmdiffer.actreload.hint"
|
||
msgid "Reload"
|
||
msgstr "Ponovno naloži"
|
||
|
||
#: tfrmdiffer.actsave.caption
|
||
msgctxt "tfrmdiffer.actsave.caption"
|
||
msgid "Save"
|
||
msgstr "Shrani"
|
||
|
||
#: tfrmdiffer.actsave.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Shrani"
|
||
|
||
#: tfrmdiffer.actsaveas.caption
|
||
msgctxt "tfrmdiffer.actsaveas.caption"
|
||
msgid "Save as..."
|
||
msgstr "Shrani kot ..."
|
||
|
||
#: tfrmdiffer.actsaveas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
||
msgid "Save as..."
|
||
msgstr "Shrani kot ..."
|
||
|
||
#: tfrmdiffer.actsaveleft.caption
|
||
msgctxt "tfrmdiffer.actsaveleft.caption"
|
||
msgid "Save Left"
|
||
msgstr "Shrani levo"
|
||
|
||
#: tfrmdiffer.actsaveleft.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
||
msgid "Save Left"
|
||
msgstr "Shrani levo"
|
||
|
||
#: tfrmdiffer.actsaveleftas.caption
|
||
msgctxt "tfrmdiffer.actsaveleftas.caption"
|
||
msgid "Save Left As..."
|
||
msgstr "Shrani levo kot ..."
|
||
|
||
#: tfrmdiffer.actsaveleftas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
||
msgid "Save Left As..."
|
||
msgstr "Shrani levo kot ..."
|
||
|
||
#: tfrmdiffer.actsaveright.caption
|
||
msgctxt "tfrmdiffer.actsaveright.caption"
|
||
msgid "Save Right"
|
||
msgstr "Shrani desno"
|
||
|
||
#: tfrmdiffer.actsaveright.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
||
msgid "Save Right"
|
||
msgstr "Shrani desno"
|
||
|
||
#: tfrmdiffer.actsaverightas.caption
|
||
msgctxt "tfrmdiffer.actsaverightas.caption"
|
||
msgid "Save Right As..."
|
||
msgstr "Shrani desno kot ..."
|
||
|
||
#: tfrmdiffer.actsaverightas.hint
|
||
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
||
msgid "Save Right As..."
|
||
msgstr "Shrani desno kot ..."
|
||
|
||
#: tfrmdiffer.actstartcompare.caption
|
||
msgctxt "tfrmdiffer.actstartcompare.caption"
|
||
msgid "Compare"
|
||
msgstr "Primerjava"
|
||
|
||
#: tfrmdiffer.actstartcompare.hint
|
||
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
||
msgid "Compare"
|
||
msgstr "Primerjava"
|
||
|
||
#: tfrmdiffer.btnleftencoding.hint
|
||
msgctxt "tfrmdiffer.btnleftencoding.hint"
|
||
msgid "Encoding"
|
||
msgstr "Nabor znakov"
|
||
|
||
#: tfrmdiffer.btnrightencoding.hint
|
||
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
||
msgid "Encoding"
|
||
msgstr "Nabor znakov"
|
||
|
||
#: tfrmdiffer.caption
|
||
msgid "Compare files"
|
||
msgstr "Primerjava datotek"
|
||
|
||
#: tfrmdiffer.midivider1.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider10.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider2.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider3.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider4.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider5.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider6.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider7.caption
|
||
msgctxt "tfrmdiffer.midivider7.caption"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider8.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.midivider9.caption
|
||
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miencodingleft.caption
|
||
msgid "&Left"
|
||
msgstr "&Levo"
|
||
|
||
#: tfrmdiffer.miencodingright.caption
|
||
msgid "&Right"
|
||
msgstr "&Desno"
|
||
|
||
#: tfrmdiffer.miseparator1.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.miseparator2.caption
|
||
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmdiffer.mnuactions.caption
|
||
msgid "&Actions"
|
||
msgstr "&Dejanja"
|
||
|
||
#: tfrmdiffer.mnuedit.caption
|
||
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&&Uredi"
|
||
|
||
#: tfrmdiffer.mnuencoding.caption
|
||
msgctxt "tfrmdiffer.mnuencoding.caption"
|
||
msgid "En&coding"
|
||
msgstr "Nabor &znakov"
|
||
|
||
#: tfrmdiffer.mnufile.caption
|
||
msgctxt "tfrmdiffer.mnufile.caption"
|
||
msgid "&File"
|
||
msgstr "&Datoteka"
|
||
|
||
#: tfrmdiffer.mnuoptions.caption
|
||
msgid "&Options"
|
||
msgstr "&Možnosti"
|
||
|
||
#: tfrmedithotkey.btnaddshortcut.hint
|
||
msgid "Add new shortcut to sequence"
|
||
msgstr "Dodaj novo tipkovno bližnjico v zaporedje"
|
||
|
||
#: tfrmedithotkey.btncancel.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmedithotkey.btnok.caption
|
||
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "V &redu"
|
||
|
||
#: tfrmedithotkey.btnremoveshortcut.hint
|
||
msgid "Remove last shortcut from sequence"
|
||
msgstr "Odstrani zadnjo tipkovno bližnjico iz zaporedja"
|
||
|
||
#: tfrmedithotkey.btnselectfromlist.hint
|
||
msgid "Select shortcut from list of remaining free available keys"
|
||
msgstr "Izbor tipkovne bližnjice iz seznama preostalih neuporabljenih tipk"
|
||
|
||
#: tfrmedithotkey.cghkcontrols.caption
|
||
msgid "Only for these controls"
|
||
msgstr "Le za navedene tipke"
|
||
|
||
#: tfrmedithotkey.lblparameters.caption
|
||
msgid "&Parameters (each in a separate line):"
|
||
msgstr "&Parametri (vsak ločeno v svoji vrstici):"
|
||
|
||
#: tfrmedithotkey.lblshortcuts.caption
|
||
msgid "Shortcuts:"
|
||
msgstr "Tipkovne bližnjice:"
|
||
|
||
#: tfrmeditor.actabout.caption
|
||
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "O programu"
|
||
|
||
#: tfrmeditor.actabout.hint
|
||
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
|
||
msgid "About"
|
||
msgstr "O programu"
|
||
|
||
#: tfrmeditor.actconfhigh.caption
|
||
msgid "&Configuration"
|
||
msgstr "&Nastavitve"
|
||
|
||
#: tfrmeditor.actconfhigh.hint
|
||
msgctxt "tfrmeditor.actconfhigh.hint"
|
||
msgid "Configuration"
|
||
msgstr "Nastavitve"
|
||
|
||
#: tfrmeditor.acteditcopy.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmeditor.acteditcopy.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmeditor.acteditcut.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Izreži"
|
||
|
||
#: tfrmeditor.acteditcut.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
|
||
msgid "Cut"
|
||
msgstr "Izreži"
|
||
|
||
#: tfrmeditor.acteditdelete.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmeditor.acteditdelete.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmeditor.acteditfind.caption
|
||
msgctxt "tfrmeditor.acteditfind.caption"
|
||
msgid "&Find"
|
||
msgstr "&Najdi"
|
||
|
||
#: tfrmeditor.acteditfind.hint
|
||
msgctxt "tfrmeditor.acteditfind.hint"
|
||
msgid "Find"
|
||
msgstr "Najdi"
|
||
|
||
#: tfrmeditor.acteditfindnext.caption
|
||
msgctxt "tfrmeditor.acteditfindnext.caption"
|
||
msgid "Find next"
|
||
msgstr "Najdi naslednje"
|
||
|
||
#: tfrmeditor.acteditfindnext.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
|
||
msgid "Find next"
|
||
msgstr "Najdi naslednje"
|
||
|
||
#: tfrmeditor.acteditfindprevious.caption
|
||
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
||
msgid "Find previous"
|
||
msgstr "Najdi predhodno"
|
||
|
||
#: tfrmeditor.acteditgotoline.caption
|
||
msgid "Goto Line..."
|
||
msgstr "Skoči v vrstico ..."
|
||
|
||
#: tfrmeditor.acteditlineendcr.caption
|
||
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcr.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
|
||
msgid "Mac (CR)"
|
||
msgstr "Mac (CR)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendcrlf.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
|
||
msgid "Windows (CRLF)"
|
||
msgstr "Windows (CRLF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.caption
|
||
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditlineendlf.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
|
||
msgid "Unix (LF)"
|
||
msgstr "Unix (LF)"
|
||
|
||
#: tfrmeditor.acteditpaste.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Prilepi"
|
||
|
||
#: tfrmeditor.acteditpaste.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
|
||
msgid "Paste"
|
||
msgstr "Prilepi"
|
||
|
||
#: tfrmeditor.acteditredo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
||
msgid "Redo"
|
||
msgstr "Ponovi"
|
||
|
||
#: tfrmeditor.acteditredo.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
|
||
msgid "Redo"
|
||
msgstr "Ponovno uveljavi"
|
||
|
||
#: tfrmeditor.acteditrplc.caption
|
||
msgid "&Replace"
|
||
msgstr "&Zamenjaj"
|
||
|
||
#: tfrmeditor.acteditrplc.hint
|
||
msgctxt "tfrmeditor.acteditrplc.hint"
|
||
msgid "Replace"
|
||
msgstr "Zamenjaj"
|
||
|
||
#: tfrmeditor.acteditselectall.caption
|
||
msgid "Select&All"
|
||
msgstr "Izberi &vse"
|
||
|
||
#: tfrmeditor.acteditselectall.hint
|
||
msgctxt "tfrmeditor.acteditselectall.hint"
|
||
msgid "Select All"
|
||
msgstr "Izberi vse"
|
||
|
||
#: tfrmeditor.acteditundo.caption
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
||
msgid "Undo"
|
||
msgstr "Razveljavi"
|
||
|
||
#: tfrmeditor.acteditundo.hint
|
||
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Razveljavi"
|
||
|
||
#: tfrmeditor.actfileclose.caption
|
||
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmeditor.actfileclose.hint
|
||
msgctxt "tfrmeditor.actfileclose.hint"
|
||
msgid "Close"
|
||
msgstr "Zapri"
|
||
|
||
#: tfrmeditor.actfileexit.caption
|
||
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "&Končaj"
|
||
|
||
#: tfrmeditor.actfileexit.hint
|
||
msgctxt "tfrmeditor.actfileexit.hint"
|
||
msgid "Exit"
|
||
msgstr "Končaj"
|
||
|
||
#: tfrmeditor.actfilenew.caption
|
||
msgid "&New"
|
||
msgstr "&Nov stolpec"
|
||
|
||
#: tfrmeditor.actfilenew.hint
|
||
msgctxt "tfrmeditor.actfilenew.hint"
|
||
msgid "New"
|
||
msgstr "Novo"
|
||
|
||
#: tfrmeditor.actfileopen.caption
|
||
msgid "&Open"
|
||
msgstr "&Odpri"
|
||
|
||
#: tfrmeditor.actfileopen.hint
|
||
msgctxt "tfrmeditor.actfileopen.hint"
|
||
msgid "Open"
|
||
msgstr "Odpri"
|
||
|
||
#: tfrmeditor.actfilesave.caption
|
||
msgctxt "tfrmeditor.actfilesave.caption"
|
||
msgid "&Save"
|
||
msgstr "&Shrani"
|
||
|
||
#: tfrmeditor.actfilesave.hint
|
||
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
|
||
msgid "Save"
|
||
msgstr "Shrani"
|
||
|
||
#: tfrmeditor.actfilesaveas.caption
|
||
msgid "Save &As..."
|
||
msgstr "Shrani &kot ..."
|
||
|
||
#: tfrmeditor.actfilesaveas.hint
|
||
msgid "Save As"
|
||
msgstr "Shrani kot"
|
||
|
||
#: tfrmeditor.actsaveall.caption
|
||
msgid "Sa&ve All"
|
||
msgstr "Shra&ni vse"
|
||
|
||
#: tfrmeditor.actsaveall.hint
|
||
msgid "Save All"
|
||
msgstr "Shrani vse"
|
||
|
||
#: tfrmeditor.caption
|
||
msgctxt "tfrmeditor.caption"
|
||
msgid "Editor"
|
||
msgstr "Urejevalnik"
|
||
|
||
#: tfrmeditor.help1.caption
|
||
msgctxt "tfrmeditor.help1.caption"
|
||
msgid "&Help"
|
||
msgstr "Pomo&č"
|
||
|
||
#: tfrmeditor.menuitem1.caption
|
||
msgctxt "TFRMEDITOR.MENUITEM1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.midiv.caption
|
||
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miedit.caption
|
||
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Uredi"
|
||
|
||
#: tfrmeditor.miencoding.caption
|
||
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Nabor &znakov"
|
||
|
||
#: tfrmeditor.miencodingin.caption
|
||
msgid "Open as"
|
||
msgstr "Odpri kot"
|
||
|
||
#: tfrmeditor.miencodingout.caption
|
||
msgctxt "tfrmeditor.miencodingout.caption"
|
||
msgid "Save as"
|
||
msgstr "Shrani kot …"
|
||
|
||
#: tfrmeditor.mifile.caption
|
||
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Datoteka"
|
||
|
||
#: tfrmeditor.mihighlight.caption
|
||
msgid "Syntax highlight"
|
||
msgstr "Poudarjanje skladnje"
|
||
|
||
#: tfrmeditor.milineendtype.caption
|
||
msgid "End Of Line"
|
||
msgstr "Konec vrstice"
|
||
|
||
#: tfrmeditor.miseparator1.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.miseparator2.caption
|
||
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n1.caption
|
||
msgctxt "TFRMEDITOR.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n3.caption
|
||
msgctxt "TFRMEDITOR.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n4.caption
|
||
msgctxt "TFRMEDITOR.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditor.n5.caption
|
||
msgctxt "TFRMEDITOR.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
||
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.OKBUTTON.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "V &redu"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
||
msgid "C&ase sensitivity"
|
||
msgstr "Upoštevanje &velikosti črk"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
||
msgid "S&earch from caret"
|
||
msgstr "Išči od &kazalke naprej"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
||
msgid "&Regular expressions"
|
||
msgstr "&Logični izraz"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
||
msgid "Selected &text only"
|
||
msgstr "Le izbrano &besedilo"
|
||
|
||
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
||
msgid "&Whole words only"
|
||
msgstr "Le &cele besede"
|
||
|
||
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
||
msgid "Option"
|
||
msgstr "Možnost"
|
||
|
||
#: tfrmeditsearchreplace.lblreplacewith.caption
|
||
msgid "&Replace with:"
|
||
msgstr "Zamenjaj &z:"
|
||
|
||
#: tfrmeditsearchreplace.lblsearchfor.caption
|
||
msgid "&Search for:"
|
||
msgstr "&Poišči:"
|
||
|
||
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
||
msgid "Direction"
|
||
msgstr "Smer"
|
||
|
||
#: tfrmextractdlg.caption
|
||
msgid "Unpack files"
|
||
msgstr "Odpakiranje datotek"
|
||
|
||
#: tfrmextractdlg.cbextractpath.caption
|
||
msgid "&Unpack path names if stored with files"
|
||
msgstr "&Odpakiraj poti datotek, če to se shranjene v arhivu"
|
||
|
||
#: tfrmextractdlg.cbfilemask.text
|
||
msgctxt "tfrmextractdlg.cbfilemask.text"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmextractdlg.cbinseparatefolder.caption
|
||
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
||
msgstr "Odpakiraj vsak arhiv v &ločeno podrejeno mapo (z imenom vsakega arhiva)"
|
||
|
||
#: tfrmextractdlg.cboverwrite.caption
|
||
msgid "O&verwrite existing files"
|
||
msgstr "&Prepiši obstoječe datoteke"
|
||
|
||
#: tfrmextractdlg.lblextractto.caption
|
||
msgid "To the &directory:"
|
||
msgstr "V &mapo:"
|
||
|
||
#: tfrmextractdlg.lblfilemask.caption
|
||
msgid "&Extract files matching file mask:"
|
||
msgstr "&Odpakiraj datoteke z masko:"
|
||
|
||
#: tfrmextractdlg.lblpassword.caption
|
||
msgid "&Password for encrypted files:"
|
||
msgstr "&Geslo šifriranih datotek:"
|
||
|
||
#: tfrmfileexecuteyourself.btnclose.caption
|
||
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmfileexecuteyourself.caption
|
||
msgid "Wait..."
|
||
msgstr "Počakaj ..."
|
||
|
||
#: tfrmfileexecuteyourself.lblfilename.caption
|
||
msgid "File name:"
|
||
msgstr "Ime datoteke:"
|
||
|
||
#: tfrmfileexecuteyourself.lblfrompath.caption
|
||
msgctxt "tfrmfileexecuteyourself.lblfrompath.caption"
|
||
msgid "From:"
|
||
msgstr "Iz:"
|
||
|
||
#: tfrmfileexecuteyourself.lblprompt.caption
|
||
msgid "Click on Close when the temporary file can be deleted!"
|
||
msgstr "Kliknite na gumb za zapiranje, ko se začasno datoteko lahko izbriše!"
|
||
|
||
#: tfrmfileop.btncancel.caption
|
||
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmfileop.btnminimizetopanel.caption
|
||
msgid "&To panel"
|
||
msgstr "Na &okno"
|
||
|
||
#: tfrmfileop.btnviewoperations.caption
|
||
msgid "&View all"
|
||
msgstr "Poglej &vse"
|
||
|
||
#: tfrmfileop.lblcurrentoperation.caption
|
||
msgid "Current operation:"
|
||
msgstr "Trenutno opravilo:"
|
||
|
||
#: tfrmfileop.lblfrom.caption
|
||
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
||
msgid "From:"
|
||
msgstr "Iz:"
|
||
|
||
#: tfrmfileop.lblto.caption
|
||
msgid "To:"
|
||
msgstr "V:"
|
||
|
||
#: tfrmfileproperties.btnclose.caption
|
||
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmfileproperties.btnsetproperties.caption
|
||
msgid "&Set properties"
|
||
msgstr "&Nastavi"
|
||
|
||
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
||
msgid "Set to &all selected files"
|
||
msgstr "Nastavi &vsem"
|
||
|
||
#: tfrmfileproperties.btnskipfile.caption
|
||
msgid "Ski&p this file"
|
||
msgstr "Pres&koči datoteko"
|
||
|
||
#: tfrmfileproperties.caption
|
||
msgctxt "tfrmfileproperties.caption"
|
||
msgid "Properties"
|
||
msgstr "Lastnosti"
|
||
|
||
#: tfrmfileproperties.cbsgid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmfileproperties.cbsticky.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Lepljivo"
|
||
|
||
#: tfrmfileproperties.cbsuid.caption
|
||
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmfileproperties.chkexecutable.caption
|
||
msgid "Allow &executing file as program"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.gbowner.caption
|
||
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Lastnik"
|
||
|
||
#: tfrmfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Biti:"
|
||
|
||
#: tfrmfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Skupina"
|
||
|
||
#: tfrmfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Ostalo"
|
||
|
||
#: tfrmfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Lastnik"
|
||
|
||
#: tfrmfileproperties.lblattrtext.caption
|
||
msgctxt "tfrmfileproperties.lblattrtext.caption"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmfileproperties.lblattrtextstr.caption
|
||
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
|
||
msgid "Text:"
|
||
msgstr "Črkovno:"
|
||
|
||
#: tfrmfileproperties.lblcontains.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblcontainsstr.caption
|
||
msgid "Contains:"
|
||
msgstr "Vsebuje:"
|
||
|
||
#: tfrmfileproperties.lblexec.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Izvajanje"
|
||
|
||
#: tfrmfileproperties.lblexecutable.caption
|
||
msgid "Execute:"
|
||
msgstr ""
|
||
|
||
#: tfrmfileproperties.lblfile.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ime datoteke"
|
||
|
||
#: tfrmfileproperties.lblfilename.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfilestr.caption
|
||
msgctxt "tfrmfileproperties.lblfilestr.caption"
|
||
msgid "File name"
|
||
msgstr "Ime datoteke"
|
||
|
||
#: tfrmfileproperties.lblfolder.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblfolderstr.caption
|
||
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
||
msgid "Path:"
|
||
msgstr "Pot:"
|
||
|
||
#: tfrmfileproperties.lblgroupstr.caption
|
||
msgid "&Group"
|
||
msgstr "&Skupina"
|
||
|
||
#: tfrmfileproperties.lbllastaccess.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastaccessstr.caption
|
||
msgid "Last access:"
|
||
msgstr "Zadnji dostop:"
|
||
|
||
#: tfrmfileproperties.lbllastmodif.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllastmodifstr.caption
|
||
msgid "Last modification:"
|
||
msgstr "Zadnja sprememba:"
|
||
|
||
#: tfrmfileproperties.lbllaststchange.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbllaststchangestr.caption
|
||
msgid "Last status change:"
|
||
msgstr "Zadnja sprememba stanja:"
|
||
|
||
#: tfrmfileproperties.lbloctal.caption
|
||
msgctxt "tfrmfileproperties.lbloctal.caption"
|
||
msgid "Octal:"
|
||
msgstr "Osmiško:"
|
||
|
||
#: tfrmfileproperties.lblownerstr.caption
|
||
msgid "O&wner"
|
||
msgstr "&Lastnik"
|
||
|
||
#: tfrmfileproperties.lblread.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Branje"
|
||
|
||
#: tfrmfileproperties.lblsize.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsizestr.caption
|
||
msgctxt "tfrmfileproperties.lblsizestr.caption"
|
||
msgid "Size:"
|
||
msgstr "Velikost:"
|
||
|
||
#: tfrmfileproperties.lblsymlink.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lblsymlinkstr.caption
|
||
msgid "Symlink to:"
|
||
msgstr "Simbolna povezava na:"
|
||
|
||
#: tfrmfileproperties.lbltype.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
||
msgid "???"
|
||
msgstr "???"
|
||
|
||
#: tfrmfileproperties.lbltypestr.caption
|
||
msgid "Type:"
|
||
msgstr "Vrsta:"
|
||
|
||
#: tfrmfileproperties.lblwrite.caption
|
||
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Pisanje"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
||
msgid "Name"
|
||
msgstr "Ime"
|
||
|
||
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
||
msgid "Value"
|
||
msgstr "Vrednost"
|
||
|
||
#: tfrmfileproperties.tsattributes.caption
|
||
msgctxt "tfrmfileproperties.tsattributes.caption"
|
||
msgid "Attributes"
|
||
msgstr "Atributi"
|
||
|
||
#: tfrmfileproperties.tsplugins.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmfileproperties.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Vstavki"
|
||
|
||
#: tfrmfileproperties.tsproperties.caption
|
||
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
||
msgid "Properties"
|
||
msgstr "Lastnosti"
|
||
|
||
#: tfrmfinddlg.actcancel.caption
|
||
msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION"
|
||
msgid "C&ancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmfinddlg.actcancelclose.caption
|
||
msgid "Cancel search and close window"
|
||
msgstr "Prekliči iskanje in zapri okno"
|
||
|
||
#: tfrmfinddlg.actclose.caption
|
||
msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
||
msgctxt "TFRMFINDDLG.ACTCONFIGFILESEARCHHOTKEYS.CAPTION"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Nastavitev hitrih tipk"
|
||
|
||
#: tfrmfinddlg.actedit.caption
|
||
msgctxt "tfrmfinddlg.actedit.caption"
|
||
msgid "&Edit"
|
||
msgstr "&&Uredi"
|
||
|
||
#: tfrmfinddlg.actfeedtolistbox.caption
|
||
msgid "Feed to &listbox"
|
||
msgstr "Izpiši v &seznam"
|
||
|
||
#: tfrmfinddlg.actfreefrommem.caption
|
||
msgid "Cancel search, close and free from memory"
|
||
msgstr "Prekliči iskanje, zapri okno in sprosti pomnilnik"
|
||
|
||
#: tfrmfinddlg.actfreefrommemallothers.caption
|
||
msgid "For all other \"Find files\", cancel, close and free from memory"
|
||
msgstr "Za vsa ostala iskanja, prekliči iskanje, zapri in sprosti pomnilnik."
|
||
|
||
#: tfrmfinddlg.actgotofile.caption
|
||
msgid "&Go to file"
|
||
msgstr "&Skoči na datoteko"
|
||
|
||
#: tfrmfinddlg.actintellifocus.caption
|
||
msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION"
|
||
msgid "Find Data"
|
||
msgstr "Najdi podatke"
|
||
|
||
#: tfrmfinddlg.actlastsearch.caption
|
||
msgid "&Last search"
|
||
msgstr "&Zadnje iskanje"
|
||
|
||
#: tfrmfinddlg.actnewsearch.caption
|
||
msgid "&New search"
|
||
msgstr "&Novo iskanje"
|
||
|
||
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
||
msgid "New search (clear filters)"
|
||
msgstr "Novo iskanje (počisti filtre)"
|
||
|
||
#: tfrmfinddlg.actpageadvanced.caption
|
||
msgid "Go to page \"Advanced\""
|
||
msgstr "Skoči na stran »Napredno«"
|
||
|
||
#: tfrmfinddlg.actpageloadsave.caption
|
||
msgid "Go to page \"Load/Save\""
|
||
msgstr "Skoči na stran »Nalaganje/Shranjevanje«"
|
||
|
||
#: tfrmfinddlg.actpagenext.caption
|
||
msgid "Switch to Nex&t Page"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageplugins.caption
|
||
msgid "Go to page \"Plugins\""
|
||
msgstr "Skoči na stran »Vstavkov«"
|
||
|
||
#: tfrmfinddlg.actpageprev.caption
|
||
msgid "Switch to &Previous Page"
|
||
msgstr ""
|
||
|
||
#: tfrmfinddlg.actpageresults.caption
|
||
msgid "Go to page \"Results\""
|
||
msgstr "Skoči na stran »Rezultatov«"
|
||
|
||
#: tfrmfinddlg.actpagestandard.caption
|
||
msgid "Go to page \"Standard\""
|
||
msgstr "Skoči na stran »Osnovno«"
|
||
|
||
#: tfrmfinddlg.actstart.caption
|
||
msgctxt "tfrmfinddlg.actstart.caption"
|
||
msgid "&Start"
|
||
msgstr "&Začni"
|
||
|
||
#: tfrmfinddlg.actview.caption
|
||
msgctxt "tfrmfinddlg.actview.caption"
|
||
msgid "&View"
|
||
msgstr "&Pogled"
|
||
|
||
#: tfrmfinddlg.btnaddattribute.caption
|
||
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
||
msgid "&Add"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmfinddlg.btnattrshelp.caption
|
||
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomo&č"
|
||
|
||
#: tfrmfinddlg.btnsavetemplate.caption
|
||
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Shrani"
|
||
|
||
#: tfrmfinddlg.btnsearchdelete.caption
|
||
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Izbriši"
|
||
|
||
#: tfrmfinddlg.btnsearchload.caption
|
||
msgid "L&oad"
|
||
msgstr "&Naloži"
|
||
|
||
#: tfrmfinddlg.btnsearchsave.caption
|
||
msgid "S&ave"
|
||
msgstr "&Shrani"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
||
msgid "Sa&ve with \"Start in directory\""
|
||
msgstr "Sh&rani z možnostjo »Začni v mapi«"
|
||
|
||
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
||
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
||
msgstr "V kolikor je možnost »Začni v mapi« shranjena, bo mesto obnovljeno med nalaganjem predloge. Možnost je uporabna pri iskanju v določeni mapi."
|
||
|
||
#: tfrmfinddlg.btnusetemplate.caption
|
||
msgid "Use template"
|
||
msgstr "Uporabi predlogo"
|
||
|
||
#: tfrmfinddlg.caption
|
||
msgctxt "tfrmfinddlg.caption"
|
||
msgid "Find files"
|
||
msgstr "Najdi datoteke"
|
||
|
||
#: tfrmfinddlg.cbcasesens.caption
|
||
msgid "Case sens&itive"
|
||
msgstr "Upoštevaj &velikost črk"
|
||
|
||
#: tfrmfinddlg.cbdatefrom.caption
|
||
msgid "&Date from:"
|
||
msgstr "&Od datuma:"
|
||
|
||
#: tfrmfinddlg.cbdateto.caption
|
||
msgid "Dat&e to:"
|
||
msgstr "&Do datuma:"
|
||
|
||
#: tfrmfinddlg.cbfilesizefrom.caption
|
||
msgid "S&ize from:"
|
||
msgstr "&Od velikosti:"
|
||
|
||
#: tfrmfinddlg.cbfilesizeto.caption
|
||
msgid "Si&ze to:"
|
||
msgstr "&Do velikosti:"
|
||
|
||
#: tfrmfinddlg.cbfindinarchive.caption
|
||
msgid "Search in &archives"
|
||
msgstr "Omogoči iskanje v &arhivih"
|
||
|
||
#: tfrmfinddlg.cbfindtext.caption
|
||
msgid "Find &text in file"
|
||
msgstr "Najdi &besedilo"
|
||
|
||
#: tfrmfinddlg.cbfollowsymlinks.caption
|
||
msgid "Follow s&ymlinks"
|
||
msgstr "Sledi &simbolnim povezavam"
|
||
|
||
#: tfrmfinddlg.cbnotcontainingtext.caption
|
||
msgid "Find files N&OT containing the text"
|
||
msgstr "Najdi datoteke, ki &ne vsebujejo besedila"
|
||
|
||
#: tfrmfinddlg.cbnotolderthan.caption
|
||
msgid "N&ot older than:"
|
||
msgstr "Ni &starejše kot:"
|
||
|
||
#: tfrmfinddlg.cbopenedtabs.caption
|
||
msgid "Opened tabs"
|
||
msgstr "Odprti zavihki"
|
||
|
||
#: tfrmfinddlg.cbpartialnamesearch.caption
|
||
msgid "Searc&h for part of file name"
|
||
msgstr "Poišči &del imena datoteke"
|
||
|
||
#: tfrmfinddlg.cbregexp.caption
|
||
msgid "&Regular expression"
|
||
msgstr "&Logični izraz"
|
||
|
||
#: tfrmfinddlg.cbreplacetext.caption
|
||
msgid "Re&place by"
|
||
msgstr "&Zamenjaj besedilo z"
|
||
|
||
#: tfrmfinddlg.cbselectedfiles.caption
|
||
msgid "Selected directories and &files"
|
||
msgstr "Izbrane &datoteke in mape"
|
||
|
||
#: tfrmfinddlg.cbtextregexp.caption
|
||
msgid "Regular &expression"
|
||
msgstr "Logični &izraz"
|
||
|
||
#: tfrmfinddlg.cbtimefrom.caption
|
||
msgid "&Time from:"
|
||
msgstr "&Od časa:"
|
||
|
||
#: tfrmfinddlg.cbtimeto.caption
|
||
msgid "Ti&me to:"
|
||
msgstr "&Do časa:"
|
||
|
||
#: tfrmfinddlg.cbuseplugin.caption
|
||
msgid "&Use search plugin:"
|
||
msgstr "Uporabi vstavek &iskanja:"
|
||
|
||
#: tfrmfinddlg.cmbexcludedirectories.hint
|
||
msgid "Enter directories names that should be excluded from search separated with \";\""
|
||
msgstr "Vpis imen map, ki naj ne bodo upoštevana v iskanju. Imena morajo biti ločena s podpičjem » ; «."
|
||
|
||
#: tfrmfinddlg.cmbexcludefiles.hint
|
||
msgid "Enter files names that should be excluded from search separated with \";\""
|
||
msgstr "Vpis imen datotek, ki naj ne bodo upoštevana v iskanju. Imena morajo biti ločena s podpičjem » ; «."
|
||
|
||
#: tfrmfinddlg.cmbfindfilemask.hint
|
||
msgid "Enter files names separated with \";\""
|
||
msgstr "Vpis imen datotek, ločenih s podpičjem » ; «"
|
||
|
||
#: tfrmfinddlg.gbdirectories.caption
|
||
msgctxt "tfrmfinddlg.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Mape"
|
||
|
||
#: tfrmfinddlg.gbfiles.caption
|
||
msgctxt "tfrmfinddlg.gbfiles.caption"
|
||
msgid "Files"
|
||
msgstr "Datoteke"
|
||
|
||
#: tfrmfinddlg.gbfinddata.caption
|
||
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
||
msgid "Find Data"
|
||
msgstr "Najdi podatke"
|
||
|
||
#: tfrmfinddlg.lblattributes.caption
|
||
msgid "Attri&butes"
|
||
msgstr "&Atributi"
|
||
|
||
#: tfrmfinddlg.lblencoding.caption
|
||
msgid "Encodin&g:"
|
||
msgstr "&Kodiranje:"
|
||
|
||
#: tfrmfinddlg.lblexcludedirectories.caption
|
||
msgid "E&xclude subdirectories"
|
||
msgstr "Ne upoštevaj &podmap:"
|
||
|
||
#: tfrmfinddlg.lblexcludefiles.caption
|
||
msgid "&Exclude files"
|
||
msgstr "Ne upoštevaj &datotek"
|
||
|
||
#: tfrmfinddlg.lblfindfilemask.caption
|
||
msgid "&File mask"
|
||
msgstr "Poišči datoteke z &masko:"
|
||
|
||
#: tfrmfinddlg.lblfindpathstart.caption
|
||
msgid "Start in &directory"
|
||
msgstr "Začni v &mapi"
|
||
|
||
#: tfrmfinddlg.lblsearchdepth.caption
|
||
msgid "Search su&bdirectories:"
|
||
msgstr "Poišči tudi po &podrejenih mapah:"
|
||
|
||
#: tfrmfinddlg.lbltemplateheader.caption
|
||
msgid "&Previous searches:"
|
||
msgstr "&Shranjena iskanja:"
|
||
|
||
#: tfrmfinddlg.miaction.caption
|
||
msgid "&Action"
|
||
msgstr "&Dejanje"
|
||
|
||
#: tfrmfinddlg.mifreefrommemallothers.caption
|
||
msgid "For all others, cancel, close and free from memory"
|
||
msgstr "Za vsa ostala prekliči iskanje, zapri in sprosti pomnilnik"
|
||
|
||
#: tfrmfinddlg.miopeninnewtab.caption
|
||
msgid "Open In New Tab(s)"
|
||
msgstr "Odpri v novem zavihku"
|
||
|
||
#: tfrmfinddlg.mioptions.caption
|
||
msgctxt "TFRMFINDDLG.MIOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Možnosti"
|
||
|
||
#: tfrmfinddlg.miremovefromllist.caption
|
||
msgid "Remove from list"
|
||
msgstr "Odstrani s seznama"
|
||
|
||
#: tfrmfinddlg.miresult.caption
|
||
msgid "&Result"
|
||
msgstr "&Rezultat"
|
||
|
||
#: tfrmfinddlg.miseparator1.caption
|
||
msgctxt "TFRMFINDDLG.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.miseparator2.caption
|
||
msgctxt "TFRMFINDDLG.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmfinddlg.mishowallfound.caption
|
||
msgid "Show all found items"
|
||
msgstr "Pokaži vse najdene predmete"
|
||
|
||
#: tfrmfinddlg.mishowineditor.caption
|
||
msgid "Show In Editor"
|
||
msgstr "Pokaži v urejevalniku"
|
||
|
||
#: tfrmfinddlg.mishowinviewer.caption
|
||
msgid "Show In Viewer"
|
||
msgstr "Pokaži v pregledovalniku"
|
||
|
||
#: tfrmfinddlg.miviewtab.caption
|
||
msgctxt "TFRMFINDDLG.MIVIEWTAB.CAPTION"
|
||
msgid "&View"
|
||
msgstr "&Pogled"
|
||
|
||
#: tfrmfinddlg.tsadvanced.caption
|
||
msgid "Advanced"
|
||
msgstr "Napredno"
|
||
|
||
#: tfrmfinddlg.tsloadsave.caption
|
||
msgid "Load/Save"
|
||
msgstr "Naloži/Shrani"
|
||
|
||
#: tfrmfinddlg.tsplugins.caption
|
||
msgctxt "tfrmfinddlg.tsplugins.caption"
|
||
msgid "Plugins"
|
||
msgstr "Vstavki"
|
||
|
||
#: tfrmfinddlg.tsresults.caption
|
||
msgid "Results"
|
||
msgstr "Rezultati"
|
||
|
||
#: tfrmfinddlg.tsstandard.caption
|
||
msgid "Standard"
|
||
msgstr "Običajno"
|
||
|
||
#: tfrmfindview.btnclose.caption
|
||
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmfindview.btnfind.caption
|
||
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
||
msgid "&Find"
|
||
msgstr "&Najdi"
|
||
|
||
#: tfrmfindview.caption
|
||
msgctxt "TFRMFINDVIEW.CAPTION"
|
||
msgid "Find"
|
||
msgstr "Najdi"
|
||
|
||
#: tfrmfindview.cbcasesens.caption
|
||
msgid "C&ase sensitive"
|
||
msgstr "&Razlikovanje velikosti črk"
|
||
|
||
#: tfrmhardlink.btncancel.caption
|
||
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmhardlink.btnok.caption
|
||
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: tfrmhardlink.caption
|
||
msgid "Create hard link"
|
||
msgstr "Ustvarjanje trde povezave"
|
||
|
||
#: tfrmhardlink.lblexistingfile.caption
|
||
msgctxt "tfrmhardlink.lblexistingfile.caption"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "&Pot povezave:"
|
||
|
||
#: tfrmhardlink.lbllinktocreate.caption
|
||
msgctxt "tfrmhardlink.lbllinktocreate.caption"
|
||
msgid "&Link name"
|
||
msgstr "Ime &povezave:"
|
||
|
||
#: tfrmhotdirexportimport.btnselectall.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
|
||
msgid "Import all!"
|
||
msgstr "Uvozi vse!"
|
||
|
||
#: tfrmhotdirexportimport.btnselectiondone.caption
|
||
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
|
||
msgid "Import selected"
|
||
msgstr "Uvozi izbrano"
|
||
|
||
#: tfrmhotdirexportimport.caption
|
||
msgid "Select the entries your want to import"
|
||
msgstr "Izberite vnose, ki jih želite uvoziti"
|
||
|
||
#: tfrmhotdirexportimport.lbhint.caption
|
||
msgid "When clicking a sub-menu, it will select the whole menu"
|
||
msgstr "S klikom na podrejeni meni bo izbran celoten meni"
|
||
|
||
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
||
msgid "Hold CTRL and click entries to select multiple ones"
|
||
msgstr "S klikom ob sočasno pritisnjeni tipki CTRL je mogoče izbrati več poljubnih predmetov"
|
||
|
||
#: tfrmlinker.btnsave.caption
|
||
msgctxt "tfrmlinker.btnsave.caption"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmlinker.caption
|
||
msgid "Linker"
|
||
msgstr "Povezovalnik"
|
||
|
||
#: tfrmlinker.gbsaveto.caption
|
||
msgid "Save to..."
|
||
msgstr "Shrani v ..."
|
||
|
||
#: tfrmlinker.grbxcontrol.caption
|
||
msgid "Item"
|
||
msgstr "Predmet"
|
||
|
||
#: tfrmlinker.lblfilename.caption
|
||
msgid "&File name"
|
||
msgstr "&Ime datoteke"
|
||
|
||
#: tfrmlinker.spbtndown.caption
|
||
msgid "Do&wn"
|
||
msgstr "&Dol"
|
||
|
||
#: tfrmlinker.spbtndown.hint
|
||
msgid "Down"
|
||
msgstr "Navzdol"
|
||
|
||
#: tfrmlinker.spbtnrem.caption
|
||
msgctxt "tfrmlinker.spbtnrem.caption"
|
||
msgid "&Remove"
|
||
msgstr "&Odstrani"
|
||
|
||
#: tfrmlinker.spbtnrem.hint
|
||
msgctxt "TFRMLINKER.SPBTNREM.HINT"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmlinker.spbtnup.caption
|
||
msgctxt "tfrmlinker.spbtnup.caption"
|
||
msgid "&Up"
|
||
msgstr "&Gor"
|
||
|
||
#: tfrmlinker.spbtnup.hint
|
||
msgid "Up"
|
||
msgstr "Navzgor"
|
||
|
||
#: tfrmmain.actabout.caption
|
||
msgid "&About"
|
||
msgstr "&O programu"
|
||
|
||
#: tfrmmain.actaddfilenametocmdline.caption
|
||
msgid "Add file name to command line"
|
||
msgstr "Doda ime datoteke v ukazno vrstico"
|
||
|
||
#: tfrmmain.actaddnewsearch.caption
|
||
msgid "New search instance..."
|
||
msgstr "Novo iskanje ..."
|
||
|
||
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
||
msgid "Add path and file name to command line"
|
||
msgstr "Doda pot in ime datoteke v ukazno vrstico"
|
||
|
||
#: tfrmmain.actaddpathtocmdline.caption
|
||
msgid "Copy path to command line"
|
||
msgstr "Kopira pot v ukazno vrstico"
|
||
|
||
#: tfrmmain.actbriefview.caption
|
||
msgid "Brief view"
|
||
msgstr "Datotečni pogled"
|
||
|
||
#: tfrmmain.actbriefview.hint
|
||
msgid "Brief View"
|
||
msgstr "Datotečni pogled"
|
||
|
||
#: tfrmmain.actcalculatespace.caption
|
||
msgid "Calculate &Occupied Space"
|
||
msgstr "Preračunaj &zasedenost prostora"
|
||
|
||
#: tfrmmain.actchangedir.caption
|
||
msgid "Change directory"
|
||
msgstr "Zamenjaj mapo"
|
||
|
||
#: tfrmmain.actchangedirtohome.caption
|
||
msgid "Change directory to home"
|
||
msgstr "Pojdi v osebno mapo"
|
||
|
||
#: tfrmmain.actchangedirtoparent.caption
|
||
msgid "Change Directory To Parent"
|
||
msgstr "Zamenjaj mapo v nadrejeno"
|
||
|
||
#: tfrmmain.actchangedirtoroot.caption
|
||
msgid "Change directory to root"
|
||
msgstr "Zamenjaj mapo v korensko"
|
||
|
||
#: tfrmmain.actchecksumcalc.caption
|
||
msgid "Calculate Check&sum..."
|
||
msgstr "Izračunaj &nadzorno vsoto ..."
|
||
|
||
#: tfrmmain.actchecksumverify.caption
|
||
msgid "&Verify Checksum..."
|
||
msgstr "Preveri nadzo&rne vsote ..."
|
||
|
||
#: tfrmmain.actclearlogfile.caption
|
||
msgid "Clear log file"
|
||
msgstr "Počisti dnevniško datoteko"
|
||
|
||
#: tfrmmain.actclearlogwindow.caption
|
||
msgid "Clear log window"
|
||
msgstr "Počisti dnevniško okno"
|
||
|
||
#: tfrmmain.actclosealltabs.caption
|
||
msgid "Close &All Tabs"
|
||
msgstr "Zapri &vse zavihke"
|
||
|
||
#: tfrmmain.actcloseduplicatetabs.caption
|
||
msgid "Close Duplicate Tabs"
|
||
msgstr "Zapri podvojene zavihke"
|
||
|
||
#: tfrmmain.actclosetab.caption
|
||
msgid "&Close Tab"
|
||
msgstr "&Zapri zavihek"
|
||
|
||
#: tfrmmain.actcmdlinenext.caption
|
||
msgid "Next Command Line"
|
||
msgstr "Naslednji ukaz"
|
||
|
||
#: tfrmmain.actcmdlinenext.hint
|
||
msgid "Set command line to next command in history"
|
||
msgstr "Izberi naslednji ukaz v zgodovini izvedenih ukazov."
|
||
|
||
#: tfrmmain.actcmdlineprev.caption
|
||
msgid "Previous Command Line"
|
||
msgstr "Predhodni ukaz"
|
||
|
||
#: tfrmmain.actcmdlineprev.hint
|
||
msgid "Set command line to previous command in history"
|
||
msgstr "Izberi predhodni ukaz v zgodovini izvedenih ukazov."
|
||
|
||
#: tfrmmain.actcolumnsview.caption
|
||
msgid "Full"
|
||
msgstr "Podrobni pogled"
|
||
|
||
#: tfrmmain.actcolumnsview.hint
|
||
msgid "Columns View"
|
||
msgstr "Stolpčni pogled"
|
||
|
||
#: tfrmmain.actcomparecontents.caption
|
||
msgid "Compare by &Contents"
|
||
msgstr "Primerjaj po &vsebini"
|
||
|
||
#: tfrmmain.actcomparedirectories.caption
|
||
msgctxt "tfrmmain.actcomparedirectories.caption"
|
||
msgid "Compare Directories"
|
||
msgstr "Primerjava map"
|
||
|
||
#: tfrmmain.actcomparedirectories.hint
|
||
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
||
msgid "Compare Directories"
|
||
msgstr "Primerjava map"
|
||
|
||
#: tfrmmain.actconfigdirhotlist.caption
|
||
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Možnosti seznama hitrih map"
|
||
|
||
#: tfrmmain.actconfigfavoritetabs.caption
|
||
msgid "Configuration of Favorite Tabs"
|
||
msgstr "Možnosti priljubljenih zavihkov"
|
||
|
||
#: tfrmmain.actconfigfoldertabs.caption
|
||
msgid "Configuration of folder tabs"
|
||
msgstr "Možnosti zavihkov map"
|
||
|
||
#: tfrmmain.actconfighotkeys.caption
|
||
msgctxt "tfrmmain.actconfighotkeys.caption"
|
||
msgid "Configuration of hot keys"
|
||
msgstr "Nastavitev hitrih tipk"
|
||
|
||
#: tfrmmain.actconfigsavesettings.caption
|
||
msgid "Save Settings"
|
||
msgstr "Shrani nastavitve"
|
||
|
||
#: tfrmmain.actconfigsearches.caption
|
||
msgid "Configuration of searches"
|
||
msgstr "Nastavitev iskanja"
|
||
|
||
#: tfrmmain.actconfigtoolbars.caption
|
||
msgid "Toolbar..."
|
||
msgstr "Orodna vrstica ..."
|
||
|
||
#: tfrmmain.actconfigtreeviewmenus.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Nastavljanje menija drevesnega pogleda"
|
||
|
||
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
||
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Nastavljanje barv menija drevesnega pogleda"
|
||
|
||
#: tfrmmain.actcontextmenu.caption
|
||
msgid "Show context menu"
|
||
msgstr "Pokaži vsebinski meni"
|
||
|
||
#: tfrmmain.actcopy.caption
|
||
msgctxt "TFRMMAIN.ACTCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmmain.actcopyalltabstoopposite.caption
|
||
msgid "Copy all tabs to opposite side"
|
||
msgstr "Kopiraj vse zavihke na nasprotno okno"
|
||
|
||
#: tfrmmain.actcopyfiledetailstoclip.caption
|
||
msgid "Copy all shown &columns"
|
||
msgstr "Kopiraj vse prikazane &stolpce"
|
||
|
||
#: tfrmmain.actcopyfullnamestoclip.caption
|
||
msgid "Copy Filename(s) with Full &Path"
|
||
msgstr "Kopiraj imena datotek s polno &potjo"
|
||
|
||
#: tfrmmain.actcopynamestoclip.caption
|
||
msgid "Copy &Filename(s) to Clipboard"
|
||
msgstr "Kopiraj i&mena datotek v odložišče"
|
||
|
||
#: tfrmmain.actcopynoask.caption
|
||
msgid "Copy files without asking for confirmation"
|
||
msgstr "Kopiraj datoteke brez zahteve po potrditvi"
|
||
|
||
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
||
msgstr "Kopiraj polno pot izbranih datotek brez ločilnika konca mape"
|
||
|
||
#: tfrmmain.actcopypathoffilestoclip.caption
|
||
msgid "Copy Full Path of selected file(s)"
|
||
msgstr "Kopiraj imena datotek s polno &potjo"
|
||
|
||
#: tfrmmain.actcopysamepanel.caption
|
||
msgid "Copy to same panel"
|
||
msgstr "Kopiraj v isto okno"
|
||
|
||
#: tfrmmain.actcopytoclipboard.caption
|
||
msgid "&Copy"
|
||
msgstr "&Kopiraj"
|
||
|
||
#: tfrmmain.actcountdircontent.caption
|
||
msgid "Sho&w Occupied Space"
|
||
msgstr "Pokaži &zasedenost prostora"
|
||
|
||
#: tfrmmain.actcuttoclipboard.caption
|
||
msgid "Cu&t"
|
||
msgstr "I&zreži"
|
||
|
||
#: tfrmmain.actdebugshowcommandparameters.caption
|
||
msgid "Show Command Parameters"
|
||
msgstr "Pokaži parametre ukaza"
|
||
|
||
#: tfrmmain.actdelete.caption
|
||
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmmain.actdeletesearches.caption
|
||
msgid "For all searches, cancel, close and free memory"
|
||
msgstr "Za vsa iskanja prekliči iskanje, zapri in sprosti pomnilnik"
|
||
|
||
#: tfrmmain.actdirhistory.caption
|
||
msgid "Directory history"
|
||
msgstr "Zgodovina mape"
|
||
|
||
#: tfrmmain.actdirhotlist.caption
|
||
msgid "Directory &Hotlist"
|
||
msgstr "Seznam &hitrih map"
|
||
|
||
#: tfrmmain.actdoanycmcommand.caption
|
||
msgid "Select any command and execute it"
|
||
msgstr "Izbor kateregakoli ukaza za izvajanje"
|
||
|
||
#: tfrmmain.actedit.caption
|
||
msgctxt "TFRMMAIN.ACTEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Uredi"
|
||
|
||
#: tfrmmain.acteditcomment.caption
|
||
msgid "Edit Co&mment..."
|
||
msgstr "Uredi &opombe datotek ..."
|
||
|
||
#: tfrmmain.acteditnew.caption
|
||
msgid "Edit new file"
|
||
msgstr "Uredi novo datoteko"
|
||
|
||
#: tfrmmain.acteditpath.caption
|
||
msgid "Edit path field above file list"
|
||
msgstr "Uredi polje poti nad seznamom datotek"
|
||
|
||
#: tfrmmain.actexchange.caption
|
||
msgid "Swap &Panels"
|
||
msgstr "Zamenjaj &okni"
|
||
|
||
#: tfrmmain.actexecutescript.caption
|
||
msgid "Execute Script"
|
||
msgstr "Izvedi skript"
|
||
|
||
#: tfrmmain.actexit.caption
|
||
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "&Končaj"
|
||
|
||
#: tfrmmain.actextractfiles.caption
|
||
msgid "&Extract Files..."
|
||
msgstr "Odpa&kiraj datoteke ..."
|
||
|
||
#: tfrmmain.actfileassoc.caption
|
||
msgid "Configuration of File &Associations"
|
||
msgstr "Možnosti datotečnih &vezi"
|
||
|
||
#: tfrmmain.actfilelinker.caption
|
||
msgid "Com&bine Files..."
|
||
msgstr "Zdr&uži razdeljeno datoteko ..."
|
||
|
||
#: tfrmmain.actfileproperties.caption
|
||
msgid "Show &File Properties"
|
||
msgstr "Pokaži &lastnosti datoteke"
|
||
|
||
#: tfrmmain.actfilespliter.caption
|
||
msgid "Spl&it File..."
|
||
msgstr "Raz&deli datoteko ..."
|
||
|
||
#: tfrmmain.actflatview.caption
|
||
msgid "&Flat view"
|
||
msgstr "&Ploski pogled"
|
||
|
||
#: tfrmmain.actfocuscmdline.caption
|
||
msgid "Focus command line"
|
||
msgstr "Postavi ukazno vrstico v žarišče"
|
||
|
||
#: tfrmmain.actfocusswap.caption
|
||
msgid "Swap focus"
|
||
msgstr "Preklopi žarišče"
|
||
|
||
#: tfrmmain.actfocusswap.hint
|
||
msgid "Switch between left and right file list"
|
||
msgstr "Preklopi med levim in desnim datotečnim oknom"
|
||
|
||
#: tfrmmain.actgotofirstfile.caption
|
||
msgid "Place cursor on first file in list"
|
||
msgstr "Postavi kazalko na prvo datoteko seznama"
|
||
|
||
#: tfrmmain.actgotolastfile.caption
|
||
msgid "Place cursor on last file in list"
|
||
msgstr "Postavi kazalko na zadnjo datoteko seznama"
|
||
|
||
#: tfrmmain.acthardlink.caption
|
||
msgid "Create &Hard Link..."
|
||
msgstr "Ustvari &trdo povezavo ..."
|
||
|
||
#: tfrmmain.acthelpindex.caption
|
||
msgid "&Contents"
|
||
msgstr "&Kazalo pomoči"
|
||
|
||
#: tfrmmain.acthorizontalfilepanels.caption
|
||
msgid "&Horizontal Panels Mode"
|
||
msgstr "Vodo&ravna postavitev oken"
|
||
|
||
#: tfrmmain.actkeyboard.caption
|
||
msgid "&Keyboard"
|
||
msgstr "&Tipkovne bližnjice"
|
||
|
||
#: tfrmmain.actleftbriefview.caption
|
||
msgid "Brief view on left panel"
|
||
msgstr "Datotečni pogled v levem oknu"
|
||
|
||
#: tfrmmain.actleftcolumnsview.caption
|
||
msgid "Columns view on left panel"
|
||
msgstr "Stolpčni pogled v levem oknu"
|
||
|
||
#: tfrmmain.actleftequalright.caption
|
||
msgid "Left &= Right"
|
||
msgstr "Levo &= Desno"
|
||
|
||
#: tfrmmain.actleftflatview.caption
|
||
msgid "&Flat view on left panel"
|
||
msgstr "&Ploski pogled v levem oknu"
|
||
|
||
#: tfrmmain.actleftopendrives.caption
|
||
msgid "Open left drive list"
|
||
msgstr "Odpri seznam levega pogona"
|
||
|
||
#: tfrmmain.actleftreverseorder.caption
|
||
msgid "Re&verse order on left panel"
|
||
msgstr "O&brnjen vrstni red v levem oknu"
|
||
|
||
#: tfrmmain.actleftsortbyattr.caption
|
||
msgid "Sort left panel by &Attributes"
|
||
msgstr "Razvrsti levo okno po &atributih"
|
||
|
||
#: tfrmmain.actleftsortbydate.caption
|
||
msgid "Sort left panel by &Date"
|
||
msgstr "Razvrsti levo okno po &datumu"
|
||
|
||
#: tfrmmain.actleftsortbyext.caption
|
||
msgid "Sort left panel by &Extension"
|
||
msgstr "Razvrsti levo okno po &priponi"
|
||
|
||
#: tfrmmain.actleftsortbyname.caption
|
||
msgid "Sort left panel by &Name"
|
||
msgstr "Razvrsti levo okno po &imenu"
|
||
|
||
#: tfrmmain.actleftsortbysize.caption
|
||
msgid "Sort left panel by &Size"
|
||
msgstr "Razvrsti levo okno po &velikosti"
|
||
|
||
#: tfrmmain.actleftthumbview.caption
|
||
msgid "Thumbnails view on left panel"
|
||
msgstr "Pogled sličic v levem oknu"
|
||
|
||
#: tfrmmain.actloadfavoritetabs.caption
|
||
msgid "Load tabs from Favorite Tabs"
|
||
msgstr "Naloži zavihke iz seznama priljubljenih"
|
||
|
||
#: tfrmmain.actloadselectionfromclip.caption
|
||
msgid "Load Selection from Clip&board"
|
||
msgstr "Naloži izbor iz o&dložišča"
|
||
|
||
#: tfrmmain.actloadselectionfromfile.caption
|
||
msgid "&Load Selection from File..."
|
||
msgstr "&Naloži izbor iz datoteke ..."
|
||
|
||
#: tfrmmain.actloadtabs.caption
|
||
msgid "&Load Tabs from File"
|
||
msgstr "&Naloži nastavitve zavihkov iz datoteke"
|
||
|
||
#: tfrmmain.actmakedir.caption
|
||
msgid "Create &Directory"
|
||
msgstr "Ustvari &mapo"
|
||
|
||
#: tfrmmain.actmarkcurrentextension.caption
|
||
msgid "Select All with the Same E&xtension"
|
||
msgstr "Izberi vse datoteke z &enako pripono"
|
||
|
||
#: tfrmmain.actmarkcurrentname.caption
|
||
msgid "Select all files with same name"
|
||
msgstr "Izberi vse datoteke z enakim imenom"
|
||
|
||
#: tfrmmain.actmarkcurrentnameext.caption
|
||
msgid "Select all files with same name and extension"
|
||
msgstr "Izberi vse datoteke z enakim imenom in pripono"
|
||
|
||
#: tfrmmain.actmarkcurrentpath.caption
|
||
msgid "Select all in same path"
|
||
msgstr "Izberi vse datoteke na isti poti"
|
||
|
||
#: tfrmmain.actmarkinvert.caption
|
||
msgid "&Invert Selection"
|
||
msgstr "Obrni iz&bor"
|
||
|
||
#: tfrmmain.actmarkmarkall.caption
|
||
msgid "&Select All"
|
||
msgstr "Izberi &vse"
|
||
|
||
#: tfrmmain.actmarkminus.caption
|
||
msgid "Unselect a Gro&up..."
|
||
msgstr "Počisti i&zbor po meri ..."
|
||
|
||
#: tfrmmain.actmarkplus.caption
|
||
msgid "Select a &Group..."
|
||
msgstr "&Izberi po meri ..."
|
||
|
||
#: tfrmmain.actmarkunmarkall.caption
|
||
msgid "&Unselect All"
|
||
msgstr "Počisti &izbor"
|
||
|
||
#: tfrmmain.actminimize.caption
|
||
msgid "Minimize window"
|
||
msgstr "Skrči okno"
|
||
|
||
#: tfrmmain.actmultirename.caption
|
||
msgid "Multi &Rename Tool"
|
||
msgstr "Napredno &preimenovanje ..."
|
||
|
||
#: tfrmmain.actnetworkconnect.caption
|
||
msgid "Network &Connect..."
|
||
msgstr "Omrežna &povezava ..."
|
||
|
||
#: tfrmmain.actnetworkdisconnect.caption
|
||
msgid "Network &Disconnect"
|
||
msgstr "&Prekini omrežno povezavo"
|
||
|
||
#: tfrmmain.actnetworkquickconnect.caption
|
||
msgid "Network &Quick Connect..."
|
||
msgstr "&Hitra povezava z omrežjem ..."
|
||
|
||
#: tfrmmain.actnewtab.caption
|
||
msgid "&New Tab"
|
||
msgstr "Ustvari nov &zavihek"
|
||
|
||
#: tfrmmain.actnextfavoritetabs.caption
|
||
msgid "Load the Next Favorite Tabs in the list"
|
||
msgstr "Naloži naslednji priljubljen zavihek na seznamu"
|
||
|
||
#: tfrmmain.actnexttab.caption
|
||
msgid "Switch to Nex&t Tab"
|
||
msgstr "Preklopi na &naslednji zavihek"
|
||
|
||
#: tfrmmain.actopen.caption
|
||
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Odpri"
|
||
|
||
#: tfrmmain.actopenarchive.caption
|
||
msgid "Try open archive"
|
||
msgstr "Poskusi odpreti arhiv"
|
||
|
||
#: tfrmmain.actopenbar.caption
|
||
msgid "Open bar file"
|
||
msgstr "Odpri datoteko orodne vrstice"
|
||
|
||
#: tfrmmain.actopendirinnewtab.caption
|
||
msgid "Open &Folder in a New Tab"
|
||
msgstr "O&dpri mapo v novem zavihku"
|
||
|
||
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
||
msgid "Open &VFS List"
|
||
msgstr "Odpri seznam &VFS"
|
||
|
||
#: tfrmmain.actoperationsviewer.caption
|
||
msgid "Operations &Viewer"
|
||
msgstr "Pre&gledovalnik opravil"
|
||
|
||
#: tfrmmain.actoptions.caption
|
||
msgid "&Options..."
|
||
msgstr "&Možnosti ..."
|
||
|
||
#: tfrmmain.actpackfiles.caption
|
||
msgid "&Pack Files..."
|
||
msgstr "Zapakira&j datoteke ..."
|
||
|
||
#: tfrmmain.actpanelssplitterperpos.caption
|
||
msgid "Set splitter position"
|
||
msgstr "Določi položaj razdelilnika"
|
||
|
||
#: tfrmmain.actpastefromclipboard.caption
|
||
msgid "&Paste"
|
||
msgstr "&Prilepi"
|
||
|
||
#: tfrmmain.actpreviousfavoritetabs.caption
|
||
msgid "Load the Previous Favorite Tabs in the list"
|
||
msgstr "Naloži predhodni priljubljen zavihek na seznamu"
|
||
|
||
#: tfrmmain.actprevtab.caption
|
||
msgid "Switch to &Previous Tab"
|
||
msgstr "Preklopi na &predhodni zavihek"
|
||
|
||
#: tfrmmain.actquickfilter.caption
|
||
msgid "Quick filter"
|
||
msgstr "Hitri filter"
|
||
|
||
#: tfrmmain.actquicksearch.caption
|
||
msgid "Quick search"
|
||
msgstr "Hitro iskanje"
|
||
|
||
#: tfrmmain.actquickview.caption
|
||
msgid "&Quick View Panel"
|
||
msgstr "Okno &hitrega predogleda"
|
||
|
||
#: tfrmmain.actrefresh.caption
|
||
msgid "&Refresh"
|
||
msgstr "&Osveži"
|
||
|
||
#: tfrmmain.actreloadfavoritetabs.caption
|
||
msgid "Reload the last Favorite Tabs loaded"
|
||
msgstr "Ponovno naloži zadnji naložen priljubljen zavihek"
|
||
|
||
#: tfrmmain.actrename.caption
|
||
msgctxt "tfrmmain.actrename.caption"
|
||
msgid "Move"
|
||
msgstr "Premakni"
|
||
|
||
#: tfrmmain.actrenamenoask.caption
|
||
msgid "Move/Rename files without asking for confirmation"
|
||
msgstr "Premakni/Preimenuj datoteke brez zahteve po potrditvi"
|
||
|
||
#: tfrmmain.actrenameonly.caption
|
||
msgctxt "tfrmmain.actrenameonly.caption"
|
||
msgid "Rename"
|
||
msgstr "Preimenuj"
|
||
|
||
#: tfrmmain.actrenametab.caption
|
||
msgid "&Rename Tab"
|
||
msgstr "Pr&eimenuj zavihek"
|
||
|
||
#: tfrmmain.actresavefavoritetabs.caption
|
||
msgid "Resave on the last Favorite Tabs loaded"
|
||
msgstr "Ponovno shrani zadnji naložen priljubljen zavihek"
|
||
|
||
#: tfrmmain.actrestoreselection.caption
|
||
msgid "&Restore Selection"
|
||
msgstr "&Obnovi zapomnjen izbor"
|
||
|
||
#: tfrmmain.actreverseorder.caption
|
||
msgid "Re&verse Order"
|
||
msgstr "O&brni razvrstitev"
|
||
|
||
#: tfrmmain.actrightbriefview.caption
|
||
msgid "Brief view on right panel"
|
||
msgstr "Datotečni pogled v desnem oknu"
|
||
|
||
#: tfrmmain.actrightcolumnsview.caption
|
||
msgid "Columns view on right panel"
|
||
msgstr "Stolpčni pogled v desnem oknu"
|
||
|
||
#: tfrmmain.actrightequalleft.caption
|
||
msgid "Right &= Left"
|
||
msgstr "Desno &= Levo"
|
||
|
||
#: tfrmmain.actrightflatview.caption
|
||
msgid "&Flat view on right panel"
|
||
msgstr "&Ploski pogled v desnem oknu"
|
||
|
||
#: tfrmmain.actrightopendrives.caption
|
||
msgid "Open right drive list"
|
||
msgstr "Odpri seznam desnega pogona"
|
||
|
||
#: tfrmmain.actrightreverseorder.caption
|
||
msgid "Re&verse order on right panel"
|
||
msgstr "O&brnjen vrstni red v desnem oknu"
|
||
|
||
#: tfrmmain.actrightsortbyattr.caption
|
||
msgid "Sort right panel by &Attributes"
|
||
msgstr "Razvrsti desno okno po &atributih"
|
||
|
||
#: tfrmmain.actrightsortbydate.caption
|
||
msgid "Sort right panel by &Date"
|
||
msgstr "Razvrsti desno okno po &datumu"
|
||
|
||
#: tfrmmain.actrightsortbyext.caption
|
||
msgid "Sort right panel by &Extension"
|
||
msgstr "Razvrsti desno okno po &priponi"
|
||
|
||
#: tfrmmain.actrightsortbyname.caption
|
||
msgid "Sort right panel by &Name"
|
||
msgstr "Razvrsti desno okno po &imenu"
|
||
|
||
#: tfrmmain.actrightsortbysize.caption
|
||
msgid "Sort right panel by &Size"
|
||
msgstr "Razvrsti desno okno po &velikosti"
|
||
|
||
#: tfrmmain.actrightthumbview.caption
|
||
msgid "Thumbnails view on right panel"
|
||
msgstr "Pogled sličic v desnem oknu"
|
||
|
||
#: tfrmmain.actrunterm.caption
|
||
msgid "Run &Terminal"
|
||
msgstr "Zaženi &terminal"
|
||
|
||
#: tfrmmain.actsavefavoritetabs.caption
|
||
msgid "Save current tabs to a New Favorite Tabs"
|
||
msgstr "Shrani trenutne zavihke med priljubljene"
|
||
|
||
#: tfrmmain.actsaveselection.caption
|
||
msgid "Sa&ve Selection"
|
||
msgstr "Zapomni si izb&or"
|
||
|
||
#: tfrmmain.actsaveselectiontofile.caption
|
||
msgid "Save S&election to File..."
|
||
msgstr "Shrani &izbor v datoteko ..."
|
||
|
||
#: tfrmmain.actsavetabs.caption
|
||
msgid "&Save Tabs to File"
|
||
msgstr "Shrani nastavitve &zavihkov v datoteko"
|
||
|
||
#: tfrmmain.actsearch.caption
|
||
msgid "&Search..."
|
||
msgstr "I&skanje ..."
|
||
|
||
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
||
msgid "All tabs Locked with Dir Opened in New Tabs"
|
||
msgstr "Nastavi vse zavihke kot zaklenjene z možnostjo odpiranja map v novih zavihkih"
|
||
|
||
#: tfrmmain.actsetalltabsoptionnormal.caption
|
||
msgid "Set all tabs to Normal"
|
||
msgstr "Nastavi vse zavihke kot običajne"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
||
msgid "Set all tabs to Locked"
|
||
msgstr "Nastavi vse zavihke kot zaklenjene"
|
||
|
||
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
||
msgid "All tabs Locked with Dir Changes Allowed"
|
||
msgstr "Nastavi vse zavihke kot zaklenjene z možnostjo spreminjanja map"
|
||
|
||
#: tfrmmain.actsetfileproperties.caption
|
||
msgid "Change &Attributes..."
|
||
msgstr "Spremeni &atribute ..."
|
||
|
||
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
||
msgid "Locked with Directories Opened in New &Tabs"
|
||
msgstr "Zaklenjen zavihek z možnostjo o&dpiranja map v novih zavihkih"
|
||
|
||
#: tfrmmain.actsettaboptionnormal.caption
|
||
msgid "&Normal"
|
||
msgstr "&Običajen zavihek"
|
||
|
||
#: tfrmmain.actsettaboptionpathlocked.caption
|
||
msgid "&Locked"
|
||
msgstr "&Zaklenjen zavihek"
|
||
|
||
#: tfrmmain.actsettaboptionpathresets.caption
|
||
msgid "Locked with &Directory Changes Allowed"
|
||
msgstr "Zaklenjen zavihek z možnostjo &spreminjanja map"
|
||
|
||
#: tfrmmain.actshellexecute.caption
|
||
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Odpri"
|
||
|
||
#: tfrmmain.actshellexecute.hint
|
||
msgid "Open using system associations"
|
||
msgstr "Odpri z uporabo sistemskih programskih vezi"
|
||
|
||
#: tfrmmain.actshowbuttonmenu.caption
|
||
msgid "Show button menu"
|
||
msgstr "Pokaži meni gumbov"
|
||
|
||
#: tfrmmain.actshowcmdlinehistory.caption
|
||
msgid "Show command line history"
|
||
msgstr "Pokaži zgodovino ukazne vrstice"
|
||
|
||
#: tfrmmain.actshowmainmenu.caption
|
||
msgid "Menu"
|
||
msgstr "Meni"
|
||
|
||
#: tfrmmain.actshowsysfiles.caption
|
||
msgid "Show &Hidden/System Files"
|
||
msgstr "Pokaži &skrite in sistemske datoteke"
|
||
|
||
#: tfrmmain.actsortbyattr.caption
|
||
msgid "Sort by &Attributes"
|
||
msgstr "Razvrsti po &atributih"
|
||
|
||
#: tfrmmain.actsortbydate.caption
|
||
msgid "Sort by &Date"
|
||
msgstr "Razvrsti po &datumu"
|
||
|
||
#: tfrmmain.actsortbyext.caption
|
||
msgid "Sort by &Extension"
|
||
msgstr "Razvrsti po &priponi"
|
||
|
||
#: tfrmmain.actsortbyname.caption
|
||
msgid "Sort by &Name"
|
||
msgstr "Razvrsti po &imenu"
|
||
|
||
#: tfrmmain.actsortbysize.caption
|
||
msgid "Sort by &Size"
|
||
msgstr "Razvrsti po &velikost"
|
||
|
||
#: tfrmmain.actsrcopendrives.caption
|
||
msgid "Open drive list"
|
||
msgstr "Odpri seznam pogona"
|
||
|
||
#: tfrmmain.actswitchignorelist.caption
|
||
msgid "Enable/disable ignore list file to not show file names"
|
||
msgstr "Omogoči/Onemogoči seznam prezrtih datotek pri prikazovanju"
|
||
|
||
#: tfrmmain.actsymlink.caption
|
||
msgid "Create Symbolic &Link..."
|
||
msgstr "Ustvari &simbolno povezavo ..."
|
||
|
||
#: tfrmmain.actsyncdirs.caption
|
||
msgid "Synchronize dirs..."
|
||
msgstr "Uskladi mape ..."
|
||
|
||
#: tfrmmain.acttargetequalsource.caption
|
||
msgid "Target &= Source"
|
||
msgstr "Izenači z &dejavnim zavihkom"
|
||
|
||
#: tfrmmain.acttestarchive.caption
|
||
msgid "&Test Archive(s)"
|
||
msgstr "Preizkusi &celovitost arhivov"
|
||
|
||
#: tfrmmain.actthumbnailsview.caption
|
||
msgctxt "tfrmmain.actthumbnailsview.caption"
|
||
msgid "Thumbnails"
|
||
msgstr "Pogled sličic"
|
||
|
||
#: tfrmmain.actthumbnailsview.hint
|
||
msgid "Thumbnails View"
|
||
msgstr "Pogled sličic"
|
||
|
||
#: tfrmmain.acttogglefullscreenconsole.caption
|
||
msgid "Toggle fullscreen mode console"
|
||
msgstr "Preklopi celozaslonski način konzole"
|
||
|
||
#: tfrmmain.acttransferleft.caption
|
||
msgid "Transfer dir under cursor to left window"
|
||
msgstr "Odpri označeno mapo desnega okna v levem oknu"
|
||
|
||
#: tfrmmain.acttransferright.caption
|
||
msgid "Transfer dir under cursor to right window"
|
||
msgstr "Odpri označeno mapo levega okna v desnem oknu"
|
||
|
||
#: tfrmmain.acttreeview.caption
|
||
msgid "&Tree View Panel"
|
||
msgstr "&Drevesni pogled"
|
||
|
||
#: tfrmmain.actuniversalsingledirectsort.caption
|
||
msgid "Sort according to parameters"
|
||
msgstr "Razvrsti glede na parametre"
|
||
|
||
#: tfrmmain.actunmarkcurrentextension.caption
|
||
msgid "Unselect All with the Same Ex&tension"
|
||
msgstr "Odstrani izbor vse&h datotek z enako pripono"
|
||
|
||
#: tfrmmain.actunmarkcurrentname.caption
|
||
msgid "Unselect all files with same name"
|
||
msgstr "Odstrani izbor vseh datotek z enakim imenom"
|
||
|
||
#: tfrmmain.actunmarkcurrentnameext.caption
|
||
msgid "Unselect all files with same name and extension"
|
||
msgstr "Odstrani izbor vseh datotek z enakim imenom in pripono"
|
||
|
||
#: tfrmmain.actunmarkcurrentpath.caption
|
||
msgid "Unselect all in same path"
|
||
msgstr "Odstrani izbor vseh datotek na isti poti"
|
||
|
||
#: tfrmmain.actview.caption
|
||
msgctxt "TFRMMAIN.ACTVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Pogled"
|
||
|
||
#: tfrmmain.actviewhistory.caption
|
||
msgid "Show history of visited paths for active view"
|
||
msgstr "Pokaži zgodovino obiskanih poti dejavnega pogleda"
|
||
|
||
#: tfrmmain.actviewhistorynext.caption
|
||
msgid "Go to next entry in history"
|
||
msgstr "Pojdi na naslednji vnos zgodovine"
|
||
|
||
#: tfrmmain.actviewhistoryprev.caption
|
||
msgid "Go to previous entry in history"
|
||
msgstr "Pojdi na predhodni vnos zgodovine"
|
||
|
||
#: tfrmmain.actviewlogfile.caption
|
||
msgid "View log file"
|
||
msgstr "Preglej vsebino datoteke dnevnika"
|
||
|
||
#: tfrmmain.actviewsearches.caption
|
||
msgid "View current search instances"
|
||
msgstr "Pogled trenutno dejavnih iskanj"
|
||
|
||
#: tfrmmain.actvisithomepage.caption
|
||
msgid "&Visit Double Commander Website"
|
||
msgstr "&Spletna stran programa"
|
||
|
||
#: tfrmmain.actwipe.caption
|
||
msgid "Wipe"
|
||
msgstr "Neobnovljivo izbriši"
|
||
|
||
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
||
msgid "Work with Directory Hotlist and parameters"
|
||
msgstr "Delo z vročimi mapami in parametri ukazov"
|
||
|
||
#: tfrmmain.btnf10.caption
|
||
msgctxt "TFRMMAIN.BTNF10.CAPTION"
|
||
msgid "Exit"
|
||
msgstr "Končaj"
|
||
|
||
#: tfrmmain.btnf7.caption
|
||
msgctxt "tfrmmain.btnf7.caption"
|
||
msgid "Directory"
|
||
msgstr "Mapa"
|
||
|
||
#: tfrmmain.btnf8.caption
|
||
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmmain.btnf9.caption
|
||
msgctxt "tfrmmain.btnf9.caption"
|
||
msgid "Terminal"
|
||
msgstr "Odpri Terminal"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnleftdirectoryhotlist.hint
|
||
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Seznam hitrih map"
|
||
|
||
#: tfrmmain.btnleftequalright.caption
|
||
msgctxt "tfrmmain.btnleftequalright.caption"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmmain.btnleftequalright.hint
|
||
msgid "Show current directory of the right panel in the left panel"
|
||
msgstr "Pokaži trenutno mapo desnega okna v levem oknu"
|
||
|
||
#: tfrmmain.btnlefthome.caption
|
||
msgctxt "tfrmmain.btnlefthome.caption"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnlefthome.hint
|
||
msgid "Go to home directory"
|
||
msgstr "Pojdi v osebno mapo"
|
||
|
||
#: tfrmmain.btnleftroot.caption
|
||
msgctxt "tfrmmain.btnleftroot.caption"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnleftroot.hint
|
||
msgid "Go to root directory"
|
||
msgstr "Pojdi v korensko mapo"
|
||
|
||
#: tfrmmain.btnleftup.caption
|
||
msgctxt "tfrmmain.btnleftup.caption"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.btnleftup.hint
|
||
msgid "Go to parent directory"
|
||
msgstr "Pojdi v mapo višje"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
||
msgid "*"
|
||
msgstr "*"
|
||
|
||
#: tfrmmain.btnrightdirectoryhotlist.hint
|
||
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Seznam hitrih map"
|
||
|
||
#: tfrmmain.btnrightequalleft.caption
|
||
msgctxt "tfrmmain.btnrightequalleft.caption"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmmain.btnrightequalleft.hint
|
||
msgid "Show current directory of the left panel in the right panel"
|
||
msgstr "Pokaži trenutno mapo levega okna v desnem oknu"
|
||
|
||
#: tfrmmain.btnrighthome.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
||
msgid "~"
|
||
msgstr "~"
|
||
|
||
#: tfrmmain.btnrightroot.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: tfrmmain.btnrightup.caption
|
||
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
||
msgid ".."
|
||
msgstr ".."
|
||
|
||
#: tfrmmain.caption
|
||
msgctxt "TFRMMAIN.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmain.lblcommandpath.caption
|
||
msgctxt "tfrmmain.lblcommandpath.caption"
|
||
msgid "Path"
|
||
msgstr "Pot"
|
||
|
||
#: tfrmmain.menuitem2.caption
|
||
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mi2080.caption
|
||
msgid "&20/80"
|
||
msgstr "&20/80"
|
||
|
||
#: tfrmmain.mi3070.caption
|
||
msgid "&30/70"
|
||
msgstr "&30/70"
|
||
|
||
#: tfrmmain.mi4060.caption
|
||
msgid "&40/60"
|
||
msgstr "&40/60"
|
||
|
||
#: tfrmmain.mi5050.caption
|
||
msgid "&50/50"
|
||
msgstr "&50/50"
|
||
|
||
#: tfrmmain.mi6040.caption
|
||
msgid "&60/40"
|
||
msgstr "&60/40"
|
||
|
||
#: tfrmmain.mi7030.caption
|
||
msgid "&70/30"
|
||
msgstr "&70/30"
|
||
|
||
#: tfrmmain.mi8020.caption
|
||
msgid "&80/20"
|
||
msgstr "&80/20"
|
||
|
||
#: tfrmmain.micancel.caption
|
||
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Prekliči"
|
||
|
||
#: tfrmmain.micopy.caption
|
||
msgid "Copy..."
|
||
msgstr "Kopiraj ..."
|
||
|
||
#: tfrmmain.mihardlink.caption
|
||
msgid "Create link..."
|
||
msgstr "Ustvari povezavo ..."
|
||
|
||
#: tfrmmain.miline1.caption
|
||
msgctxt "TFRMMAIN.MILINE1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline10.caption
|
||
msgctxt "TFRMMAIN.MILINE10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline11.caption
|
||
msgctxt "TFRMMAIN.MILINE11.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline12.caption
|
||
msgctxt "TFRMMAIN.MILINE12.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline13.caption
|
||
msgctxt "TFRMMAIN.MILINE13.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline14.caption
|
||
msgctxt "TFRMMAIN.MILINE14.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline15.caption
|
||
msgctxt "TFRMMAIN.MILINE15.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline16.caption
|
||
msgctxt "TFRMMAIN.MILINE16.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline17.caption
|
||
msgctxt "TFRMMAIN.MILINE17.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline18.caption
|
||
msgctxt "TFRMMAIN.MILINE18.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline19.caption
|
||
msgctxt "TFRMMAIN.MILINE19.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline2.caption
|
||
msgctxt "TFRMMAIN.MILINE2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline20.caption
|
||
msgctxt "TFRMMAIN.MILINE20.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline21.caption
|
||
msgctxt "TFRMMAIN.MILINE21.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline22.caption
|
||
msgctxt "TFRMMAIN.MILINE22.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline23.caption
|
||
msgctxt "TFRMMAIN.MILINE23.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline24.caption
|
||
msgctxt "TFRMMAIN.MILINE24.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline25.caption
|
||
msgctxt "TFRMMAIN.MILINE25.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline26.caption
|
||
msgctxt "TFRMMAIN.MILINE26.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline3.caption
|
||
msgctxt "TFRMMAIN.MILINE3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline32.caption
|
||
msgctxt "TFRMMAIN.MILINE32.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline33.caption
|
||
msgctxt "TFRMMAIN.MILINE33.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline37.caption
|
||
msgctxt "TFRMMAIN.MILINE37.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline38.caption
|
||
msgctxt "TFRMMAIN.MILINE38.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline39.caption
|
||
msgctxt "TFRMMAIN.MILINE39.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline4.caption
|
||
msgctxt "TFRMMAIN.MILINE4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline40.caption
|
||
msgctxt "TFRMMAIN.MILINE40.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline47.caption
|
||
msgctxt "TFRMMAIN.MILINE47.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline5.caption
|
||
msgctxt "TFRMMAIN.MILINE5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline50.caption
|
||
msgctxt "TFRMMAIN.MILINE50.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline55.caption
|
||
msgctxt "TFRMMAIN.MILINE55.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline6.caption
|
||
msgctxt "TFRMMAIN.MILINE6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline7.caption
|
||
msgctxt "TFRMMAIN.MILINE7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline8.caption
|
||
msgctxt "TFRMMAIN.MILINE8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.miline9.caption
|
||
msgctxt "TFRMMAIN.MILINE9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.milogclear.caption
|
||
msgid "Clear"
|
||
msgstr "Počisti"
|
||
|
||
#: tfrmmain.milogcopy.caption
|
||
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmmain.miloghide.caption
|
||
msgid "Hide"
|
||
msgstr "Skrij"
|
||
|
||
#: tfrmmain.milogselectall.caption
|
||
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Izberi vse"
|
||
|
||
#: tfrmmain.mimove.caption
|
||
msgid "Move..."
|
||
msgstr "Premakni ..."
|
||
|
||
#: tfrmmain.misymlink.caption
|
||
msgid "Create symlink..."
|
||
msgstr "Ustvari simbolno povezavo ..."
|
||
|
||
#: tfrmmain.mitaboptions.caption
|
||
msgid "Tab options"
|
||
msgstr "Možnosti zavihkov"
|
||
|
||
#: tfrmmain.mitrayiconexit.caption
|
||
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "&Končaj"
|
||
|
||
#: tfrmmain.mitrayiconrestore.caption
|
||
msgid "Restore"
|
||
msgstr "Obnovi"
|
||
|
||
#: tfrmmain.mnualloperpause.caption
|
||
msgctxt "tfrmmain.mnualloperpause.caption"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmmain.mnualloperstart.caption
|
||
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
|
||
msgid "Start"
|
||
msgstr "Začni"
|
||
|
||
#: tfrmmain.mnualloperstop.caption
|
||
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Prekliči"
|
||
|
||
#: tfrmmain.mnucmd.caption
|
||
msgid "&Commands"
|
||
msgstr "&Ukazi"
|
||
|
||
#: tfrmmain.mnuconfig.caption
|
||
msgid "C&onfiguration"
|
||
msgstr "&Nastavitve"
|
||
|
||
#: tfrmmain.mnucontextline1.caption
|
||
msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnucontextline2.caption
|
||
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmain.mnufavoritetabs.caption
|
||
msgid "Favorites"
|
||
msgstr "Priljubljeno"
|
||
|
||
#: tfrmmain.mnufiles.caption
|
||
msgid "&Files"
|
||
msgstr "&Datoteke"
|
||
|
||
#: tfrmmain.mnuhelp.caption
|
||
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomo&č"
|
||
|
||
#: tfrmmain.mnumark.caption
|
||
msgid "&Mark"
|
||
msgstr "&Izbor"
|
||
|
||
#: tfrmmain.mnunetwork.caption
|
||
msgctxt "tfrmmain.mnunetwork.caption"
|
||
msgid "Network"
|
||
msgstr "Omrežje"
|
||
|
||
#: tfrmmain.mnushow.caption
|
||
msgid "&Show"
|
||
msgstr "&Pokaži"
|
||
|
||
#: tfrmmain.mnutaboptions.caption
|
||
msgid "Tab &Options"
|
||
msgstr "Možnosti &zavihka"
|
||
|
||
#: tfrmmain.mnutabs.caption
|
||
msgid "&Tabs"
|
||
msgstr "&Zavihki"
|
||
|
||
#: tfrmmain.tbchangedir.caption
|
||
msgid "CD"
|
||
msgstr "CD"
|
||
|
||
#: tfrmmain.tbcopy.caption
|
||
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmmain.tbcut.caption
|
||
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Izreži"
|
||
|
||
#: tfrmmain.tbdelete.caption
|
||
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmmain.tbedit.caption
|
||
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Uredi"
|
||
|
||
#: tfrmmain.tbpaste.caption
|
||
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Prilepi"
|
||
|
||
#: tfrmmain.tbseparator.caption
|
||
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmaincommandsdlg.btncancel.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmmaincommandsdlg.btnok.caption
|
||
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: tfrmmaincommandsdlg.caption
|
||
msgid "Select your internal command"
|
||
msgstr "Izbor notranjega ukaza"
|
||
|
||
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
||
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
||
msgid "Legacy sorted"
|
||
msgstr "Nerazvrščeno"
|
||
|
||
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
||
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
|
||
msgid "Legacy sorted"
|
||
msgstr "Nerazvrščeno"
|
||
|
||
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
||
msgid "Select all categories by default"
|
||
msgstr "Privzeto izberi vse kategorije"
|
||
|
||
#: tfrmmaincommandsdlg.gbselection.caption
|
||
msgid "Selection:"
|
||
msgstr "Izbor:"
|
||
|
||
#: tfrmmaincommandsdlg.lblcategory.caption
|
||
msgid "&Categories:"
|
||
msgstr "&Kategorije:"
|
||
|
||
#: tfrmmaincommandsdlg.lblcommandname.caption
|
||
msgid "Command &name:"
|
||
msgstr "&Ime ukaza:"
|
||
|
||
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
||
msgid "&Filter:"
|
||
msgstr "&Filter:"
|
||
|
||
#: tfrmmaincommandsdlg.lblhint.caption
|
||
msgid "Hint:"
|
||
msgstr "Namig:"
|
||
|
||
#: tfrmmaincommandsdlg.lblhotkey.caption
|
||
msgid "Hotkey:"
|
||
msgstr "Hitra tipka:"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
||
msgid "cm_name"
|
||
msgstr "cm_ime"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
||
msgid "Category"
|
||
msgstr "Kategorija"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
||
msgid "Help"
|
||
msgstr "Pomoč"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
||
msgid "Hint"
|
||
msgstr "Namig"
|
||
|
||
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
||
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
||
msgid "Hotkey"
|
||
msgstr "Hitra tipka"
|
||
|
||
#: tfrmmaskinputdlg.btnaddattribute.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNADDATTRIBUTE.CAPTION"
|
||
msgid "&Add"
|
||
msgstr "Dod&aj"
|
||
|
||
#: tfrmmaskinputdlg.btnattrshelp.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomo&č"
|
||
|
||
#: tfrmmaskinputdlg.btncancel.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
||
msgid "&Define..."
|
||
msgstr "&Določi ..."
|
||
|
||
#: tfrmmaskinputdlg.btnok.caption
|
||
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
||
msgid "Case sensitive"
|
||
msgstr "Razlikovanje velikosti črk"
|
||
|
||
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
||
msgid "Ignore accents and ligatures"
|
||
msgstr "Prezri naglase in vezave znakov"
|
||
|
||
#: tfrmmaskinputdlg.lblattributes.caption
|
||
msgid "Attri&butes:"
|
||
msgstr "&Atributi"
|
||
|
||
#: tfrmmaskinputdlg.lblprompt.caption
|
||
msgid "Input Mask:"
|
||
msgstr "Maska izbire:"
|
||
|
||
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
||
msgid "O&r select predefined selection type:"
|
||
msgstr "&Shranjene maske izbire:"
|
||
|
||
#: tfrmmkdir.btncancel.caption
|
||
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmmkdir.btnok.caption
|
||
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: tfrmmkdir.caption
|
||
msgid "Create new directory"
|
||
msgstr "Ustvarjanje nove mape"
|
||
|
||
#: tfrmmkdir.lblmakedir.caption
|
||
msgid "&Input new directory name:"
|
||
msgstr "Ime &nove mape:"
|
||
|
||
#: tfrmmodview.btnpath1.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath2.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath3.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath4.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.btnpath5.caption
|
||
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmodview.caption
|
||
msgctxt "tfrmmodview.caption"
|
||
msgid "New Size"
|
||
msgstr "Nova velikost"
|
||
|
||
#: tfrmmodview.lblheight.caption
|
||
msgid "Height :"
|
||
msgstr "Višina :"
|
||
|
||
#: tfrmmodview.lblpath1.caption
|
||
msgctxt "tfrmmodview.lblpath1.caption"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmodview.lblpath2.caption
|
||
msgid "2"
|
||
msgstr "2"
|
||
|
||
#: tfrmmodview.lblpath3.caption
|
||
msgid "3"
|
||
msgstr "3"
|
||
|
||
#: tfrmmodview.lblpath4.caption
|
||
msgid "4"
|
||
msgstr "4"
|
||
|
||
#: tfrmmodview.lblpath5.caption
|
||
msgid "5"
|
||
msgstr "5"
|
||
|
||
#: tfrmmodview.lblquality.caption
|
||
msgid "Quality of compress to Jpg"
|
||
msgstr "Kakovost stiskanja zapisa JPG"
|
||
|
||
#: tfrmmodview.lblwidth.caption
|
||
msgid "Width :"
|
||
msgstr "Širina :"
|
||
|
||
#: tfrmmodview.rbbmp.caption
|
||
msgid "BMP"
|
||
msgstr "BMP"
|
||
|
||
#: tfrmmodview.rbico.caption
|
||
msgid "ICO"
|
||
msgstr "ICO"
|
||
|
||
#: tfrmmodview.rbjpg.caption
|
||
msgid "JPG"
|
||
msgstr "JPG"
|
||
|
||
#: tfrmmodview.rbpng.caption
|
||
msgid "PNG"
|
||
msgstr "PNG"
|
||
|
||
#: tfrmmodview.rbpnm.caption
|
||
msgid "PNM"
|
||
msgstr "PNM"
|
||
|
||
#: tfrmmodview.teheight.text
|
||
msgctxt "tfrmmodview.teheight.text"
|
||
msgid "Height"
|
||
msgstr "Višina"
|
||
|
||
#: tfrmmodview.tequality.text
|
||
msgid "80"
|
||
msgstr "80"
|
||
|
||
#: tfrmmodview.tewidth.text
|
||
msgctxt "tfrmmodview.tewidth.text"
|
||
msgid "Width"
|
||
msgstr "Širina"
|
||
|
||
#: tfrmmsg.lblmsg.caption
|
||
msgid "456456465465465"
|
||
msgstr "456456465465465"
|
||
|
||
#: tfrmmultirename.btnclose.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmmultirename.btndeletepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Izbriši"
|
||
|
||
#: tfrmmultirename.btnedit.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&&Uredi"
|
||
|
||
#: tfrmmultirename.btnextmenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnloadpreset.caption
|
||
msgid "&Load"
|
||
msgstr "&Naloži"
|
||
|
||
#: tfrmmultirename.btnnamemenu.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmmultirename.btnrename.caption
|
||
msgctxt "tfrmmultirename.btnrename.caption"
|
||
msgid "&Rename"
|
||
msgstr "&Preimenuj"
|
||
|
||
#: tfrmmultirename.btnrestore.caption
|
||
msgid "Reset &all"
|
||
msgstr "Ponastavi &vse"
|
||
|
||
#: tfrmmultirename.btnsavepreset.caption
|
||
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
||
msgid "&Save"
|
||
msgstr "&Shrani"
|
||
|
||
#: tfrmmultirename.caption
|
||
msgid "MultiRename"
|
||
msgstr "Napredno preimenovanje"
|
||
|
||
#: tfrmmultirename.cblog.caption
|
||
msgid "Ena&ble"
|
||
msgstr "&Omogoči"
|
||
|
||
#: tfrmmultirename.cbregexp.caption
|
||
msgid "Regular e&xpressions"
|
||
msgstr "Logični &izrazi"
|
||
|
||
#: tfrmmultirename.cbusesubs.caption
|
||
msgid "&Use substitution"
|
||
msgstr "Uporabi &zamenjave"
|
||
|
||
#: tfrmmultirename.cmbxwidth.text
|
||
msgid "01"
|
||
msgstr "01"
|
||
|
||
#: tfrmmultirename.edinterval.text
|
||
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.edpoc.text
|
||
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmmultirename.extension.caption
|
||
msgid "[E] Extension"
|
||
msgstr "[E] Pripona"
|
||
|
||
#: tfrmmultirename.gbcounter.caption
|
||
msgid "Counter"
|
||
msgstr "Števec"
|
||
|
||
#: tfrmmultirename.gbfindreplace.caption
|
||
msgid "Find && Replace"
|
||
msgstr "Najdi &in zamenjaj"
|
||
|
||
#: tfrmmultirename.gblog.caption
|
||
msgid "Log Result"
|
||
msgstr "Rezultat beleženja"
|
||
|
||
#: tfrmmultirename.gbmaska.caption
|
||
msgid "Mask"
|
||
msgstr "Maska"
|
||
|
||
#: tfrmmultirename.gbpresets.caption
|
||
msgid "Presets"
|
||
msgstr "Shranjena preimenovanja"
|
||
|
||
#: tfrmmultirename.lbext.caption
|
||
msgid "&Extension"
|
||
msgstr "&Pripona"
|
||
|
||
#: tfrmmultirename.lbfind.caption
|
||
msgid "&Find..."
|
||
msgstr "&Najdi ..."
|
||
|
||
#: tfrmmultirename.lbinterval.caption
|
||
msgid "&Interval"
|
||
msgstr "&Razmik"
|
||
|
||
#: tfrmmultirename.lbname.caption
|
||
msgid "File &Name"
|
||
msgstr "Ime &datoteke"
|
||
|
||
#: tfrmmultirename.lbreplace.caption
|
||
msgid "Re&place..."
|
||
msgstr "&Zamenjaj ..."
|
||
|
||
#: tfrmmultirename.lbstnb.caption
|
||
msgid "S&tart Number"
|
||
msgstr "&Začetna vrednost"
|
||
|
||
#: tfrmmultirename.lbwidth.caption
|
||
msgid "&Width"
|
||
msgstr "&Širina"
|
||
|
||
#: tfrmmultirename.micounter.caption
|
||
msgid "[C] Counter"
|
||
msgstr "[C] Števec"
|
||
|
||
#: tfrmmultirename.miday.caption
|
||
msgid "[D] Day"
|
||
msgstr "[D] Dan"
|
||
|
||
#: tfrmmultirename.miday1.caption
|
||
msgid "[DD] Day (2 digits)"
|
||
msgstr "[DD] Dan (2 številki)"
|
||
|
||
#: tfrmmultirename.miday2.caption
|
||
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
||
msgstr "[DDD] Dan v tednu (kratko, npr.: »pon«)"
|
||
|
||
#: tfrmmultirename.miday3.caption
|
||
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
||
msgstr "[DDDD] Dan v tednu (dolgo, npr.: »ponedeljek«)"
|
||
|
||
#: tfrmmultirename.miextensionx.caption
|
||
msgid "[Ex] Character at position x"
|
||
msgstr "[Ex] Znak pripone na mestu (x)"
|
||
|
||
#: tfrmmultirename.miextensionxx.caption
|
||
msgid "[Ex:y] Characters from position x to y"
|
||
msgstr "[Ex] Znaki pripone med mestoma (x) in (y)"
|
||
|
||
#: tfrmmultirename.mihour.caption
|
||
msgid "[h] Hour"
|
||
msgstr "[h] Ure"
|
||
|
||
#: tfrmmultirename.mihour1.caption
|
||
msgid "[hh] Hour (2 digits)"
|
||
msgstr "[hh] Ure (2 številki)"
|
||
|
||
#: tfrmmultirename.miminute.caption
|
||
msgid "[n] Minute"
|
||
msgstr "[n] Minute"
|
||
|
||
#: tfrmmultirename.miminute1.caption
|
||
msgid "[nn] Minute (2 digits)"
|
||
msgstr "[nn] Minute (2 številki)"
|
||
|
||
#: tfrmmultirename.mimonth.caption
|
||
msgid "[M] Month"
|
||
msgstr "[M] Mesec"
|
||
|
||
#: tfrmmultirename.mimonth1.caption
|
||
msgid "[MM] Month (2 digits)"
|
||
msgstr "[MM] Mesec (2 številki)"
|
||
|
||
#: tfrmmultirename.mimonth2.caption
|
||
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
||
msgstr "[MMM] Ime meseca (kratko, npr.: »jan«)"
|
||
|
||
#: tfrmmultirename.mimonth3.caption
|
||
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
||
msgstr "[MMMM] Ime meseca (dolgo, npr.: »januar«)"
|
||
|
||
#: tfrmmultirename.miname.caption
|
||
msgid "[N] Name"
|
||
msgstr "[N] Ime"
|
||
|
||
#: tfrmmultirename.minamex.caption
|
||
msgid "[Nx] Character at position x"
|
||
msgstr "[Nx] Znak imena na mestu (x)"
|
||
|
||
#: tfrmmultirename.minamexx.caption
|
||
msgid "[Nx:y] Characters from position x to y"
|
||
msgstr "[Nx:y] Znaki imena med mestoma (x) in (y)"
|
||
|
||
#: tfrmmultirename.minext.caption
|
||
msgid "Time..."
|
||
msgstr "Čas ..."
|
||
|
||
#: tfrmmultirename.minextextension.caption
|
||
msgid "Extension..."
|
||
msgstr "Pripona ..."
|
||
|
||
#: tfrmmultirename.minextname.caption
|
||
msgid "Name..."
|
||
msgstr "Ime ..."
|
||
|
||
#: tfrmmultirename.miplugin.caption
|
||
msgctxt "tfrmmultirename.miplugin.caption"
|
||
msgid "Plugin"
|
||
msgstr "Vstavek"
|
||
|
||
#: tfrmmultirename.misecond.caption
|
||
msgid "[s] Second"
|
||
msgstr "[s] Sekunde"
|
||
|
||
#: tfrmmultirename.misecond1.caption
|
||
msgid "[ss] Second (2 digits)"
|
||
msgstr "[ss] Sekunde (2 številki)"
|
||
|
||
#: tfrmmultirename.miyear.caption
|
||
msgid "[Y] Year (2 digits)"
|
||
msgstr "[Y] Leto (2 številki)"
|
||
|
||
#: tfrmmultirename.miyear1.caption
|
||
msgid "[YYYY] Year (4 digits)"
|
||
msgstr "[YYYY] Leto (4 številke)"
|
||
|
||
#: tfrmmultirename.mnueditnames.caption
|
||
msgid "Edit names..."
|
||
msgstr "Urejanje imen ..."
|
||
|
||
#: tfrmmultirename.mnuloadfromfile.caption
|
||
msgid "Load names from file..."
|
||
msgstr "Naloži imena iz datoteke ..."
|
||
|
||
#: tfrmmultirename.n1.caption
|
||
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n2.caption
|
||
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n3.caption
|
||
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n4.caption
|
||
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.n5.caption
|
||
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
||
msgid "Old File Name"
|
||
msgstr "Staro ime datoteke"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
||
msgid "New File Name"
|
||
msgstr "Novo ime datoteke"
|
||
|
||
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
||
msgid "File Path"
|
||
msgstr "Pot datoteke"
|
||
|
||
#: tfrmmultirenamewait.caption
|
||
msgctxt "TFRMMULTIRENAMEWAIT.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmmultirenamewait.lblmessage.caption
|
||
msgid "Click OK when you have closed the editor to load the changed names!"
|
||
msgstr "Po zapiranju urejevalnika je treba potrditi nalaganje spremenenjih imen!"
|
||
|
||
#: tfrmopenwith.caption
|
||
msgid "Choose an application"
|
||
msgstr "Izbor programa"
|
||
|
||
#: tfrmopenwith.chkcustomcommand.caption
|
||
msgid "Custom command"
|
||
msgstr "Ukaz po meri"
|
||
|
||
#: tfrmopenwith.chksaveassociation.caption
|
||
msgid "Save association"
|
||
msgstr "Shrani programsko vez"
|
||
|
||
#: tfrmopenwith.chkuseasdefault.caption
|
||
msgid "Set selected application as default action"
|
||
msgstr "Nastavi izbrani program za privzeto dejanje"
|
||
|
||
#: tfrmopenwith.lblmimetype.caption
|
||
msgid "File type to be opened: %s"
|
||
msgstr "Vrsta datoteke za odpiranje: %s"
|
||
|
||
#: tfrmopenwith.milistoffiles.caption
|
||
msgid "Multiple file names"
|
||
msgstr "Imena več datotek"
|
||
|
||
#: tfrmopenwith.milistoffiles.hint
|
||
msgid "%F"
|
||
msgstr "%F"
|
||
|
||
#: tfrmopenwith.milistofurls.caption
|
||
msgid "Multiple URIs"
|
||
msgstr "Več naslovov URI"
|
||
|
||
#: tfrmopenwith.milistofurls.hint
|
||
msgid "%U"
|
||
msgstr "%U"
|
||
|
||
#: tfrmopenwith.misinglefilename.caption
|
||
msgid "Single file name"
|
||
msgstr "Ime ene datoteke"
|
||
|
||
#: tfrmopenwith.misinglefilename.hint
|
||
msgid "%f"
|
||
msgstr "%f"
|
||
|
||
#: tfrmopenwith.misingleurl.caption
|
||
msgid "Single URI"
|
||
msgstr "En naslov URI"
|
||
|
||
#: tfrmopenwith.misingleurl.hint
|
||
msgid "%u"
|
||
msgstr "%u"
|
||
|
||
#: tfrmoptions.btnapply.caption
|
||
msgid "&Apply"
|
||
msgstr "&Uveljavi"
|
||
|
||
#: tfrmoptions.btncancel.caption
|
||
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmoptions.btnok.caption
|
||
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: tfrmoptions.caption
|
||
msgctxt "tfrmoptions.caption"
|
||
msgid "Options"
|
||
msgstr "Možnosti"
|
||
|
||
#: tfrmoptions.lblemptyeditor.caption
|
||
msgid "Please select one of the subpages, this page does not contain any settings."
|
||
msgstr "Nastavitve sklopa so urejene na straneh podrejenih kategorij."
|
||
|
||
#: tfrmoptionsarchivers.btnautoconfig.caption
|
||
msgid "A&uto Configure"
|
||
msgstr "&Samodejno nastavi"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcadd.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcapply.caption
|
||
msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption"
|
||
msgid "A&pply"
|
||
msgstr "&Uveljavi"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
|
||
msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption"
|
||
msgid "D&elete"
|
||
msgstr "&Izbriši"
|
||
|
||
#: tfrmoptionsarchivers.btnmultiarcrename.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
|
||
msgid "&Rename"
|
||
msgstr "&Preimenuj"
|
||
|
||
#: tfrmoptionsarchivers.btnrelativearchiver.hint
|
||
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
|
||
msgid "De&bug mode"
|
||
msgstr "Način &razhroščevanja"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
|
||
msgid "E&nabled"
|
||
msgstr "O&mogočeno"
|
||
|
||
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
|
||
msgid "S&how console output"
|
||
msgstr "Pokaži &odvod konzole"
|
||
|
||
#: tfrmoptionsarchivers.gbarchiveroptions.caption
|
||
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Možnosti"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveadd.caption
|
||
msgid "Add&ing:"
|
||
msgstr "Doda&janje:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextension.caption
|
||
msgid "E&xtension:"
|
||
msgstr "&Razširitev:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveextract.caption
|
||
msgid "Ex&tract:"
|
||
msgstr "Raz&širi:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelist.caption
|
||
msgid "&List:"
|
||
msgstr "&Seznam:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistend.caption
|
||
msgid "Listing &finish (optional):"
|
||
msgstr "&Konec seznama (izbirno):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchivelistformat.caption
|
||
msgid "Listing for&mat:"
|
||
msgstr "&Oblika seznama:"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiveliststart.caption
|
||
msgid "Listin&g start (optional):"
|
||
msgstr "&Začetek seznama (izbirno):"
|
||
|
||
#: tfrmoptionsarchivers.lblarchiver.caption
|
||
msgid "Arc&hiver:"
|
||
msgstr "Ar&hivirnik:"
|
||
|
||
#: tfrmoptionsarchivers.lbldescription.caption
|
||
msgid "De&scription:"
|
||
msgstr "&Opis:"
|
||
|
||
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
||
msgid "Additional"
|
||
msgstr "Dodatno"
|
||
|
||
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
||
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
|
||
msgid "General"
|
||
msgstr "Splošno"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
||
msgid "When &size, date or attributes change"
|
||
msgstr "če se spremenijo &velikost, datum ali atributi"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
||
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "za navedene &poti in podrejene mape:"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
||
msgid "When &files are created, deleted or renamed"
|
||
msgstr "ko je datoteka &ustvarjena, izbrisana ali preimenovana"
|
||
|
||
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
||
msgid "When application is in the &background"
|
||
msgstr "če je program zagnan v &ozadju"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
||
msgid "Disable auto-refresh"
|
||
msgstr "Onemogoči samodejno osveževanje:"
|
||
|
||
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
||
msgid "Refresh file list"
|
||
msgstr "Osveži seznam datotek:"
|
||
|
||
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
||
msgid "Al&ways show tray icon"
|
||
msgstr "Vedno &pokaži ikono v sistemski vrstici"
|
||
|
||
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
||
msgid "Automatically &hide unmounted devices"
|
||
msgstr "Samodejno &skrij odklopljene naprave"
|
||
|
||
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
||
msgid "Mo&ve icon to system tray when minimized"
|
||
msgstr "Pri skrčenju okna programa pokaži ikono v sistemski vrstici"
|
||
|
||
#: tfrmoptionsbehavior.cbonlyonce.caption
|
||
msgid "A&llow only one copy of DC at a time"
|
||
msgstr "Dovoli le &en zagnan primerek programa"
|
||
|
||
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
||
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
||
msgstr "Več pogonov ali priklopnih točk je mogoča vpisati ločeno s podpičjem » ; «."
|
||
|
||
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
||
msgid "Drives &blacklist"
|
||
msgstr "Črni seznam &pogonov"
|
||
|
||
#: tfrmoptionsbriefview.gbcolumns.caption
|
||
msgid "Columns size"
|
||
msgstr "Velikost stolpcev"
|
||
|
||
#: tfrmoptionsbriefview.gbshowfileext.caption
|
||
msgid "Show file extensions"
|
||
msgstr "Izpis pripon datotek"
|
||
|
||
#: tfrmoptionsbriefview.rbaligned.caption
|
||
msgid "ali&gned (with Tab)"
|
||
msgstr "&Poravnano (v stolpcu)"
|
||
|
||
#: tfrmoptionsbriefview.rbdirectly.caption
|
||
msgid "di&rectly after filename"
|
||
msgstr "&Neposredno za imenom datoteke"
|
||
|
||
#: tfrmoptionsbriefview.rbuseautosize.caption
|
||
msgid "Auto"
|
||
msgstr "Samodejno"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
||
msgid "Fixed columns count"
|
||
msgstr "Določeno število stolpcev"
|
||
|
||
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
||
msgid "Fixed columns width"
|
||
msgstr "Določena širina stolpcev"
|
||
|
||
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
||
msgid "Cut &text to column width"
|
||
msgstr "&Okrajšaj besedilo na širino stolpca"
|
||
|
||
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
|
||
msgid "&Extend cell width if text is not fitting into column"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
||
msgid "&Horizontal lines"
|
||
msgstr "&Vodoravne črte"
|
||
|
||
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
||
msgid "&Vertical lines"
|
||
msgstr "&Navpične črte"
|
||
|
||
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
||
msgid "A&uto fill columns"
|
||
msgstr "Samodejno &zapolni stolpce"
|
||
|
||
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
||
msgid "Show grid"
|
||
msgstr "Izris mreže okna"
|
||
|
||
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
||
msgid "Auto-size columns"
|
||
msgstr "Samodejno prilagajanje velikosti stolpcev"
|
||
|
||
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
||
msgid "Auto si&ze column:"
|
||
msgstr "Samodejno prilagodi &velikost:"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Uveljavi"
|
||
|
||
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
||
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Uredi"
|
||
|
||
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
||
msgid "Co&mmand line history"
|
||
msgstr "zgodovino &ukazne vrstice"
|
||
|
||
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
||
msgid "&Directory history"
|
||
msgstr "zgodovino &map"
|
||
|
||
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
||
msgid "&File mask history"
|
||
msgstr "zgodovino mask &imen datotek"
|
||
|
||
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
||
msgid "Sa&ve configuration"
|
||
msgstr "&nastavitve"
|
||
|
||
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
||
msgid "Searc&h/Replace history"
|
||
msgstr "zgodovino iskanj in zamenjav"
|
||
|
||
#: tfrmoptionsconfiguration.gbdirectories.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
|
||
msgid "Directories"
|
||
msgstr "Mape"
|
||
|
||
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
||
msgid "Location of configuration files"
|
||
msgstr "Privzeto mesto nastavitvenih datotek je:"
|
||
|
||
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
||
msgid "Save on exit"
|
||
msgstr "Pred končanjem programa shrani:"
|
||
|
||
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
||
msgid "Sort order of configuration order in left tree"
|
||
msgstr "Razvrščanje razdelkov nastavitev v drevesnem pogledu na levi:"
|
||
|
||
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
||
msgid "Set on command line"
|
||
msgstr "Nastavi v ukazni vrstici"
|
||
|
||
#: tfrmoptionsconfiguration.lbliconthemes.caption
|
||
msgid "Icon themes:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.lblthumbcache.caption
|
||
msgid "Thumbnails cache:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
||
msgid "P&rogram directory (portable version)"
|
||
msgstr "mapa &programa (prenosna različica)"
|
||
|
||
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
||
msgid "&User home directory"
|
||
msgstr "osebna mapa &uporabnika"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallfont.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
|
||
msgid "Apply modification to all columns"
|
||
msgstr "Uveljavi spremembo za vse stolpce"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Izbriši"
|
||
|
||
#: tfrmoptionscustomcolumns.btnfont.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
||
msgid "Go to set default"
|
||
msgstr "Nastavi kot privzeto"
|
||
|
||
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Povrni na privzete vrednosti"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
|
||
msgid "New"
|
||
msgstr "Novo"
|
||
|
||
#: tfrmoptionscustomcolumns.btnnext.caption
|
||
msgid "Next"
|
||
msgstr "Naslednja"
|
||
|
||
#: tfrmoptionscustomcolumns.btnprev.caption
|
||
msgid "Previous"
|
||
msgstr "Predhodna"
|
||
|
||
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Preimenuj"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
||
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
|
||
msgid "R"
|
||
msgstr "R"
|
||
|
||
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
|
||
msgid "Reset to default"
|
||
msgstr "Počisti na privzeto vrednost"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
|
||
msgid "Save as"
|
||
msgstr "Shrani kot"
|
||
|
||
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Shrani"
|
||
|
||
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Dovoli nadbarvo"
|
||
|
||
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
||
msgid "When clicking to change something, change for all columns"
|
||
msgstr "S klikanjem za spreminjanje česarkoli, se to odrazi na vseh stolpcih"
|
||
|
||
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
|
||
msgid "General"
|
||
msgstr "Splošno"
|
||
|
||
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
||
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
||
msgid "Cursor border"
|
||
msgstr "Okvir kazalke"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
||
msgid "Use Frame Cursor"
|
||
msgstr "Kazalka ima obrobo"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Selection Color"
|
||
msgstr "Barva izbire nedejavnega okno:"
|
||
|
||
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
||
msgid "Use Inverted Selection"
|
||
msgstr "Uporabi &obrnjen izbor"
|
||
|
||
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
||
msgid "Use custom font and color for this view"
|
||
msgstr "Uporabi barvo in pisavo po meri za ta pogled"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
||
msgid "BackGround:"
|
||
msgstr "Ozadje:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
||
msgid "Background 2:"
|
||
msgstr "Ozadje 2:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
||
msgid "Con&figure columns view:"
|
||
msgstr "Nastavi &stolpce za datotečni sistem:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
||
msgid "[Current Column Name]"
|
||
msgstr "[Trenutno ime stolpca]"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
||
msgid "Cursor Color:"
|
||
msgstr "Barva kazalke:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
||
msgid "Cursor Text:"
|
||
msgstr "Besedilo kazalke:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontname.caption
|
||
msgid "Font:"
|
||
msgstr "Pisava:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
||
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
|
||
msgid "Size:"
|
||
msgstr "Velikost:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
||
msgid "Text Color:"
|
||
msgstr "Barva besedila:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Barva nedejavne kazalke"
|
||
|
||
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Barva nedejavnega označevalnika"
|
||
|
||
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
||
msgid "Mark Color:"
|
||
msgstr "Barva oznake:"
|
||
|
||
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
||
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Spodaj je okno predogleda. S premikanjem kazalnika in izborom datoteke se pokažejo različne prilagoditve nastavitev."
|
||
|
||
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
||
msgid "Settings for column:"
|
||
msgstr "Nastavitve stolpca:"
|
||
|
||
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
||
msgid "Add column"
|
||
msgstr "Dodaj stolpec"
|
||
|
||
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
||
msgid "Position of frame panel after the comparison:"
|
||
msgstr "Položaj pladnja po primerjavi"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
|
||
msgid "Add directory of the &active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
|
||
msgid "Add &directories of the active && inactive frames"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
|
||
msgid "Add directory I will bro&wse to"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
|
||
msgid "Add a copy of the selected entry"
|
||
msgstr "Dodaj kopijo izbranega vnosa"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
|
||
msgid "Add current &selected or active directories of active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
|
||
msgid "Add a separator"
|
||
msgstr "Dodaj ločilnik"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
|
||
msgid "Add a sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
|
||
msgid "Add directory I will type"
|
||
msgstr "Dodaj mapo z vpisom imena"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
|
||
msgid "Collapse all"
|
||
msgstr "Zloži vse veje"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
|
||
msgid "Collapse item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actcut.caption
|
||
msgid "Cut selection of entries"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
|
||
msgid "Delete all!"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
|
||
msgid "Delete selected item"
|
||
msgstr "Izbriši izbrane predmete"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
|
||
msgid "Delete sub-menu and all its elements"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
|
||
msgid "Delete just sub-menu but keep elements"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
|
||
msgid "Expand item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
|
||
msgid "Focus tree window"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
|
||
msgid "Goto first item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
|
||
msgid "Goto last item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
|
||
msgid "Go to next item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
|
||
msgid "Go to previous item"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
|
||
msgid "Insert directory of the &active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
|
||
msgid "Insert &directories of the active && inactive frames"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
|
||
msgid "Insert directory I will bro&wse to"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
|
||
msgid "Insert a copy of the selected entry"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
|
||
msgid "Insert current &selected or active directories of active frame"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
|
||
msgid "Insert a separator"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
|
||
msgid "Insert sub menu"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
|
||
msgid "Insert directory I will type"
|
||
msgstr "Vstavi mapo z vpisom imena"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
|
||
msgid "Move to next"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
|
||
msgid "Move to previous"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
|
||
#, fuzzy
|
||
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
|
||
msgid "Open all branches"
|
||
msgstr "Odpri vse veje"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actpaste.caption
|
||
msgid "Paste what was cut"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
|
||
msgid "Search && replace in &path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
|
||
msgid "Search && replace in both path and target"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
|
||
msgid "Search && replace in &target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
|
||
msgid "Tweak path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
|
||
msgid "Tweak target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
||
msgid "A&dd..."
|
||
msgstr "Dodaj ..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
||
msgid "Bac&kup..."
|
||
msgstr "_Varnostna kopija"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
||
msgid "De&lete..."
|
||
msgstr "Izbriši ..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
||
msgid "E&xport..."
|
||
msgstr "Izvozi ..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomoč"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
||
msgid "Impo&rt..."
|
||
msgstr "Uvozi ..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
||
msgid "&Insert..."
|
||
msgstr "Vstavi ..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
||
msgid "&Miscellaneous..."
|
||
msgstr "Drugo ..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
||
msgid "Some functions to select appropriate target"
|
||
msgstr "Nekatere funkcije za izbor ustreznega cilja"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
||
msgid "&Sort..."
|
||
msgstr "Razvrsti ..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
||
msgid "&When adding directory, add also target"
|
||
msgstr "Med dodajanjem mape dodaj tudi cilj"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
||
msgid "Alwa&ys expand tree"
|
||
msgstr "Vedno pokaži razširjeno"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
||
msgid "Show only &valid environment variables"
|
||
msgstr "Pokaži le veljavne spremenljivke okolja"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
||
msgid "In pop&up, show [path also]"
|
||
msgstr "V pojavnem oknu (pokaže tudi pot)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
||
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
|
||
msgid "Name, a-z"
|
||
msgstr "Ime, a-z"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
|
||
msgid "Name, a-z"
|
||
msgstr "Ime, a–z"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
||
msgid "Directory Hotlist (reorder by drag && drop)"
|
||
msgstr "Seznam hitrih map (razvrščanje z vlečenjem)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
||
msgid "Other options"
|
||
msgstr "Druge možnosti"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
|
||
msgid "Name:"
|
||
msgstr "Ime:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
|
||
msgid "Path:"
|
||
msgstr "Pot:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
||
msgid "&Target:"
|
||
msgstr "Cilj:"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
||
msgid "...current le&vel of item(s) selected only"
|
||
msgstr "... le trenutno raven izbranih predmetov"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
||
msgid "Scan all &hotdir's path to validate the ones that actually exist"
|
||
msgstr "Preveri vse poti hitrih map in potrdi tiste, ki zares obstajajo"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
||
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
|
||
msgstr "Preveri vse poti &in cilje hitrih map ter potrdi tiste, ki zares obstajajo"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
||
msgid "to a Directory &Hotlist file (.hotlist)"
|
||
msgstr "v datoteko seznama hitrih map (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
|
||
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
||
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
|
||
msgstr "v datoteko »wincmd.ini« programa TotalCommander (izbriši obstoječe)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
||
msgid "Go to &configure TC related info"
|
||
msgstr "Skoči na podrobnosti o nastavitvah programa TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
||
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
|
||
msgid "Go to &configure TC related info"
|
||
msgstr "Skok na podrobnosti o nastavitvah programa TC"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
||
msgid "HotDirTestMenu"
|
||
msgstr "Preizkusni meni hitrih map"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
||
msgid "from a Directory &Hotlist file (.hotlist)"
|
||
msgstr "iz datoteke seznama hitrih map (.hotlist)"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
||
msgid "from \"&wincmd.ini\" of TC"
|
||
msgstr "iz datoteke »wincmd.ini« programa TotalCommander."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.minavigate.caption
|
||
msgid "&Navigate..."
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
||
msgid "&Restore a backup of Directory Hotlist"
|
||
msgstr "Obnovi varnostno kopijo seznama hitrih map"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
||
msgid "&Save a backup of current Directory Hotlist"
|
||
msgstr "Shrani varnostno kopijo seznama hitrih map"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
||
msgid "Search and &replace..."
|
||
msgstr "Poišči in zamenjaj ..."
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
||
msgid "...everything, from A to &Z!"
|
||
msgstr "... vse od A do Ž!"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
||
msgid "...single &group of item(s) only"
|
||
msgstr "... le eno skupino predmetov"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
||
msgid "...&content of submenu(s) selected, no sublevel"
|
||
msgstr "... le vsebino izbranega podrejenega menija brez podravni"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
||
msgid "...content of submenu(s) selected and &all sublevels"
|
||
msgstr "... vsebino izbranega podrejenega menija in vse podravni"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
||
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
|
||
msgid "Test resultin&g menu"
|
||
msgstr "Preizkus menija"
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
|
||
msgid "Tweak &path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
|
||
msgid "Tweak &target path"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
||
msgid "Addition from main panel"
|
||
msgstr "Dodajanje iz glavnega okna:"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
||
msgid "From all the supported formats, ask which one to use every time"
|
||
msgstr "Vedno vprašaj, kateri zapis naj bo uporabljen"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
||
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
||
msgstr "Med shranjevanjem besedila v naboru Unikod, shrani kot UTF8 (sicer bo uporabljen UTF16)"
|
||
|
||
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
||
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
||
msgstr "Med vlečenjem besedila samodejno ustvari ime datoteke (sicer se bo pojavilo vnosno polje)"
|
||
|
||
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
||
msgid "&Show confirmation dialog after drop"
|
||
msgstr "Pokaži &potrditveno okno po spuščanju datotek"
|
||
|
||
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
||
msgid "When drag && dropping text into panels:"
|
||
msgstr "Med vlečenjem besedila v okna:"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
||
msgid "Place the most desired format on top of list (use dag && drop):"
|
||
msgstr "Najustreznejši zapis postavi na vrh seznama (razvrščanje z vlečenjem):"
|
||
|
||
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
||
msgid "(if the most desired is not present, we'll take second one and so on)"
|
||
msgstr "(Če najustreznejši ni na voljo, bo uporabljen zapis na drugem mestu)"
|
||
|
||
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
||
msgid "(will not work with some source application, so try to uncheck if problem)"
|
||
msgstr "(lahko ne deluje z nekaterimi izvornimi programi)"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
||
msgid "Show &file system"
|
||
msgstr "Pokaži &datotečni sistem"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
||
msgid "Show fr&ee space"
|
||
msgstr "Pokaži &zasedenost prostora"
|
||
|
||
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
||
msgid "Show &label"
|
||
msgstr "Pokaži &oznako"
|
||
|
||
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
||
msgid "Drives list"
|
||
msgstr "Seznam pogonov"
|
||
|
||
#: tfrmoptionseditor.chkscrollpastendline.caption
|
||
msgid "Caret past end of line"
|
||
msgstr "Kazalka je za znakom konca vrstice"
|
||
|
||
#: tfrmoptionseditor.chkshowspecialchars.caption
|
||
msgid "Show special characters"
|
||
msgstr "Pokaži posebne znake"
|
||
|
||
#: tfrmoptionseditor.gbinternaleditor.caption
|
||
msgid "Internal editor options"
|
||
msgstr "Možnosti notranjega urejevalnika"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
||
msgid "Bac&kground"
|
||
msgstr "O&zadje"
|
||
|
||
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
||
msgid "Bac&kground"
|
||
msgstr "O&zadje"
|
||
|
||
#: tfrmoptionseditorcolors.btnresetmask.hint
|
||
msgid "Reset"
|
||
msgstr "Ponastavi"
|
||
|
||
#: tfrmoptionseditorcolors.btnsavemask.hint
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
|
||
msgid "Save"
|
||
msgstr "Shrani"
|
||
|
||
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
||
msgid "Element Attributes"
|
||
msgstr "Atributi predmeta"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
||
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
||
msgid "Fo®round"
|
||
msgstr "Pi&sava"
|
||
|
||
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
||
msgid "Fo®round"
|
||
msgstr "Pi&sava"
|
||
|
||
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
||
msgid "&Text-mark"
|
||
msgstr "&Označba besedila"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
||
msgid "Use (and edit) &global scheme settings"
|
||
msgstr "Uporabi (in uredi) nastavitve &splošne sheme"
|
||
|
||
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
||
msgid "Use &local scheme settings"
|
||
msgstr "Uporabi nastavitve &krajevne sheme"
|
||
|
||
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
||
msgid "&Bold"
|
||
msgstr "&Krepko"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "O&brni"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "O&nemogočeno"
|
||
|
||
#: tfrmoptionseditorcolors.textboldradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "&Omogočeno"
|
||
|
||
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
||
msgid "&Italic"
|
||
msgstr "&Ležeče"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "O&brni"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "O&nemogočeno"
|
||
|
||
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "&Omogočeno"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
||
msgid "&Strike Out"
|
||
msgstr "&Prečrtano"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
|
||
msgid "In&vert"
|
||
msgstr "O&brni"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
|
||
msgid "O&ff"
|
||
msgstr "O&nemogočeno"
|
||
|
||
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
||
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
|
||
msgid "O&n"
|
||
msgstr "&Omogočeno"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
||
msgid "&Underline"
|
||
msgstr "&Podčrtano"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
||
msgid "In&vert"
|
||
msgstr "O&brni"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
||
msgid "O&ff"
|
||
msgstr "O&nemogočeno"
|
||
|
||
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
||
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
||
msgid "O&n"
|
||
msgstr "&Omogočeno"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnadd.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION"
|
||
msgid "Add..."
|
||
msgstr "Dodaj ..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btndelete.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION"
|
||
msgid "Delete..."
|
||
msgstr "Izbriši ..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
||
msgid "Import/Export"
|
||
msgstr "Uvoz / Izvoz"
|
||
|
||
#: tfrmoptionsfavoritetabs.btninsert.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION"
|
||
msgid "Insert..."
|
||
msgstr "Vstavi ..."
|
||
|
||
#: tfrmoptionsfavoritetabs.btnrename.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Preimenuj"
|
||
|
||
#: tfrmoptionsfavoritetabs.btnsort.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION"
|
||
msgid "Sort..."
|
||
msgstr "Razvrsti ..."
|
||
|
||
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
||
msgid "None"
|
||
msgstr "brez"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION"
|
||
msgid "Always expand tree"
|
||
msgstr "Vedno pokaži razširjeno"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
||
msgid "No"
|
||
msgstr "Ne"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
||
msgid "Left"
|
||
msgstr "Leva"
|
||
|
||
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
||
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
||
msgid "Right"
|
||
msgstr "Desna"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
||
msgid "Favorite Tabs list (reorder by drag && drop)"
|
||
msgstr "Seznam priljubljenih zavihkov (razvrstitev je mogoča z miško)"
|
||
|
||
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION"
|
||
msgid "Other options"
|
||
msgstr "Druge možnosti"
|
||
|
||
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
||
msgid "What to restore where for the selected entry:"
|
||
msgstr "Kaj obnoviti in kje za izbran vnos:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
||
msgid "Existing tabs to keep:"
|
||
msgstr "Ohrani zavihke:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
||
msgid "Save dir history:"
|
||
msgstr "Shrani zgodovino mape:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
||
msgid "Tabs saved on left to be restored to:"
|
||
msgstr "Zavihki, shranjeni na levi, bodo obnovljeni na:"
|
||
|
||
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
||
msgid "Tabs saved on right to be restored to:"
|
||
msgstr "Zavihki, shranjeni na desni, bodo obnovljeni na:"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION"
|
||
msgid "a separator"
|
||
msgstr "ločilnik vnosov"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
||
msgid "Add separator"
|
||
msgstr "Dodaj ločilnik"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION"
|
||
msgid "sub-menu"
|
||
msgstr "podrejeni meni"
|
||
|
||
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION"
|
||
msgid "Add sub-menu"
|
||
msgstr "Dodaj podrejeni meni"
|
||
|
||
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION"
|
||
msgid "Collapse all"
|
||
msgstr "Zloži vse veje"
|
||
|
||
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION"
|
||
msgid "...current level of item(s) selected only"
|
||
msgstr "... le trenutno raven izbranih predmetov"
|
||
|
||
#: tfrmoptionsfavoritetabs.micutselection.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION"
|
||
msgid "Cut"
|
||
msgstr "Izreži"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION"
|
||
msgid "delete all!"
|
||
msgstr "vse predmete!"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION"
|
||
msgid "sub-menu and all its elements"
|
||
msgstr "podrejeni meni in vse njegove predmete"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION"
|
||
msgid "just sub-menu but keep elements"
|
||
msgstr "le podrejeni meni, vendar ohrani predmete"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION"
|
||
msgid "selected item"
|
||
msgstr "izbrane predmete"
|
||
|
||
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION"
|
||
msgid "Delete selected item"
|
||
msgstr "Izbriši izbrane predmete"
|
||
|
||
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
||
msgid "Export selection to legacy .tab file(s)"
|
||
msgstr "Izvozi izbor v datoteko *.tab"
|
||
|
||
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
||
msgid "FavoriteTabsTestMenu"
|
||
msgstr "Preizkusni meni priljubljenih zavihkov"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
||
msgid "Import legacy .tab file(s) according to default setting"
|
||
msgstr "Uvozi shranjeno datoteko *.tab glede na privzete nastavitve"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr "Uvozi shranjeno datoteko *.tab na izbrano mesto"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
||
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
||
msgid "Import legacy .tab file(s) at selected position"
|
||
msgstr "Uvozi shranjeno datoteko *.tab na izbrano mesto"
|
||
|
||
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
||
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
||
msgstr "Uvozi shranjeno datoteko *.tab na izbrano mesto v podrejenem meniju"
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
||
msgid "Insert separator"
|
||
msgstr "Vstavi ločilnik"
|
||
|
||
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
||
msgid "Insert sub-menu"
|
||
msgstr "Vstavi podrejeni meni"
|
||
|
||
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION"
|
||
msgid "Open all branches"
|
||
msgstr "Odpri vse veje"
|
||
|
||
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION"
|
||
msgid "Paste"
|
||
msgstr "Prilepi"
|
||
|
||
#: tfrmoptionsfavoritetabs.mirename.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Preimenuj"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR11.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTEVERYTHING.CAPTION"
|
||
msgid "...everything, from A to Z!"
|
||
msgstr "... vse od A do Ž!"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP.CAPTION"
|
||
msgid "...single group of item(s) only"
|
||
msgstr "... le eno skupino predmetov"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP2.CAPTION"
|
||
msgid "Sort single group of item(s) only"
|
||
msgstr "Razvrsti le eno skupino predmetov"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLESUBMENU.CAPTION"
|
||
msgid "...content of submenu(s) selected, no sublevel"
|
||
msgstr "... le vsebino izbranega podrejenega menija brez podravni"
|
||
|
||
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSUBMENUANDSUBLEVEL.CAPTION"
|
||
msgid "...content of submenu(s) selected and all sublevels"
|
||
msgstr "... vsebino izbranega podrejenega menija in vse podravni"
|
||
|
||
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
||
msgctxt "TFRMOPTIONSFAVORITETABS.MITESTRESULTINGFAVORITETABSMENU.CAPTION"
|
||
msgid "Test resulting menu"
|
||
msgstr "Preizkus menija"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddact.caption
|
||
msgid "Add"
|
||
msgstr "Dodaj"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddext.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
|
||
msgid "&Add"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmoptionsfileassoc.btncloneact.caption
|
||
msgid "Clone"
|
||
msgstr "Kloniraj"
|
||
|
||
#: tfrmoptionsfileassoc.btndownact.caption
|
||
msgid "&Down"
|
||
msgstr "&Dol"
|
||
|
||
#: tfrmoptionsfileassoc.btneditext.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Uredi"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertact.caption
|
||
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
||
msgid "Insert"
|
||
msgstr "Vstavi"
|
||
|
||
#: tfrmoptionsfileassoc.btninsertext.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION"
|
||
msgid "Insert"
|
||
msgstr "Vstavi"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveact.caption
|
||
msgid "Remo&ve"
|
||
msgstr "O&dstrani"
|
||
|
||
#: tfrmoptionsfileassoc.btnremoveext.caption
|
||
msgid "Re&move"
|
||
msgstr "&Odstrani"
|
||
|
||
#: tfrmoptionsfileassoc.btnremovetype.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "&Odstrani"
|
||
|
||
#: tfrmoptionsfileassoc.btnrenametype.caption
|
||
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
||
msgid "R&ename"
|
||
msgstr "&Preimenuj"
|
||
|
||
#: tfrmoptionsfileassoc.btnupact.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
|
||
msgid "&Up"
|
||
msgstr "&Gor"
|
||
|
||
#: tfrmoptionsfileassoc.destartpath.hint
|
||
msgid "Starting path of the command. Never quote this string."
|
||
msgstr "Začetna pot ukaza. Ta niz ne sme biti zapisan v navednicah."
|
||
|
||
#: tfrmoptionsfileassoc.edbactionname.hint
|
||
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
||
msgstr "Ime opravila. Niz ni sistemska vrednost, zato je lahko poljuben."
|
||
|
||
#: tfrmoptionsfileassoc.edtparams.hint
|
||
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
|
||
msgstr "Parametri za ukaz. Daljše ime datoteke, ki vključuje presledke, mora biti zapisan v navednicah."
|
||
|
||
#: tfrmoptionsfileassoc.fnecommand.hint
|
||
msgid "Command to execute. Long filename with space should be quoted."
|
||
msgstr "Ukaz za izvršitev. Daljše ime datoteke, ki vključuje presledke, mora biti zapisan v navednicah."
|
||
|
||
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
||
msgid "Action description:"
|
||
msgstr "Opis dejanja:"
|
||
|
||
#: tfrmoptionsfileassoc.gbactions.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
||
msgid "Actions"
|
||
msgstr "Dejanja"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.caption
|
||
msgid "Extensions"
|
||
msgstr "Razširitve"
|
||
|
||
#: tfrmoptionsfileassoc.gbexts.hint
|
||
msgid "Can be sorted by drag & drop"
|
||
msgstr "Dovoljeno je razvrščanje z &vlečenjem"
|
||
|
||
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
||
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
||
msgid "File types"
|
||
msgstr "Vrste datotek"
|
||
|
||
#: tfrmoptionsfileassoc.gbicon.caption
|
||
msgid "Icon"
|
||
msgstr "Ikona"
|
||
|
||
#: tfrmoptionsfileassoc.lbactions.hint
|
||
msgid "Actions may be sorted by drag & drop"
|
||
msgstr "Opravila je mogoče razvrstiti z vlečenjem"
|
||
|
||
#: tfrmoptionsfileassoc.lbexts.hint
|
||
msgid "Extensions may be sorted by drag & drop"
|
||
msgstr "Razširitve je mogoče razvrstiti z vlečenjem"
|
||
|
||
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
||
msgid "File types may be sorted by drag & drop"
|
||
msgstr "Vrste datotek je mogoče razvrščati z vlečenjem"
|
||
|
||
#: tfrmoptionsfileassoc.lblaction.caption
|
||
msgid "Action name:"
|
||
msgstr "Ime dejanja:"
|
||
|
||
#: tfrmoptionsfileassoc.lblcommand.caption
|
||
msgid "&Command:"
|
||
msgstr "&Ukaz:"
|
||
|
||
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
||
msgid "Parameter&s:"
|
||
msgstr "Parametr&i:"
|
||
|
||
#: tfrmoptionsfileassoc.lblstartpath.caption
|
||
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
||
msgid "Start pat&h:"
|
||
msgstr "Začetna &pot:"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem1.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.menuitem3.caption
|
||
msgid "Custom with..."
|
||
msgstr "Po meri ..."
|
||
|
||
#: tfrmoptionsfileassoc.micustom.caption
|
||
msgid "Custom"
|
||
msgstr "Po meri"
|
||
|
||
#: tfrmoptionsfileassoc.miedit.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
|
||
msgid "Edit"
|
||
msgstr "Uredi"
|
||
|
||
#: tfrmoptionsfileassoc.mieditor.caption
|
||
msgid "Open in Editor"
|
||
msgstr "Odpri v urejevalniku"
|
||
|
||
#: tfrmoptionsfileassoc.mieditwith.caption
|
||
msgid "Edit with..."
|
||
msgstr "Uredi s programom ..."
|
||
|
||
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
||
msgid "Get output from command"
|
||
msgstr "Pridobi odvod ukaza"
|
||
|
||
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
||
msgid "Open in Internal Editor"
|
||
msgstr "Odpri v notranjem urejevalniku"
|
||
|
||
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
||
msgid "Open in Internal Viewer"
|
||
msgstr "Odpri v notranjem pregledovalniku"
|
||
|
||
#: tfrmoptionsfileassoc.miopen.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
|
||
msgid "Open"
|
||
msgstr "Odpri"
|
||
|
||
#: tfrmoptionsfileassoc.miopenwith.caption
|
||
msgid "Open with..."
|
||
msgstr "Odpri s programom …"
|
||
|
||
#: tfrmoptionsfileassoc.miseparator.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionsfileassoc.mishell.caption
|
||
msgid "Run in terminal"
|
||
msgstr "Zaženi v terminalu"
|
||
|
||
#: tfrmoptionsfileassoc.miview.caption
|
||
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Pogled"
|
||
|
||
#: tfrmoptionsfileassoc.miviewer.caption
|
||
msgid "Open in Viewer"
|
||
msgstr "Odpri v pregledovalniku"
|
||
|
||
#: tfrmoptionsfileassoc.miviewwith.caption
|
||
msgid "View with..."
|
||
msgstr "Poglej s programom ..."
|
||
|
||
#: tfrmoptionsfileassoc.sbtnicon.hint
|
||
msgid "Click me to change icon!"
|
||
msgstr "Klik za zamenjavo ikone."
|
||
|
||
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
||
msgid "Execute via shell"
|
||
msgstr "Izvedi prek lupine"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
||
msgid "Extended context menu"
|
||
msgstr "Razširjen vsebinski meni"
|
||
|
||
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
|
||
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXTENDEDCONTEXTMENU.HINT"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr "Ob dostopu do programskih vezi z datotekami naj se pokaže tudi pogovorno okno za dodajanje izbrane vrste datoteke med zbrane nastavitve vezi"
|
||
|
||
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
||
msgid "File association configuration"
|
||
msgstr "Nastavitve datotečnih vezi"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
||
msgid "Offer to add selection to file association when not included already"
|
||
msgstr "Prikaži možnost dodajanja izbrane datoteke med programske vezi"
|
||
|
||
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
||
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
||
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
||
msgstr "Ob dostopu do programskih vezi z datotekami naj se pokaže tudi pogovorno okno za dodajanje izbrane vrste datoteke med zbrane nastavitve vezi"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Izvedi v terminalu in končaj"
|
||
|
||
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
||
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Izvedi v terminalu in pusti terminal odprt"
|
||
|
||
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
||
msgid "Extended options items:"
|
||
msgstr "Možnosti v vsebinskem meniju"
|
||
|
||
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
||
msgid "Show confirmation window for:"
|
||
msgstr "Potrditveno okno se pokaže za:"
|
||
|
||
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
||
msgid "Cop&y operation"
|
||
msgstr "opravila &kopiranja"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
||
msgid "&Delete operation"
|
||
msgstr "opravila &brisanja"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
||
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
||
msgstr "Izbriši v &smeti (s sočasnim pritiskom dvigalke se izbriše trajno)"
|
||
|
||
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
||
msgid "D&elete to trash operation"
|
||
msgstr "opravila brisanja v smeti"
|
||
|
||
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
||
msgid "D&rop readonly flag"
|
||
msgstr "Odstrani &zastavico le za branje"
|
||
|
||
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
||
msgid "&Move operation"
|
||
msgstr "opravila &premikanja"
|
||
|
||
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
||
msgid "&Process comments with files/folders"
|
||
msgstr "&Obravnavaj opombe skupaj z datotekami in mapami"
|
||
|
||
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
||
msgid "Select &file name without extension when renaming"
|
||
msgstr "Med preimenovanjem izberi le &ime datoteke brez pripone"
|
||
|
||
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
||
msgid "Sho&w tab select panel in copy/move dialog"
|
||
msgstr "Pokaži polje izbire &zavihka v pogovornem oknu kopiranja in premikanja"
|
||
|
||
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
||
msgid "S&kip file operations errors and write them to log window"
|
||
msgstr "&Preskoči napake datotečnih opravil in jih zapiši v dnevnik"
|
||
|
||
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
||
msgid "Executing operations"
|
||
msgstr "Izvajanje opravil"
|
||
|
||
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
||
msgid "User interface"
|
||
msgstr "Uporabniški vmesnik"
|
||
|
||
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
||
msgid "&Buffer size for file operations (in KB):"
|
||
msgstr "Velikost &medpomnilnika opravila (v KB):"
|
||
|
||
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
||
msgid "Buffer size for &hash calculation (in KB):"
|
||
msgstr "Velikost &medpomnilnika za izračun nadzorne vsote (v KB):"
|
||
|
||
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
||
msgid "Show operations progress &initially in"
|
||
msgstr "Pokaži splošni napredek &dejavnosti v"
|
||
|
||
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
||
msgid "Duplicated name auto-rename style:"
|
||
msgstr "Slog samodejnega preimenovanja podvojenih datotek:"
|
||
|
||
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
||
msgid "&Number of wipe passes:"
|
||
msgstr "Število prehodov &neobnovljivega brisanja:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
||
msgid "Reset to DC default"
|
||
msgstr "Ponastavi na privzete vrednosti"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION"
|
||
msgid "Allow Overcolor"
|
||
msgstr "Dovoli nadbarvo"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
||
msgid "Use &Frame Cursor"
|
||
msgstr "Uporabi kazalko &okvirja"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
||
msgid "Use &Gradient Indicator"
|
||
msgstr "Uporabi kazalnik &preliva"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
||
msgid "Use Inactive Sel Color"
|
||
msgstr "Uporabi barvo in pisavo za nedejavno okno"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
||
msgid "U&se Inverted Selection"
|
||
msgstr "Uporabi &obrnjen izbor"
|
||
|
||
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION"
|
||
msgid "Cursor border"
|
||
msgstr "Okvir kazalke"
|
||
|
||
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
||
msgid "Drive Free Space Indicator"
|
||
msgstr "Kazalnik zasedenosti prostora na pogonu"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
||
msgid "Bac&kground:"
|
||
msgstr "O&zadje:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
||
msgid "Backg&round 2:"
|
||
msgstr "&Drugo o&zadje:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
||
msgid "C&ursor Color:"
|
||
msgstr "Barva &kazalke:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
||
msgid "Cursor Te&xt:"
|
||
msgstr "Besedilo ka&zalke:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION"
|
||
msgid "Inactive Cursor Color:"
|
||
msgstr "Barva nedejavne kazalke:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
||
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION"
|
||
msgid "Inactive Mark Color:"
|
||
msgstr "Označeno besedilo:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
||
msgid "&Brightness level of inactive panel"
|
||
msgstr "Raven &svetlosti nedejavnega okna"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
||
msgid "In&dicator Back Color:"
|
||
msgstr "Barva &ozadja"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
||
msgid "&Indicator Fore Color:"
|
||
msgstr "Barva &pisave kazalnika:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
||
msgid "&Mark Color:"
|
||
msgstr "Barva &oznake:"
|
||
|
||
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
||
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
||
msgstr "Spodaj je okno predogleda. S premikanjem kazalnika in izborom datoteke se pokažejo različne prilagoditve nastavitev."
|
||
|
||
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
||
msgid "T&ext Color:"
|
||
msgstr "Barva &besedila:"
|
||
|
||
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
||
msgid "When launching file search, clear file mask filter"
|
||
msgstr "Med zagonom iskalnika datotek, počisti predhodno masko iskanja"
|
||
|
||
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
||
msgid "&Search for part of file name"
|
||
msgstr "&Poišči del imena datoteke"
|
||
|
||
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
||
msgid "Show menu bar in \"Find files\""
|
||
msgstr "Pokaži menijsko vrstico v oknu »iskanja datotek«"
|
||
|
||
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
||
msgid "Text search in files"
|
||
msgstr "Iskanje besedila v datotekah"
|
||
|
||
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
||
msgctxt "TFRMOPTIONSFILESEARCH.GBFILESEARCH.CAPTION"
|
||
msgid "File search"
|
||
msgstr "Iskanje datotek"
|
||
|
||
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
||
msgid "Current filters with \"New search\" button:"
|
||
msgstr "Trenutni filtri gumba »Novo iskanje«:"
|
||
|
||
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
||
msgid "Default search template:"
|
||
msgstr "Privzeta predloga iskanja:"
|
||
|
||
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
||
msgid "Use memory mapping for search te&xt in files"
|
||
msgstr "Uporabi preslikavo pomnilnika za iskanje &besedila v datotekah"
|
||
|
||
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
||
msgid "&Use stream for search text in files"
|
||
msgstr "&Uporabi pretok za iskanje besedila v datotekah"
|
||
|
||
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.BTNADDATTRIBUTE.CAPTION"
|
||
msgid "&Add"
|
||
msgstr "Dod&aj"
|
||
|
||
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
||
msgctxt "TFRMOPTIONSFILESVIEWS.BTNATTRSHELP.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomo&č"
|
||
|
||
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
||
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
||
msgstr "Omogoči prehod v &nadrejeno mapo, kadar je izveden dvojni klik na prazni del okna datotek"
|
||
|
||
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
||
msgid "Do&n't load file list until a tab is activated"
|
||
msgstr "&Ne naloži datoteke, dokler zavihek ni omogočen"
|
||
|
||
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
||
msgid "S&how square brackets around directories"
|
||
msgstr "&Izpiši oglate oklepaje okoli imena mape v seznamu okna"
|
||
|
||
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
||
msgid "Hi&ghlight new and updated files"
|
||
msgstr "&Poudari nove in posodobljene datoteke"
|
||
|
||
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
||
msgid "Enable inplace &renaming when clicking twice on a name"
|
||
msgstr "Omogoči takojšnje &preimenovanje z dvoklikom na ime datoteke"
|
||
|
||
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
||
msgid "Load &file list in separate thread"
|
||
msgstr "Naloži &seznam datotek v ločeni niti"
|
||
|
||
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
||
msgid "Load icons af&ter file list"
|
||
msgstr "Naloži ikone &za seznamom datotek"
|
||
|
||
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
||
msgid "Show s&ystem and hidden files"
|
||
msgstr "Pokaže skrite in &sistemske datoteke"
|
||
|
||
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
||
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
||
msgstr "&Med izbiranjem datotek s preslednico, se premakni na naslednjo datoteko v seznamu (kot z vstavljalko)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
||
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
||
msgstr "Filter v slogu sistema Windows za označevanje datotek (»*.*« izbere tudi datoteke brez pripone ...)"
|
||
|
||
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
||
msgid "Use an independent attribute filter in mask input dialog each time"
|
||
msgstr "Vsakič uporabi neodvisen filter atributa v maski"
|
||
|
||
#: tfrmoptionsfilesviews.gbformatting.caption
|
||
msgid "Formatting"
|
||
msgstr "Oblikovanje"
|
||
|
||
#: tfrmoptionsfilesviews.gbmarking.caption
|
||
msgid "Marking/Unmarking entries"
|
||
msgstr "Označevanje/Preklic oznake vnosov"
|
||
|
||
#: tfrmoptionsfilesviews.gbsorting.caption
|
||
msgid "Sorting"
|
||
msgstr "Razvrščanje"
|
||
|
||
#: tfrmoptionsfilesviews.lbattributemask.caption
|
||
msgid "Default attribute mask value to use:"
|
||
msgstr "Privzeta maska za uporabo:"
|
||
|
||
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
||
msgid "Case s&ensitivity:"
|
||
msgstr "Razlikovanje velikosti &črk:"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
||
msgid "Incorrect format"
|
||
msgstr "Napačen zapis"
|
||
|
||
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
||
msgid "&Date and time format:"
|
||
msgstr "&Zapis datuma in časa:"
|
||
|
||
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
||
msgid "File si&ze format:"
|
||
msgstr "Zapis velikosti datoteke:"
|
||
|
||
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
||
msgid "&Insert new files:"
|
||
msgstr "&Vstavi nove datoteke:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
||
msgid "So&rting directories:"
|
||
msgstr "Razvrščanje map:"
|
||
|
||
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
||
msgid "&Sort method:"
|
||
msgstr "&Način razvrščanja:"
|
||
|
||
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
||
msgid "&Move updated files:"
|
||
msgstr "&Premakni posodobljene datoteke:"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Uveljavi"
|
||
|
||
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
||
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "&Izbriši"
|
||
|
||
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
||
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
|
||
msgid "Template..."
|
||
msgstr "Predloga ..."
|
||
|
||
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
||
msgid "File types colors (sort by drag&&drop)"
|
||
msgstr "Obarvanje različnih skupin datotek (razvrščanje z vlečenjem)"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
||
msgid "Category a&ttributes:"
|
||
msgstr "&Atributi kategorije:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
||
msgid "Category co&lor:"
|
||
msgstr "&Barva kategorije:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
||
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
|
||
msgid "Category &mask:"
|
||
msgstr "&Maska kategorije:"
|
||
|
||
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
||
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
|
||
msgid "Category &name:"
|
||
msgstr "&Ime kategorije:"
|
||
|
||
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNPATHEDITFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSEARCHRESULTSFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnseleditfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnsellogfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselmainfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.btnselviewfnt.caption
|
||
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmoptionsfonts.lblconsolefont.caption
|
||
msgid "&Console font"
|
||
msgstr "&Pisava konzole"
|
||
|
||
#: tfrmoptionsfonts.lbleditorfont.caption
|
||
msgid "&Editor font"
|
||
msgstr "Pisava &urejevalnika"
|
||
|
||
#: tfrmoptionsfonts.lbllogfont.caption
|
||
msgid "&Log font"
|
||
msgstr "Pisava &dnevnika"
|
||
|
||
#: tfrmoptionsfonts.lblmainfont.caption
|
||
msgid "Main &font"
|
||
msgstr "&Glavna pisava"
|
||
|
||
#: tfrmoptionsfonts.lblpatheditfont.caption
|
||
msgid "Path font"
|
||
msgstr "Pisava poti"
|
||
|
||
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
||
msgid "Search results font"
|
||
msgstr "Pisava rezultatov iskanja"
|
||
|
||
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
||
msgid "Viewer&Book Font"
|
||
msgstr "Pisava &bralnega pregledovalnika"
|
||
|
||
#: tfrmoptionsfonts.lblviewerfont.caption
|
||
msgid "&Viewer font"
|
||
msgstr "Pisava &pregledovalnika"
|
||
|
||
#: tfrmoptionshotkeys.actaddhotkey.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTADDHOTKEY.CAPTION"
|
||
msgid "Add &hotkey"
|
||
msgstr "&Dodaj hitro tipko"
|
||
|
||
#: tfrmoptionshotkeys.actcopy.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTCOPY.CAPTION"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmoptionshotkeys.actdelete.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETE.CAPTION"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETEHOTKEY.CAPTION"
|
||
msgid "&Delete hotkey"
|
||
msgstr "&Izbriši hitro tipko"
|
||
|
||
#: tfrmoptionshotkeys.actedithotkey.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTEDITHOTKEY.CAPTION"
|
||
msgid "&Edit hotkey"
|
||
msgstr "Uredi &hitro tipko"
|
||
|
||
#: tfrmoptionshotkeys.actnextcategory.caption
|
||
msgid "Next category"
|
||
msgstr "Naslednja kategorija"
|
||
|
||
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
||
msgid "Make popup the file related menu"
|
||
msgstr "Pojavno okno naj bo z vrsto datoteke povezan meni"
|
||
|
||
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
||
msgid "Previous category"
|
||
msgstr "Predhodna kategorija"
|
||
|
||
#: tfrmoptionshotkeys.actrename.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.ACTRENAME.CAPTION"
|
||
msgid "Rename"
|
||
msgstr "Preimenuj"
|
||
|
||
#: tfrmoptionshotkeys.actrestoredefault.caption
|
||
msgid "Restore DC default"
|
||
msgstr "Ponastavi na privzete vrednosti"
|
||
|
||
#: tfrmoptionshotkeys.actsavenow.caption
|
||
msgid "Save now"
|
||
msgstr "Shrani zdaj"
|
||
|
||
#: tfrmoptionshotkeys.actsortbycommand.caption
|
||
msgid "Sort by command name"
|
||
msgstr "Razvrsti po imenu ukaza"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
||
msgid "Sort by hotkeys (grouped)"
|
||
msgstr "Razvrsti po hitrih tipkah (skupinjeno)"
|
||
|
||
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
||
msgid "Sort by hotkeys (one per row)"
|
||
msgstr "Razvrsti po hitrih tipkah (ena na vrstico)"
|
||
|
||
#: tfrmoptionshotkeys.lbfilter.caption
|
||
msgid "&Filter"
|
||
msgstr "&Filter"
|
||
|
||
#: tfrmoptionshotkeys.lblcategories.caption
|
||
msgid "C&ategories:"
|
||
msgstr "&Kategorije:"
|
||
|
||
#: tfrmoptionshotkeys.lblcommands.caption
|
||
msgid "Co&mmands:"
|
||
msgstr "&Ukazi:"
|
||
|
||
#: tfrmoptionshotkeys.lblscfiles.caption
|
||
msgid "&Shortcut files:"
|
||
msgstr "Datoteke &tipkovnih bližnjic:"
|
||
|
||
#: tfrmoptionshotkeys.lblsortorder.caption
|
||
msgid "So&rt order:"
|
||
msgstr "Način &razvrščanja:"
|
||
|
||
#: tfrmoptionshotkeys.micategories.caption
|
||
msgid "Categories"
|
||
msgstr "Kategorije"
|
||
|
||
#: tfrmoptionshotkeys.micommands.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.MICOMMANDS.CAPTION"
|
||
msgid "Command"
|
||
msgstr "Ukaz"
|
||
|
||
#: tfrmoptionshotkeys.miseparator1.caption
|
||
msgctxt "TFRMOPTIONSHOTKEYS.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionshotkeys.misortorder.caption
|
||
msgid "Sort order"
|
||
msgstr "Način razvrščanja"
|
||
|
||
#: tfrmoptionsicons.cbiconsexclude.caption
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
||
msgid "For the following &paths and their subdirectories:"
|
||
msgstr "Za navedene &poti in podrejene mape:"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenus.caption
|
||
msgid "Show icons for actions in &menus"
|
||
msgstr "Pokaži ikone za dejanja v &meniju"
|
||
|
||
#: tfrmoptionsicons.cbiconsinmenussize.text
|
||
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
|
||
msgid "16x16"
|
||
msgstr "16x16"
|
||
|
||
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
||
msgid "Show icons on buttons"
|
||
msgstr "Na gumbih naj se izrisujejo ikone."
|
||
|
||
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
||
msgid "Show o&verlay icons, e.g. for links"
|
||
msgstr "Pokaži prekrivne i&kone za npr. povezave"
|
||
|
||
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
||
msgid "Disable special icons"
|
||
msgstr "Onemogoči posebne ikone"
|
||
|
||
#: tfrmoptionsicons.gbiconssize.caption
|
||
msgid " Icon size "
|
||
msgstr "Velikost ikon"
|
||
|
||
#: tfrmoptionsicons.gbicontheme.caption
|
||
msgid "Icon theme"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.gbshowicons.caption
|
||
msgid "Show icons"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.gbshowiconsmode.caption
|
||
msgid " Show icons to the left of the filename "
|
||
msgstr "Pokaži ikone na levi strani imena datoteke"
|
||
|
||
#: tfrmoptionsicons.lbldiskpanel.caption
|
||
msgid "Disk panel:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.lblfilepanel.caption
|
||
msgid "File panel:"
|
||
msgstr ""
|
||
|
||
#: tfrmoptionsicons.rbiconsshowall.caption
|
||
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
|
||
msgid "A&ll"
|
||
msgstr "&Vse"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
||
msgid "All associated + &EXE/LNK (slow)"
|
||
msgstr "Vse programske vezi in &EXE/LNK (počasneje)"
|
||
|
||
#: tfrmoptionsicons.rbiconsshownone.caption
|
||
msgid "&No icons"
|
||
msgstr "Brez &ikon"
|
||
|
||
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
||
msgid "Only &standard icons"
|
||
msgstr "Le &običajne ikone"
|
||
|
||
#: tfrmoptionsignorelist.btnaddsel.caption
|
||
msgid "A&dd selected names"
|
||
msgstr "&Dodaj izbrana imena"
|
||
|
||
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
||
msgid "Add selected names with &full path"
|
||
msgstr "Doda izbrana imena s polno &potjo"
|
||
|
||
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
||
msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmoptionsignorelist.chkignoreenable.caption
|
||
msgid "&Ignore (don't show) the following files and folders:"
|
||
msgstr "&Prezri in ne pokaži naslednjih datotek in map:"
|
||
|
||
#: tfrmoptionsignorelist.lblsavein.caption
|
||
msgid "&Save in:"
|
||
msgstr "&Shrani v:"
|
||
|
||
#: tfrmoptionskeyboard.cblynxlike.caption
|
||
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
||
msgstr "&Tipki levo in desno zamenjata mapo (način Lynx)"
|
||
|
||
#: tfrmoptionskeyboard.gbtyping.caption
|
||
msgid "Typing"
|
||
msgstr "Dejanja pritiskov tipk na tipkovnici"
|
||
|
||
#: tfrmoptionskeyboard.lblalt.caption
|
||
msgid "Alt+L&etters:"
|
||
msgstr "Alt+Č&rke:"
|
||
|
||
#: tfrmoptionskeyboard.lblctrlalt.caption
|
||
msgid "Ctrl+Alt+Le&tters:"
|
||
msgstr "Ctrl+Alt+Čr&ke:"
|
||
|
||
#: tfrmoptionskeyboard.lblnomodifier.caption
|
||
msgid "&Letters:"
|
||
msgstr "&Črke:"
|
||
|
||
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
||
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
|
||
msgid "&Flat buttons"
|
||
msgstr "&Ploski gumbi"
|
||
|
||
#: tfrmoptionslayout.cbflatinterface.caption
|
||
msgid "Flat i&nterface"
|
||
msgstr "&Ploski vmesnik"
|
||
|
||
#: tfrmoptionslayout.cbflattoolbar.caption
|
||
msgid "Flat b&uttons"
|
||
msgstr "Ploski &gumbi"
|
||
|
||
#: tfrmoptionslayout.cbfreespaceind.caption
|
||
msgid "Show fr&ee space indicator on drive label"
|
||
msgstr "Pokaži vrstico &zasedenosti prostora"
|
||
|
||
#: tfrmoptionslayout.cblogwindow.caption
|
||
msgid "Show lo&g window"
|
||
msgstr "Pokaži okno &dnevniškega izpisa"
|
||
|
||
#: tfrmoptionslayout.cbpanelofoperations.caption
|
||
msgid "Show panel of operation in background"
|
||
msgstr "Pokaži okno opravil, zagnanih v ozadju"
|
||
|
||
#: tfrmoptionslayout.cbproginmenubar.caption
|
||
msgid "Show common progress in menu bar"
|
||
msgstr "Pokaži splošni napredek dejavnosti v menijski vrstici"
|
||
|
||
#: tfrmoptionslayout.cbshowcmdline.caption
|
||
msgid "Show command l&ine"
|
||
msgstr "Pokaži &ukazno vrstico"
|
||
|
||
#: tfrmoptionslayout.cbshowcurdir.caption
|
||
msgid "Show current director&y"
|
||
msgstr "Pokaži &trenutno mapo"
|
||
|
||
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
||
msgid "Show &drive buttons"
|
||
msgstr "Pokaže gumbe &pogonov"
|
||
|
||
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
||
msgid "Show free s&pace label"
|
||
msgstr "Pokaži vrednost &zasedenosti prostora"
|
||
|
||
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
||
msgid "Show drives list bu&tton"
|
||
msgstr "Pokaži gumb seznama &pogonov"
|
||
|
||
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
||
msgid "Show function &key buttons"
|
||
msgstr "Pokaži &funkcijske gumbe"
|
||
|
||
#: tfrmoptionslayout.cbshowmainmenu.caption
|
||
msgid "Show &main menu"
|
||
msgstr "Pokaži &glavni meni"
|
||
|
||
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
||
msgid "Show tool&bar"
|
||
msgstr "Pokaži &orodno vrstico"
|
||
|
||
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
||
msgid "Show short free space &label"
|
||
msgstr "Pokaži kratko oznako &zasedenosti prostora"
|
||
|
||
#: tfrmoptionslayout.cbshowstatusbar.caption
|
||
msgid "Show &status bar"
|
||
msgstr "Pokaži vrstico &stanja"
|
||
|
||
#: tfrmoptionslayout.cbshowtabheader.caption
|
||
msgid "S&how tabstop header"
|
||
msgstr "Pokaži glave &stolpcev"
|
||
|
||
#: tfrmoptionslayout.cbshowtabs.caption
|
||
msgid "Sho&w folder tabs"
|
||
msgstr "Pokaži z&avihke map"
|
||
|
||
#: tfrmoptionslayout.cbtermwindow.caption
|
||
msgid "Show te&rminal window"
|
||
msgstr "Pokaži okno &terminala"
|
||
|
||
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
||
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
||
msgstr "Pokaži dve orodni vrstici gumbov pogonov (&določene širine nad okni)"
|
||
|
||
#: tfrmoptionslayout.gbscreenlayout.caption
|
||
msgid " Screen layout "
|
||
msgstr "Zaslonska razporeditev"
|
||
|
||
#: tfrmoptionslog.btnrelativelogfile.hint
|
||
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmoptionslog.btnviewlogfile.hint
|
||
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
||
msgid "View log file content"
|
||
msgstr "Preglej vsebino datoteke dnevnika"
|
||
|
||
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
||
msgid "Include date in log filename"
|
||
msgstr "Vključi datum v ime dnevniške datoteke"
|
||
|
||
#: tfrmoptionslog.cblogarcop.caption
|
||
msgid "&Pack/Unpack"
|
||
msgstr "&Zapakiranje/Odpakiranje"
|
||
|
||
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
||
msgid "External command line execution"
|
||
msgstr "Zunanje izvajanje ukazne vrstice"
|
||
|
||
#: tfrmoptionslog.cblogcpmvln.caption
|
||
msgid "Cop&y/Move/Create link/symlink"
|
||
msgstr "Ko&piranje/Premikanje/Ustvarjanje navadnih in simbolnih povezav"
|
||
|
||
#: tfrmoptionslog.cblogdelete.caption
|
||
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Brisanje"
|
||
|
||
#: tfrmoptionslog.cblogdirop.caption
|
||
msgid "Crea&te/Delete directories"
|
||
msgstr "Us&tvarnje/Brisanje map"
|
||
|
||
#: tfrmoptionslog.cblogerrors.caption
|
||
msgid "Log &errors"
|
||
msgstr "Beleži &napake opravil"
|
||
|
||
#: tfrmoptionslog.cblogfile.caption
|
||
msgid "C&reate a log file:"
|
||
msgstr "Ustvari &dnevniško datoteko:"
|
||
|
||
#: tfrmoptionslog.cbloginfo.caption
|
||
msgid "Log &information messages"
|
||
msgstr "&Beleži sporočila podrobnosti"
|
||
|
||
#: tfrmoptionslog.cblogstartshutdown.caption
|
||
msgid "Start/shutdown"
|
||
msgstr "Zagon/Izklop programa"
|
||
|
||
#: tfrmoptionslog.cblogsuccess.caption
|
||
msgid "Log &successful operations"
|
||
msgstr "Beleži &uspešno končana opravila"
|
||
|
||
#: tfrmoptionslog.cblogvfs.caption
|
||
msgid "&File system plugins"
|
||
msgstr "&Uporabo sistemsko-datotečnih vstavkov"
|
||
|
||
#: tfrmoptionslog.gblogfile.caption
|
||
msgid "File operation log file"
|
||
msgstr "Dnevniška datoteka datotečnih opravil"
|
||
|
||
#: tfrmoptionslog.gblogfileop.caption
|
||
msgid "Log operations"
|
||
msgstr "Beleži opravila"
|
||
|
||
#: tfrmoptionslog.gblogfilestatus.caption
|
||
msgid "Operation status"
|
||
msgstr "Stanje opravila"
|
||
|
||
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
||
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
||
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
||
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
||
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
||
msgid "&Remove thumbnails for no longer existing files"
|
||
msgstr "&Odstrani sličice neobstoječih datotek"
|
||
|
||
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
||
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
|
||
msgid "View log file content"
|
||
msgstr "Preglej vsebino datoteke dnevnika"
|
||
|
||
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
||
msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION"
|
||
msgid "Create new with the encoding:"
|
||
msgstr "Ustvari novo besedilno datoteko z naborom:"
|
||
|
||
#: tfrmoptionsmisc.chkgotoroot.caption
|
||
msgid "Always &go to the root of a drive when changing drives"
|
||
msgstr "Med zamenjavo pogona vedno odpri &korensko mapo"
|
||
|
||
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
||
msgid "Show &warning messages (\"OK\" button only)"
|
||
msgstr "Pokaži &opozorila (okna, ki imajo le gumb »V redu«)"
|
||
|
||
#: tfrmoptionsmisc.chkthumbsave.caption
|
||
msgid "&Save thumbnails in cache"
|
||
msgstr "&Shrani sličice v predpomnilnik"
|
||
|
||
#: tfrmoptionsmisc.dblthumbnails.caption
|
||
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
|
||
msgid "Thumbnails"
|
||
msgstr "Sličice"
|
||
|
||
#: tfrmoptionsmisc.gbfilecomments.caption
|
||
msgid "File comments (descript.ion)"
|
||
msgstr "Opombe k datoteki (descript.ion)"
|
||
|
||
#: tfrmoptionsmisc.gbtcexportimport.caption
|
||
msgid "Regarding TC export/import:"
|
||
msgstr "TC izvoz in uvoz:"
|
||
|
||
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
||
msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION"
|
||
msgid "Default encoding:"
|
||
msgstr "Privzeti nabor:"
|
||
|
||
#: tfrmoptionsmisc.lbltcconfig.caption
|
||
msgid "Configuration file:"
|
||
msgstr "Nastavitvena datoteka:"
|
||
|
||
#: tfrmoptionsmisc.lbltcexecutable.caption
|
||
msgid "TC executable:"
|
||
msgstr "Izvedljiva datoteka TC."
|
||
|
||
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
||
msgid "Toolbar output path:"
|
||
msgstr "Odvodna pot orodne vrstice"
|
||
|
||
#: tfrmoptionsmisc.lblthumbpixels.caption
|
||
msgid "pixels"
|
||
msgstr "točke"
|
||
|
||
#: tfrmoptionsmisc.lblthumbseparator.caption
|
||
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmoptionsmisc.lblthumbsize.caption
|
||
msgid "&Thumbnail size:"
|
||
msgstr "&Velikost sličic:"
|
||
|
||
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
||
msgid "&Selection by mouse"
|
||
msgstr "&Izbiranje datotek z miško"
|
||
|
||
#: tfrmoptionsmouse.gbscrolling.caption
|
||
msgid "Scrolling"
|
||
msgstr "Drsenje"
|
||
|
||
#: tfrmoptionsmouse.gbselection.caption
|
||
msgid "Selection"
|
||
msgstr "Izbor"
|
||
|
||
#: tfrmoptionsmouse.lblmousemode.caption
|
||
msgid "&Mode:"
|
||
msgstr "&Način:"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
||
msgid "&Line by line"
|
||
msgstr "&Vrstica po vrstico"
|
||
|
||
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
||
msgid "Line by line &with cursor movement"
|
||
msgstr "Premik kazalke &vrstico po vrstico"
|
||
|
||
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
||
msgid "&Page by page"
|
||
msgstr "&Stran po stran"
|
||
|
||
#: tfrmoptionsplugins.btnaddplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmoptionsplugins.btnconfigplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
|
||
msgid "Con&figure"
|
||
msgstr "&Nastavitve"
|
||
|
||
#: tfrmoptionsplugins.btnenableplugin.caption
|
||
msgid "E&nable"
|
||
msgstr "&Omogoči"
|
||
|
||
#: tfrmoptionsplugins.btnremoveplugin.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "&Odstrani"
|
||
|
||
#: tfrmoptionsplugins.btntweakplugin.caption
|
||
msgid "&Tweak"
|
||
msgstr "&Prilagodi"
|
||
|
||
#: tfrmoptionsplugins.lbldsxdescription.caption
|
||
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
||
msgstr "Vstavki &iskalnikov omogočajo uporabo dodatnih načinov iskanja oziroma uporabo zunanjih orodij (ukaz »locate« in podobno)"
|
||
|
||
#: tfrmoptionsplugins.lblwcxdescription.caption
|
||
msgid "Pack&er plugins are used to work with archives"
|
||
msgstr "Vstavki &pakirnikov so uporabljeni za delo z arhivi."
|
||
|
||
#: tfrmoptionsplugins.lblwdxdescription.caption
|
||
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
||
msgstr "Vsebinski &vstavki omogočajo prikaz podrobnosti datotek, kot so oznake mp3, atributi slik in seznami datotek, ter uporabo podatkov oznak za iskanje, preimenovanje in drugo."
|
||
|
||
#: tfrmoptionsplugins.lblwfxdescription.caption
|
||
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
||
msgstr "Sistemsko-datotečni vstavki omogočajo dostop do naprav, kot so dlančniki in PocketPC."
|
||
|
||
#: tfrmoptionsplugins.lblwlxdescription.caption
|
||
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
||
msgstr "Vstavki &pregledovalnikov omogočajo prikaz različnih datotek dokumentov, kot so slike, preglednice, podatkovne zbirke in podobno (F3, Ctrl+Q)."
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
|
||
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
|
||
msgid "Active"
|
||
msgstr "Dejavno"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
|
||
msgid "Plugin"
|
||
msgstr "Vstavek"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
|
||
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
|
||
msgid "Registered for"
|
||
msgstr "Vpisano za"
|
||
|
||
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
|
||
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ime datoteke"
|
||
|
||
#: tfrmoptionsplugins.tsdsx.caption
|
||
msgid "&Search plugins (.DSX)"
|
||
msgstr "Vstavki &iskanja (.dsx)"
|
||
|
||
#: tfrmoptionsplugins.tswcx.caption
|
||
msgid "Pac&ker plugins (.WCX)"
|
||
msgstr "Vstavki &pakiranja (.wcx)"
|
||
|
||
#: tfrmoptionsplugins.tswdx.caption
|
||
msgid "Content pl&ugins (.WDX)"
|
||
msgstr "&Vsebinski vstavki (.wdx)"
|
||
|
||
#: tfrmoptionsplugins.tswfx.caption
|
||
msgid "F&ile system plugins (.WFX)"
|
||
msgstr "Sistemsko-&datotečni vstavki (.wfx)"
|
||
|
||
#: tfrmoptionsplugins.tswlx.caption
|
||
msgid "&Viewer plugins (.WLX)"
|
||
msgstr "Vstavki &pregledovanja (.wlx)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
||
msgid "&Beginning (name must start with first typed character)"
|
||
msgstr "na &začetku (ime se mora začeti s prvim vpisanim znakom)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
||
msgid "En&ding (last character before a typed dot . must match)"
|
||
msgstr "na &koncu (ime se mora končati s prvim vpisanim znakom pred piko (.) in pripono)"
|
||
|
||
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
||
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
||
msgid "Options"
|
||
msgstr "Možnosti"
|
||
|
||
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
||
msgid "Exact name match"
|
||
msgstr "Natančno ujemanje imena datoteke:"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
||
msgid "Search case"
|
||
msgstr "Upoštevanje velikosti črk med iskanjem je:"
|
||
|
||
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
||
msgid "Search for these items"
|
||
msgstr "Iskanje predmetov"
|
||
|
||
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
||
msgid "Keep renamed name when unlocking a tab"
|
||
msgstr "Ohrani preimenovano ime ob odklepanju zavihka"
|
||
|
||
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
||
msgid "Activate target &panel when clicking on one of its Tabs"
|
||
msgstr "S klikom na zavihek, se okno postavi v &žarišče"
|
||
|
||
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
||
msgid "&Show tab header also when there is only one tab"
|
||
msgstr "Pokaži &glavo zavihka tudi, ko je odprt le en zavihek"
|
||
|
||
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
||
msgid "Close duplicate tabs when closing application"
|
||
msgstr "Zapri podvojene zavihke ob končanju programa"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
||
msgid "Con&firm close all tabs"
|
||
msgstr "&Potrdi zapiranje vseh zavihkov"
|
||
|
||
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
||
msgid "Confirm close locked tabs"
|
||
msgstr "Potrdi zapiranje zaklenjenih zavihkov"
|
||
|
||
#: tfrmoptionstabs.cbtabslimitoption.caption
|
||
msgid "&Limit tab title length to"
|
||
msgstr "Omeji dolžino naslova zavihka na"
|
||
|
||
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
||
msgid "Show locked tabs &with an asterisk *"
|
||
msgstr "Zaklenjene zavihke označi z zvezdico *"
|
||
|
||
#: tfrmoptionstabs.cbtabsmultilines.caption
|
||
msgid "&Tabs on multiple lines"
|
||
msgstr "&Zavihki so lahko v več vrsticah"
|
||
|
||
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
||
msgid "Ctrl+&Up opens new tab in foreground"
|
||
msgstr "Tipki CTRL+↑ odpreta nov zavihek v ospredju"
|
||
|
||
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
||
msgid "Open &new tabs near current tab"
|
||
msgstr "Odpri &nov zavihek ob trenutno dejavnem"
|
||
|
||
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
||
msgid "Reuse existing tab when possible"
|
||
msgstr "Uporabi obstoječi zavihek, ko je le mogoče"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
||
msgid "Show ta&b close button"
|
||
msgstr "Gumb za &zapiranje zavihka je vedno viden"
|
||
|
||
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
||
msgid "Always show drive letter in tab title"
|
||
msgstr "Vedno pokaži črko pogona v nazivu zavihka"
|
||
|
||
#: tfrmoptionstabs.gbtabs.caption
|
||
msgid "Folder tabs headers"
|
||
msgstr "Glave zavihkov map"
|
||
|
||
#: tfrmoptionstabs.lblchar.caption
|
||
msgid "characters"
|
||
msgstr "znakov"
|
||
|
||
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
||
msgid "Action to do when double click on a tab:"
|
||
msgstr "Dejanja ob dvojnem kliku na zavihek:"
|
||
|
||
#: tfrmoptionstabs.lbltabsposition.caption
|
||
msgid "Ta&bs position"
|
||
msgstr "Položaj &zavihkov"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
||
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTEXISTINGTABSTOKEEP.TEXT"
|
||
msgid "None"
|
||
msgstr "brez"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
||
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTSAVEDIRHISTORY.TEXT"
|
||
msgid "No"
|
||
msgstr "Ne"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
||
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELLEFTSAVED.TEXT"
|
||
msgid "Left"
|
||
msgstr "Leva"
|
||
|
||
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
||
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELRIGHTSAVED.TEXT"
|
||
msgid "Right"
|
||
msgstr "Desna"
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after resaving"
|
||
msgstr "Po ponovnem shranjevanju skoči na nastavitve priljubljenih zavihkov"
|
||
|
||
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
||
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
||
msgstr "Po prvem shranjevanju skoči na nastavitve priljubljenih zavihkov"
|
||
|
||
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
||
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
||
msgstr "Omogoči dodatne možnosti priljubljenih zavihkov (izbor ciljne strani ob obnovitvi ...)"
|
||
|
||
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
||
msgid "Default extra settings when saving new Favorite Tabs:"
|
||
msgstr "Privzete dodatne nastavitve shranjevanja zavihkov:"
|
||
|
||
#: tfrmoptionstabsextra.gbtabs.caption
|
||
msgid "Folder tabs headers extra"
|
||
msgstr "Glave zavihkov map"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
||
msgid "When restoring tab, existing tabs to keep:"
|
||
msgstr "Ob obnavljanju zavihkov obdrži tudi:"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
||
msgid "Tabs saved on left will be restored to:"
|
||
msgstr "Zavihki, shranjeni na levi, bodo obnovljeni na:"
|
||
|
||
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
||
msgid "Tabs saved on right will be restored to:"
|
||
msgstr "Zavihki, shranjeni na desni, bodo obnovljeni na:"
|
||
|
||
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
||
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "S priljubljenimi zavihki se shranjuje tudi zgodovina map:"
|
||
|
||
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
||
msgid "Default position in menu when saving a new Favorite Tabs:"
|
||
msgstr "Privzet položaj v meniju med shranjevanjem:"
|
||
|
||
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
||
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "{command} bi moral biti izpisan na tem mestu za ukaz, ki bo zagnan v terminalu"
|
||
|
||
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
||
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "{command} bi moral biti izpisan na tem mestu za ukaz, ki bo zagnan v terminalu"
|
||
|
||
#: tfrmoptionsterminal.edruntermparams.hint
|
||
msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT"
|
||
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
||
msgstr "{command} bi moral biti izpisan na tem mestu za ukaz, ki bo zagnan v terminalu"
|
||
|
||
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
||
msgid "Command for just running terminal:"
|
||
msgstr "Ukaz za zagon terminala:"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
||
msgid "Command for running a command in terminal and close after:"
|
||
msgstr "Ukaz za izvedbo zaključenega ukaza v terminalu"
|
||
|
||
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
||
msgid "Command for running a command in terminal and stay open:"
|
||
msgstr "Ukaz za izvedbo ukaza v oknu terminala, ki naj ostane odprto"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION"
|
||
msgid "Command:"
|
||
msgstr "Ukaz:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION"
|
||
msgid "Parameters:"
|
||
msgstr "Parametri:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION"
|
||
msgid "Command:"
|
||
msgstr "Ukaz:"
|
||
|
||
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION"
|
||
msgid "Parameters:"
|
||
msgstr "Parametri:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermcmd.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION"
|
||
msgid "Command:"
|
||
msgstr "Ukaz:"
|
||
|
||
#: tfrmoptionsterminal.lbruntermparams.caption
|
||
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION"
|
||
msgid "Parameters:"
|
||
msgstr "Parametri:"
|
||
|
||
#: tfrmoptionstoolbar.btnclonebutton.caption
|
||
msgid "C&lone button"
|
||
msgstr "Gumb za &kloniranje"
|
||
|
||
#: tfrmoptionstoolbar.btndeletebutton.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
|
||
msgid "&Delete"
|
||
msgstr "&Izbriši"
|
||
|
||
#: tfrmoptionstoolbar.btnedithotkey.caption
|
||
msgid "Edit hot&key"
|
||
msgstr "Uredi hitro &tipko"
|
||
|
||
#: tfrmoptionstoolbar.btninsertbutton.caption
|
||
msgid "&Insert new button"
|
||
msgstr "&Vstavi nov gumb"
|
||
|
||
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
||
msgid "Select"
|
||
msgstr "Izbor"
|
||
|
||
#: tfrmoptionstoolbar.btnopenfile.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnother.caption
|
||
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
||
msgid "Other..."
|
||
msgstr "Drugo ..."
|
||
|
||
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
||
msgid "Remove hotke&y"
|
||
msgstr "Odstrani &hitre tipke"
|
||
|
||
#: tfrmoptionstoolbar.btnstartpath.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
||
msgid "Suggest"
|
||
msgstr "Predlagaj"
|
||
|
||
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
||
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
||
msgstr "Naj program ponudi orodni namig na osnovi vrste gumba, ukaza in parametra"
|
||
|
||
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.CBFLATBUTTONS.CAPTION"
|
||
msgid "&Flat buttons"
|
||
msgstr "&Ploski gumbi"
|
||
|
||
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
||
msgid "Report errors with commands"
|
||
msgstr "Pokaži napake ukazov"
|
||
|
||
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
||
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
||
msgstr "Vnos parametrov ukaza, ki so podani vsak v svoji vrstici. Pritisnite tipko F1 za več pomoči o parametrih."
|
||
|
||
#: tfrmoptionstoolbar.gbgroupbox.caption
|
||
msgid "Appearance"
|
||
msgstr "Videz"
|
||
|
||
#: tfrmoptionstoolbar.lblbarsize.caption
|
||
msgid "&Bar size:"
|
||
msgstr "Velikost orodne &vrstice:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
||
msgid "Comman&d:"
|
||
msgstr "&Ukaz:"
|
||
|
||
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
|
||
msgid "Parameter&s:"
|
||
msgstr "Parametr&i:"
|
||
|
||
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION"
|
||
msgid "Help"
|
||
msgstr "Pomoč"
|
||
|
||
#: tfrmoptionstoolbar.lblhotkey.caption
|
||
msgid "Hot key:"
|
||
msgstr "Hitra tipka:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconfile.caption
|
||
msgid "Ico&n:"
|
||
msgstr "Iko&na:"
|
||
|
||
#: tfrmoptionstoolbar.lbliconsize.caption
|
||
msgid "Icon si&ze:"
|
||
msgstr "Veli&kost ikone:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
||
msgid "Co&mmand:"
|
||
msgstr "&Ukaz:"
|
||
|
||
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
||
msgid "&Parameters:"
|
||
msgstr "&Parametri:"
|
||
|
||
#: tfrmoptionstoolbar.lblstartpath.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.LBLSTARTPATH.CAPTION"
|
||
msgid "Start pat&h:"
|
||
msgstr "Začetna &pot:"
|
||
|
||
#: tfrmoptionstoolbar.lbltooltip.caption
|
||
msgid "&Tooltip:"
|
||
msgstr "&Orodni namig:"
|
||
|
||
#: tfrmoptionstoolbar.miaddallcmds.caption
|
||
msgid "Add toolbar with ALL DC commands"
|
||
msgstr "Dodaj orodno vrstico z VSEMI ukazi DC"
|
||
|
||
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
||
msgid "for an external command"
|
||
msgstr "za zunanji ukaz"
|
||
|
||
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
||
msgid "for an internal command"
|
||
msgstr "za notranji ukaz"
|
||
|
||
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
||
msgid "for a separator"
|
||
msgstr "za ločilnik"
|
||
|
||
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
||
msgid "for a sub-tool bar"
|
||
msgstr "za podrejeno orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.mibackup.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION"
|
||
msgid "Backup..."
|
||
msgstr "Varnostna kopija ..."
|
||
|
||
#: tfrmoptionstoolbar.miexport.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION"
|
||
msgid "Export..."
|
||
msgstr "Izvozi ..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrent.caption
|
||
msgid "Current toolbar..."
|
||
msgstr "Trenutna orodna vrstica ..."
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "v datoteko orodne vrstice (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "v datoteko TC.BAR (ohrani obstoječe)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "v datoteko TC.BAR (izbriši obstoječe)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
|
||
|
||
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator1.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator2.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator3.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexportseparator4.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miexporttop.caption
|
||
msgid "Top toolbar..."
|
||
msgstr "Vrhnja orodna vrstica"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
||
msgid "Save a backup of Toolbar"
|
||
msgstr "Shrani varnostno kopijo orodne vrstice"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
||
msgid "to a Toolbar File (.toolbar)"
|
||
msgstr "v datoteko orodne vrstice (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
||
msgid "to a TC .BAR file (keep existing)"
|
||
msgstr "v datoteko TC.BAR (ohrani obstoječe)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
||
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
||
msgid "to a TC .BAR file (erase existing)"
|
||
msgstr "v datoteko TC.BAR (izbriši obstoječe)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
|
||
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
||
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
|
||
|
||
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
|
||
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
||
msgstr "v datoteko »wincmd.ini« programa TotalCommander (ohrani obstoječe)"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
|
||
msgid "just after current selection"
|
||
msgstr "takoj za trenutno izbiro"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
|
||
msgid "as first element"
|
||
msgstr "kot prvi predmet"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
|
||
msgid "as last element"
|
||
msgstr "kot zadnji predmet"
|
||
|
||
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
|
||
msgid "just prior current selection"
|
||
msgstr "takoj pred trenutno izbiro"
|
||
|
||
#: tfrmoptionstoolbar.miimport.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION"
|
||
msgid "Import..."
|
||
msgstr "Uvozi ..."
|
||
|
||
#: tfrmoptionstoolbar.miimportbackup.caption
|
||
msgid "Restore a backup of Toolbar"
|
||
msgstr "Obnovi varnostno kopijo orodne vrstice"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
|
||
msgid "to add to current toolbar"
|
||
msgstr "za dodajanje na trenutno orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "za dodajanje na novo orodno vrstico na trenutni orodni vrstici"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "za dodajanje nove orodne vrstice na vrhnjo orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
|
||
msgid "to add to top toolbar"
|
||
msgstr "za dodajanje na vrhnjo orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
|
||
msgid "to replace top toolbar"
|
||
msgstr "za zamenjavo vrhnje orodne vrstice"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbar.caption
|
||
msgid "from a Toolbar File (.toolbar)"
|
||
msgstr "iz datoteke orodne vrstice (.toolbar)"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
||
msgid "to add to current toolbar"
|
||
msgstr "za dodajanje na trenutno orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "za dodajanje na novo orodno vrstico na trenutni orodni vrstici"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "za dodajanje na novo orodno vrstico na vrhnji orodni vrstici"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
||
msgid "to add to top toolbar"
|
||
msgstr "za dodajanje na vrhnjo orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
||
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
||
msgid "to replace top toolbar"
|
||
msgstr "za zamenjavo vrhnje orodne vrstice"
|
||
|
||
#: tfrmoptionstoolbar.miimportseparator.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbar.caption
|
||
msgid "from a single TC .BAR file"
|
||
msgstr "iz ene datoteke TC.BAR"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
|
||
msgid "to add to current toolbar"
|
||
msgstr "za dodajanje na trenutno orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "za dodajanje na novo orodno vrstico na trenutni orodni vrstici"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "za dodajanje nove orodne vrstice na vrhnjo orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
|
||
msgid "to add to top toolbar"
|
||
msgstr "za dodajanje na vrhnjo orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION"
|
||
msgid "to replace top toolbar"
|
||
msgstr "za zamenjavo vrhnje orodne vrstice"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcini.caption
|
||
msgid "from \"wincmd.ini\" of TC..."
|
||
msgstr "iz datoteke »wincmd.ini« programa TotalCommander ..."
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
|
||
msgid "to add to current toolbar"
|
||
msgstr "za dodajanje na trenutno orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
|
||
msgid "to add to a new toolbar to current toolbar"
|
||
msgstr "za dodajanje na novo orodno vrstico na trenutni orodni vrstici"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
|
||
msgid "to add to a new toolbar to top toolbar"
|
||
msgstr "za dodajanje nove orodne vrstice na vrhnjo orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
|
||
msgid "to add to top toolbar"
|
||
msgstr "za dodajanje na vrhnjo orodno vrstico"
|
||
|
||
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
|
||
msgid "to replace top toolbar"
|
||
msgstr "za zamenjavo vrhnje orodne vrstice"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
|
||
msgid "just after current selection"
|
||
msgstr "takoj za trenutnim izborom"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
|
||
msgid "as first element"
|
||
msgstr "kot prvi predmet"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
|
||
msgid "as last element"
|
||
msgstr "kot zadnji predmet"
|
||
|
||
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
|
||
msgid "just prior current selection"
|
||
msgstr "takoj pred trenutno izbiro"
|
||
|
||
#: tfrmoptionstoolbar.misearchandreplace.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION"
|
||
msgid "Search and replace..."
|
||
msgstr "Poišči in zamenjaj ..."
|
||
|
||
#: tfrmoptionstoolbar.miseparator1.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator10.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator11.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator13.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator14.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator2.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator6.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator7.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator8.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparator9.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
||
msgid "just after current selection"
|
||
msgstr "takoj za trenutnim izborom"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
||
msgid "as first element"
|
||
msgstr "kot prvi predmet"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
||
msgid "as last element"
|
||
msgstr "kot zadnji predmet"
|
||
|
||
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
||
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
||
msgid "just prior current selection"
|
||
msgstr "takoj pred trenutno izbiro"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
||
msgid "in all of all the above..."
|
||
msgstr "v vseh od vseh zgoraj ..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
||
msgid "in all commands..."
|
||
msgstr "v vseh ukazih ..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
||
msgid "in all icon names..."
|
||
msgstr "v vseh imenih ikon ..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
||
msgid "in all parameters..."
|
||
msgstr "v vseh parametrih ..."
|
||
|
||
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
||
msgid "in all start path..."
|
||
msgstr "v vseh začetnih poteh ..."
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
|
||
msgid "just after current selection"
|
||
msgstr "takoj za trenutnim izborom"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
|
||
msgid "as first element"
|
||
msgstr "kot prvi predmet"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
|
||
msgid "as last element"
|
||
msgstr "kot zadnji predmet"
|
||
|
||
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
||
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
|
||
msgid "just prior current selection"
|
||
msgstr "takoj pred trenutnim izborom"
|
||
|
||
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
||
msgid "Button type"
|
||
msgstr "Vrsta gumba"
|
||
|
||
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
||
msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
||
msgid "&Keep terminal window open after executing program"
|
||
msgstr "Po koncu izvajanja programa ohrani okno terminala &odprto"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
||
msgid "&Execute in terminal"
|
||
msgstr "Izvedi v &terminalu"
|
||
|
||
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
||
msgid "&Use external program"
|
||
msgstr "Uporabi &zunanji program"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
||
msgid "A&dditional parameters"
|
||
msgstr "&Dodatni parametri:"
|
||
|
||
#: tfrmoptionstoolbase.lbltoolspath.caption
|
||
msgid "&Path to program to execute"
|
||
msgstr "&Pot do programa za izvedbo:"
|
||
|
||
#: tfrmoptionstooltips.btnaddfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
|
||
msgid "A&dd"
|
||
msgstr "&Dodaj"
|
||
|
||
#: tfrmoptionstooltips.btnapplyfields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
|
||
msgid "A&pply"
|
||
msgstr "&Uveljavi"
|
||
|
||
#: tfrmoptionstooltips.btndeletefields.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
|
||
msgid "D&elete"
|
||
msgstr "&Izbriši"
|
||
|
||
#: tfrmoptionstooltips.btnfieldslist.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
||
msgid "Template..."
|
||
msgstr "Predloga ..."
|
||
|
||
#: tfrmoptionstooltips.chkshowtooltip.caption
|
||
msgid "&Show tooltip for files in the file panel"
|
||
msgstr "Pokaži orodne &namige za datoteke v oknu"
|
||
|
||
#: tfrmoptionstooltips.gbcustomfields.caption
|
||
msgid "Custom fields by file type"
|
||
msgstr "Polja po meri (glede na vrsto datoteke)"
|
||
|
||
#: tfrmoptionstooltips.lblfieldslist.caption
|
||
msgid "Category &hint:"
|
||
msgstr "&Namig kategorije:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsmask.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
||
msgid "Category &mask:"
|
||
msgstr "&Maska kategorije:"
|
||
|
||
#: tfrmoptionstooltips.lblfieldsname.caption
|
||
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
|
||
msgid "Category &name:"
|
||
msgstr "Ime &kategorije:"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
||
msgid "With double-click on the bar on top of a file panel"
|
||
msgstr "Z dvojnim klikom na vrstico na vrhu datotečnega okna"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
||
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
||
msgid "With the menu and internal command"
|
||
msgstr "za notranji ukaz"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
||
msgid "Double click in tree select and exit"
|
||
msgstr "Dvojni klik miške v izboru drevesa in končaj"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION"
|
||
msgid "With the menu and internal command"
|
||
msgstr "za notranji ukaz"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
||
msgid "With double-click on a tab (if configured for it)"
|
||
msgstr "Z dvojnim klikom na zavihe (če je tako nastavljeno)"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
||
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
||
msgstr "Med uporabi tipkovnih bližnjic, konča okno in se vrne na trenutno izbiro"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
||
msgid "Single mouse click in tree select and exit"
|
||
msgstr "Enojni klik miške v izboru drevesa in končaj"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
||
msgid "Use it for Command Line History"
|
||
msgstr "Uporabi za zgodovino ukazne vrstice"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
||
msgid "Use it for the Dir History"
|
||
msgstr "Uporabi za zgodovino map"
|
||
|
||
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
||
msgid "Use it for the View History (Visited paths for active view)"
|
||
msgstr "Uporabi za zgodovino pogleda (obiskane poti dejavnega okna)"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
||
msgid "Behavior regarding selection:"
|
||
msgstr "Obnašanje glede na izbor:"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
||
msgid "Tree View Menus related options:"
|
||
msgstr "Možnosti, povezane z menijem drevesnega pogleda:"
|
||
|
||
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
||
msgid "Where to use Tree View Menus:"
|
||
msgstr "Kje uporabiti menije drevesnega pogleda:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblnote.caption
|
||
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
||
msgstr "* OPOMBA: Možnosti, kot so upoštevanje velikosti črk, izpuščanje akcentov znakov in podobno, so shranjene in naložene posamično za vsako rabo oziroma sejo."
|
||
|
||
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
||
msgid "With Directory Hotlist:"
|
||
msgstr "Z vročimi mapami:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
||
msgid "With Favorite Tabs:"
|
||
msgstr "S priljubljenimi zavihki:"
|
||
|
||
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
||
msgid "With History:"
|
||
msgstr "Z zgodovino:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
||
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
||
msgid "Use and display keyboard shortcut for choosing items"
|
||
msgstr "Uporabi in pokaži tipkovno bližnjico za izbor predmetov"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
||
msgid "Layout and colors options:"
|
||
msgstr "Razporeditev in možnosti barv:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
||
msgid "Background color:"
|
||
msgstr "Barva ozadja:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
||
msgid "Cursor color:"
|
||
msgstr "Barva kazalke:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
||
msgid "Found text color:"
|
||
msgstr "Barva najdenega besedila:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
||
msgid "Found text under cursor:"
|
||
msgstr "Barva najdenega besedila pod kazalko:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
||
msgid "Normal text color:"
|
||
msgstr "Običajna barva besedila:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
||
msgid "Normal text under cursor:"
|
||
msgstr "Običajna barva ozadja besedila:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
||
msgid "Tree View Menu Preview:"
|
||
msgstr "Predogled menija drevesnega pogleda:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
||
msgid "Secondary text color:"
|
||
msgstr "Drugotna barva besedila:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
||
msgid "Secondary text under cursor:"
|
||
msgstr "Drugotna barva ozadja besedila:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
||
msgid "Shortcut color:"
|
||
msgstr "Barva bližnjice:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
||
msgid "Shortcut under cursor:"
|
||
msgstr "Bližnjica pod kazalko:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
||
msgid "Unselectable text color:"
|
||
msgstr "Barva pisave neizberljivega predmeta:"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
||
msgid "Unselectable under cursor:"
|
||
msgstr "Barva neizberljivega predmeta"
|
||
|
||
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
||
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
||
msgstr "S spreminjanjem barve na levi si je mogoče ogledati, kako bo drevesni pogled menija videti."
|
||
|
||
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
||
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
||
msgid "Viewer Book Mode"
|
||
msgstr "Način bralnega pregledovalnika"
|
||
|
||
#: tfrmoptionsviewer.gbviewerexample.caption
|
||
msgid "Example"
|
||
msgstr "Primer"
|
||
|
||
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
||
msgid "&Background color in book viewer"
|
||
msgstr "Barva &ozadja v bralnem pregledovalniku"
|
||
|
||
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
||
msgid "&Font color in book viewer"
|
||
msgstr "&Barva pisave v bralnem pregledovalniku"
|
||
|
||
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
||
msgid "&Number of columns in book viewer"
|
||
msgstr "&Število stolpcev v bralnem pregledovalniku"
|
||
|
||
#: tfrmpackdlg.btnconfig.caption
|
||
msgctxt "tfrmpackdlg.btnconfig.caption"
|
||
msgid "Con&figure"
|
||
msgstr "&Nastavitve"
|
||
|
||
#: tfrmpackdlg.caption
|
||
msgid "Pack files"
|
||
msgstr "Pakiranje datotek"
|
||
|
||
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
||
msgid "C&reate separate archives, one per selected file/dir"
|
||
msgstr "&Ustvari ločen arhiv za vsako izbrano datoteko oziroma mapo"
|
||
|
||
#: tfrmpackdlg.cbcreatesfx.caption
|
||
msgid "Create self e&xtracting archive"
|
||
msgstr "Ustvari arhiv za samodejno odpakiranje"
|
||
|
||
#: tfrmpackdlg.cbencrypt.caption
|
||
msgid "Encr&ypt"
|
||
msgstr "&Šifriraj arhiv z geslom"
|
||
|
||
#: tfrmpackdlg.cbmovetoarchive.caption
|
||
msgid "Mo&ve to archive"
|
||
msgstr "Pre&makni v arhiv"
|
||
|
||
#: tfrmpackdlg.cbmultivolume.caption
|
||
msgid "&Multiple disk archive"
|
||
msgstr "Ustvari arhiv v več &delih"
|
||
|
||
#: tfrmpackdlg.cbotherplugins.caption
|
||
msgid "=>"
|
||
msgstr "=>"
|
||
|
||
#: tfrmpackdlg.cbputintarfirst.caption
|
||
msgid "P&ut in the TAR archive first"
|
||
msgstr "Najprej &vstavi v arhiv TAR"
|
||
|
||
#: tfrmpackdlg.cbstoredir.caption
|
||
msgid "Also &pack path names (only recursed)"
|
||
msgstr "Zapakiraj tudi imena &poti (le pri več ravneh map)"
|
||
|
||
#: tfrmpackdlg.lblprompt.caption
|
||
msgid "Pack file(s) to the file:"
|
||
msgstr "Zapakiraj datoteke v arhiv:"
|
||
|
||
#: tfrmpackdlg.rgpacker.caption
|
||
msgid "Packer"
|
||
msgstr "Pakirnik"
|
||
|
||
#: tfrmpackinfodlg.btnclose.caption
|
||
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
||
msgid "Unpack &all and execute"
|
||
msgstr "Odpakiraj &vse in izvedi"
|
||
|
||
#: tfrmpackinfodlg.btnunpackandexec.caption
|
||
msgid "&Unpack and execute"
|
||
msgstr "Odpakiraj &in izvedi"
|
||
|
||
#: tfrmpackinfodlg.caption
|
||
msgid "Properties of packed file"
|
||
msgstr "Lastnosti arhiva"
|
||
|
||
#: tfrmpackinfodlg.lblattributes.caption
|
||
msgid "Attributes:"
|
||
msgstr "Atributi:"
|
||
|
||
#: tfrmpackinfodlg.lblcompressionratio.caption
|
||
msgid "Compression ratio:"
|
||
msgstr "Raven stiskanja:"
|
||
|
||
#: tfrmpackinfodlg.lbldate.caption
|
||
msgid "Date:"
|
||
msgstr "Datum:"
|
||
|
||
#: tfrmpackinfodlg.lblmethod.caption
|
||
msgid "Method:"
|
||
msgstr "Način:"
|
||
|
||
#: tfrmpackinfodlg.lbloriginalsize.caption
|
||
msgid "Original size:"
|
||
msgstr "Izvorna velikost:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedfile.caption
|
||
msgid "File:"
|
||
msgstr "Datoteka:"
|
||
|
||
#: tfrmpackinfodlg.lblpackedsize.caption
|
||
msgid "Packed size:"
|
||
msgstr "Arhivirana velikost:"
|
||
|
||
#: tfrmpackinfodlg.lblpacker.caption
|
||
msgid "Packer:"
|
||
msgstr "Pakirnik:"
|
||
|
||
#: tfrmpackinfodlg.lbltime.caption
|
||
msgid "Time:"
|
||
msgstr "Čas:"
|
||
|
||
#: tfrmquicksearch.btncancel.caption
|
||
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
|
||
msgid "X"
|
||
msgstr "X"
|
||
|
||
#: tfrmquicksearch.btncancel.hint
|
||
msgid "Close filter panel"
|
||
msgstr "Zapri okno filtra"
|
||
|
||
#: tfrmquicksearch.edtsearch.hint
|
||
msgid "Enter text to search for or filter by"
|
||
msgstr "Vnos besedila za iskanje ali filtriranje"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.caption
|
||
msgid "Aa"
|
||
msgstr "Aa"
|
||
|
||
#: tfrmquicksearch.sbcasesensitive.hint
|
||
msgid "Case Sensitive"
|
||
msgstr "Razlikuj velikosti črk"
|
||
|
||
#: tfrmquicksearch.sbdirectories.caption
|
||
msgid "D"
|
||
msgstr "M"
|
||
|
||
#: tfrmquicksearch.sbdirectories.hint
|
||
msgctxt "TFRMQUICKSEARCH.SBDIRECTORIES.HINT"
|
||
msgid "Directories"
|
||
msgstr "Mape"
|
||
|
||
#: tfrmquicksearch.sbfiles.caption
|
||
msgid "F"
|
||
msgstr "D"
|
||
|
||
#: tfrmquicksearch.sbfiles.hint
|
||
msgctxt "TFRMQUICKSEARCH.SBFILES.HINT"
|
||
msgid "Files"
|
||
msgstr "Datoteke"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.caption
|
||
msgid "{"
|
||
msgstr "{"
|
||
|
||
#: tfrmquicksearch.sbmatchbeginning.hint
|
||
msgid "Match Beginning"
|
||
msgstr "Poišči na začetku imena"
|
||
|
||
#: tfrmquicksearch.sbmatchending.caption
|
||
msgid "}"
|
||
msgstr "}"
|
||
|
||
#: tfrmquicksearch.sbmatchending.hint
|
||
msgid "Match Ending"
|
||
msgstr "Poišči na koncu imena"
|
||
|
||
#: tfrmquicksearch.tglfilter.caption
|
||
msgid "Filter"
|
||
msgstr "Filter"
|
||
|
||
#: tfrmquicksearch.tglfilter.hint
|
||
msgid "Toggle between search or filter"
|
||
msgstr "Preklop med iskalnim in filtrirnim načinom"
|
||
|
||
#: tfrmsearchplugin.btnadd.caption
|
||
msgid "&More rules"
|
||
msgstr "&Več pravil"
|
||
|
||
#: tfrmsearchplugin.btndelete.caption
|
||
msgid "L&ess rules"
|
||
msgstr "Man%j pravil"
|
||
|
||
#: tfrmsearchplugin.chkuseplugins.caption
|
||
msgid "Use &content plugins, combine with:"
|
||
msgstr "Uporabi &vsebinske vstavke združeno z:"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[0].text
|
||
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
|
||
msgid "Plugin"
|
||
msgstr "Vstavek"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[1].text
|
||
msgid "Field"
|
||
msgstr "Polje"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[2].text
|
||
msgid "Operator"
|
||
msgstr "Operator"
|
||
|
||
#: tfrmsearchplugin.headercontrol.sections[3].text
|
||
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
||
msgid "Value"
|
||
msgstr "Vrednost"
|
||
|
||
#: tfrmsearchplugin.rband.caption
|
||
msgid "&AND (all match)"
|
||
msgstr "&AND (vsi zadetki)"
|
||
|
||
#: tfrmsearchplugin.rbor.caption
|
||
msgid "&OR (any match)"
|
||
msgstr "&OR (vsi zadetki)"
|
||
|
||
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
||
msgid "Cancel"
|
||
msgstr "Prekliči"
|
||
|
||
#: tfrmselecttextrange.btppanel.closebutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
||
msgid "&Close"
|
||
msgstr "&Zapri"
|
||
|
||
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
||
msgid "&Help"
|
||
msgstr "Pomo&č"
|
||
|
||
#: tfrmselecttextrange.btppanel.okbutton.caption
|
||
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "V &redu"
|
||
|
||
#: tfrmselecttextrange.lblselecttext.caption
|
||
msgid "&Select the characters to insert:"
|
||
msgstr "Izbor znakov za &vstavljanje:"
|
||
|
||
#: tfrmsetfileproperties.btncancel.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmsetfileproperties.btnok.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: tfrmsetfileproperties.caption
|
||
msgid "Change attributes"
|
||
msgstr "Spreminjanje atributov"
|
||
|
||
#: tfrmsetfileproperties.cbsgid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
||
msgid "SGID"
|
||
msgstr "SGID"
|
||
|
||
#: tfrmsetfileproperties.cbsticky.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
||
msgid "Sticky"
|
||
msgstr "Lepljivo"
|
||
|
||
#: tfrmsetfileproperties.cbsuid.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
||
msgid "SUID"
|
||
msgstr "SUID"
|
||
|
||
#: tfrmsetfileproperties.chkarchive.caption
|
||
msgid "Archive"
|
||
msgstr "Arhiv"
|
||
|
||
#: tfrmsetfileproperties.chkcreationtime.caption
|
||
msgid "Created:"
|
||
msgstr "Ustvarjeno:"
|
||
|
||
#: tfrmsetfileproperties.chkhidden.caption
|
||
msgid "Hidden"
|
||
msgstr "Skrita datoteka"
|
||
|
||
#: tfrmsetfileproperties.chklastaccesstime.caption
|
||
msgid "Accessed:"
|
||
msgstr "Zadnji dostop:"
|
||
|
||
#: tfrmsetfileproperties.chklastwritetime.caption
|
||
msgid "Modified:"
|
||
msgstr "Spremenjeno:"
|
||
|
||
#: tfrmsetfileproperties.chkreadonly.caption
|
||
msgid "Read only"
|
||
msgstr "Le za branje"
|
||
|
||
#: tfrmsetfileproperties.chkrecursive.caption
|
||
msgid "Including subfolders"
|
||
msgstr "Vključi podrejene mape"
|
||
|
||
#: tfrmsetfileproperties.chksystem.caption
|
||
msgid "System"
|
||
msgstr "Sistemska datoteka"
|
||
|
||
#: tfrmsetfileproperties.gbtimesamp.caption
|
||
msgid "Timestamp properties"
|
||
msgstr "Časovni podatki datotek in map"
|
||
|
||
#: tfrmsetfileproperties.gbunixattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Atributi"
|
||
|
||
#: tfrmsetfileproperties.gbwinattributes.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
||
msgid "Attributes"
|
||
msgstr "Atributi"
|
||
|
||
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
||
msgid "Bits:"
|
||
msgstr "Biti:"
|
||
|
||
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
||
msgid "Group"
|
||
msgstr "Skupina"
|
||
|
||
#: tfrmsetfileproperties.lblattrinfo.caption
|
||
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(sivo polje pomeni nespremenjeno vrednost)"
|
||
|
||
#: tfrmsetfileproperties.lblattrotherstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
||
msgid "Other"
|
||
msgstr "Drugo"
|
||
|
||
#: tfrmsetfileproperties.lblattrownerstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
||
msgid "Owner"
|
||
msgstr "Lastnik"
|
||
|
||
#: tfrmsetfileproperties.lblattrtext.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
||
msgid "-----------"
|
||
msgstr "-----------"
|
||
|
||
#: tfrmsetfileproperties.lblattrtextstr.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
||
msgid "Text:"
|
||
msgstr "Črkovno:"
|
||
|
||
#: tfrmsetfileproperties.lblexec.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
||
msgid "Execute"
|
||
msgstr "Izvedi"
|
||
|
||
#: tfrmsetfileproperties.lblmodeinfo.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION"
|
||
msgid "(gray field means unchanged value)"
|
||
msgstr "(sivo polje pomeni nespremenjeno vrednost)"
|
||
|
||
#: tfrmsetfileproperties.lbloctal.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
||
msgid "Octal:"
|
||
msgstr "Osmiško:"
|
||
|
||
#: tfrmsetfileproperties.lblread.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
||
msgid "Read"
|
||
msgstr "Preberi"
|
||
|
||
#: tfrmsetfileproperties.lblwrite.caption
|
||
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
||
msgid "Write"
|
||
msgstr "Zapiši"
|
||
|
||
#: tfrmsplitter.btncancel.caption
|
||
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmsplitter.btnftchoice.caption
|
||
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
||
msgid "..."
|
||
msgstr "..."
|
||
|
||
#: tfrmsplitter.btnok.caption
|
||
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "V &redu"
|
||
|
||
#: tfrmsplitter.btnrelativeftchoice.hint
|
||
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
|
||
msgid "Some functions to select appropriate path"
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti"
|
||
|
||
#: tfrmsplitter.caption
|
||
msgid "Splitter"
|
||
msgstr "Razdelilnik"
|
||
|
||
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
||
msgid "Require a CRC32 verification file"
|
||
msgstr "Ustvari overitveno datoteko CRC32"
|
||
|
||
#: tfrmsplitter.cmbxsize.text
|
||
msgid "1457664B - 3.5\""
|
||
msgstr "1457664B – 3.5\""
|
||
|
||
#: tfrmsplitter.grbxfile.caption
|
||
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
||
msgid "File name"
|
||
msgstr "Ime datoteke"
|
||
|
||
#: tfrmsplitter.grbxsize.caption
|
||
msgid "Size and number of parts"
|
||
msgstr "Velikost in število delov"
|
||
|
||
#: tfrmsplitter.lbdirtarget.caption
|
||
msgid "Directory &target"
|
||
msgstr "&Ciljna mapa:"
|
||
|
||
#: tfrmsplitter.lbfilesource.caption
|
||
msgid "File &source"
|
||
msgstr "&Vir datoteke:"
|
||
|
||
#: tfrmsplitter.lblnumberparts.caption
|
||
msgid "&Number of parts"
|
||
msgstr "&Število delov"
|
||
|
||
#: tfrmsplitter.rbtnbyte.caption
|
||
msgid "&Bytes"
|
||
msgstr "&Bajti"
|
||
|
||
#: tfrmsplitter.rbtngigab.caption
|
||
msgid "&Gigabytes"
|
||
msgstr "&Gigabajti"
|
||
|
||
#: tfrmsplitter.rbtnkilob.caption
|
||
msgid "&Kilobytes"
|
||
msgstr "&Kilobajti"
|
||
|
||
#: tfrmsplitter.rbtnmegab.caption
|
||
msgid "&Megabytes"
|
||
msgstr "&Megabajti"
|
||
|
||
#: tfrmstartingsplash.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblbuild.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
|
||
msgid "Build"
|
||
msgstr "Izgradnja"
|
||
|
||
#: tfrmstartingsplash.lblfreepascalver.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: tfrmstartingsplash.lbllazarusver.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: tfrmstartingsplash.lbloperatingsystem.caption
|
||
msgid "Operating System"
|
||
msgstr "Operacijski sistem"
|
||
|
||
#: tfrmstartingsplash.lblplatform.caption
|
||
msgid "Platform"
|
||
msgstr "Okolje"
|
||
|
||
#: tfrmstartingsplash.lblrevision.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
|
||
msgid "Revision"
|
||
msgstr "Predelava"
|
||
|
||
#: tfrmstartingsplash.lbltitle.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
|
||
msgid "Double Commander"
|
||
msgstr "Double Commander"
|
||
|
||
#: tfrmstartingsplash.lblversion.caption
|
||
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
|
||
msgid "Version"
|
||
msgstr "Različica"
|
||
|
||
#: tfrmstartingsplash.lblwidgetsetver.caption
|
||
msgid "WidgetsetVer"
|
||
msgstr "Različica gradnika"
|
||
|
||
#: tfrmsymlink.btncancel.caption
|
||
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmsymlink.btnok.caption
|
||
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: tfrmsymlink.caption
|
||
msgid "Create symbolic link"
|
||
msgstr "Ustvarjanje simbolne povezave"
|
||
|
||
#: tfrmsymlink.lblexistingfile.caption
|
||
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
||
msgid "&Destination that the link will point to"
|
||
msgstr "&Pot povezave:"
|
||
|
||
#: tfrmsymlink.lbllinktocreate.caption
|
||
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
||
msgid "&Link name"
|
||
msgstr "Ime &povezave:"
|
||
|
||
#: tfrmsyncdirsdlg.btnclose.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
|
||
msgid "Close"
|
||
msgstr "Zapri"
|
||
|
||
#: tfrmsyncdirsdlg.btncompare.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Primerjaj"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir1.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnseldir2.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
|
||
msgid ">>"
|
||
msgstr ">>"
|
||
|
||
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
||
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
||
msgid "Synchronize"
|
||
msgstr "Uskladi"
|
||
|
||
#: tfrmsyncdirsdlg.caption
|
||
msgid "Synchronize directories"
|
||
msgstr "Usklajevanje map"
|
||
|
||
#: tfrmsyncdirsdlg.cbextfilter.text
|
||
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
|
||
msgid "*.*"
|
||
msgstr "*.*"
|
||
|
||
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
||
msgid "asymmetric"
|
||
msgstr "Nesimetrično"
|
||
|
||
#: tfrmsyncdirsdlg.chkbycontent.caption
|
||
msgid "by content"
|
||
msgstr "Po vsebini"
|
||
|
||
#: tfrmsyncdirsdlg.chkignoredate.caption
|
||
msgid "ignore date"
|
||
msgstr "Prezri datum"
|
||
|
||
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
||
msgid "only selected"
|
||
msgstr "Le izbrano mapo"
|
||
|
||
#: tfrmsyncdirsdlg.chksubdirs.caption
|
||
msgid "Subdirs"
|
||
msgstr "Upoštevaj podmape"
|
||
|
||
#: tfrmsyncdirsdlg.groupbox1.caption
|
||
msgid "Show:"
|
||
msgstr "Pokaži:"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
|
||
msgid "Name"
|
||
msgstr "Ime"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
|
||
msgid "Size"
|
||
msgstr "Velikost"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
|
||
msgid "Date"
|
||
msgstr "Datum"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
||
msgid "<=>"
|
||
msgstr "<=>"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
|
||
msgid "Date"
|
||
msgstr "Datum"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
|
||
msgid "Size"
|
||
msgstr "Velikost"
|
||
|
||
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
|
||
msgid "Name"
|
||
msgstr "Ime"
|
||
|
||
#: tfrmsyncdirsdlg.label1.caption
|
||
msgid "(in main window)"
|
||
msgstr "(v glavnem oknu)"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
|
||
msgid "Compare"
|
||
msgstr "Primerjaj"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
||
msgid "View left"
|
||
msgstr "Poglej na levi"
|
||
|
||
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
||
msgid "View right"
|
||
msgstr "Poglej na desni"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
|
||
msgid "<"
|
||
msgstr "<"
|
||
|
||
#: tfrmsyncdirsdlg.sbcopyright.caption
|
||
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
|
||
msgid ">"
|
||
msgstr ">"
|
||
|
||
#: tfrmsyncdirsdlg.sbduplicates.caption
|
||
msgid "duplicates"
|
||
msgstr "podvojene"
|
||
|
||
#: tfrmsyncdirsdlg.sbequal.caption
|
||
msgid "="
|
||
msgstr "="
|
||
|
||
#: tfrmsyncdirsdlg.sbnotequal.caption
|
||
msgid "!="
|
||
msgstr "!="
|
||
|
||
#: tfrmsyncdirsdlg.sbsingles.caption
|
||
msgid "singles"
|
||
msgstr "posamezne"
|
||
|
||
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
||
msgid "Please press \"Compare\" to start"
|
||
msgstr "Pritisnite gumb »Primerjava« za začetek"
|
||
|
||
#: tfrmsyncdirsperformdlg.caption
|
||
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
|
||
msgid "Synchronize"
|
||
msgstr "Uskladi"
|
||
|
||
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
||
msgid "Confirm overwrites"
|
||
msgstr "Potrdi prepisovanje"
|
||
|
||
#: tfrmtreeviewmenu.caption
|
||
msgctxt "tfrmtreeviewmenu.caption"
|
||
msgid "Tree View Menu"
|
||
msgstr "Meni drevesnega pogleda"
|
||
|
||
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
||
msgid "Select your hot directory:"
|
||
msgstr "Izbor vroče mape:"
|
||
|
||
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
||
msgid "Search is case sensitive"
|
||
msgstr "Iskanje upošteva velikosti črk"
|
||
|
||
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
||
msgid "Full collapse"
|
||
msgstr "Zloži vse ravni"
|
||
|
||
#: tfrmtreeviewmenu.pmifullexpand.caption
|
||
msgid "Full expand"
|
||
msgstr "Razširi vse ravni"
|
||
|
||
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
||
msgid "Search ignore accents and ligatures"
|
||
msgstr "Iskanje ne upošteva naglasov in vezav znakov"
|
||
|
||
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
||
msgid "Search is not case sensitive"
|
||
msgstr "Iskanje ne upošteva velikosti črk"
|
||
|
||
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
||
msgid "Search is strict regarding accents and ligatures"
|
||
msgstr "Iskanje upošteva naglase in vezave znakov"
|
||
|
||
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
||
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
||
msgstr "Ne pokaži vsebine veje »le zato«, ker je iskalni niz najden v imenu veje"
|
||
|
||
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
||
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
||
msgstr "Če je iskalni niz najden v imenu veje, pokaži celotno vejo tudi, če predneti niso skladni"
|
||
|
||
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
||
msgid "Close Tree View Menu"
|
||
msgstr "Zapri meni drevesnega pogleda"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
||
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT"
|
||
msgid "Configuration of Tree View Menu"
|
||
msgstr "Nastavljanje menija drevesnega pogleda"
|
||
|
||
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
||
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT"
|
||
msgid "Configuration of Tree View Menu Colors"
|
||
msgstr "Nastavljanje barv menija drevesnega pogleda"
|
||
|
||
#: tfrmtweakplugin.btnadd.caption
|
||
msgid "A&dd new"
|
||
msgstr "Dodaj n&ovo"
|
||
|
||
#: tfrmtweakplugin.btncancel.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: tfrmtweakplugin.btnchange.caption
|
||
msgid "C&hange"
|
||
msgstr "S&premeni"
|
||
|
||
#: tfrmtweakplugin.btndefault.caption
|
||
msgid "De&fault"
|
||
msgstr "Pri&vzeto"
|
||
|
||
#: tfrmtweakplugin.btnok.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
||
msgid "&OK"
|
||
msgstr "V &redu"
|
||
|
||
#: tfrmtweakplugin.btnremove.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
||
msgid "&Remove"
|
||
msgstr "&Odstrani"
|
||
|
||
#: tfrmtweakplugin.caption
|
||
msgid "Tweak plugin"
|
||
msgstr "Prilagodi vstavek"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
||
msgid "De&tect archive type by content"
|
||
msgstr "Določi vrsto arhiva po &vsebini"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
||
msgid "Can de&lete files"
|
||
msgstr "Dovoljeno je &izbrisati datoteke"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
||
msgid "Supports e&ncryption"
|
||
msgstr "Podpira &šifriranje"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
||
msgid "Sho&w as normal files (hide packer icon)"
|
||
msgstr "Pokaži kot &običajne datoteke (skrij ikono arhiva)"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
||
msgid "Supports pac&king in memory"
|
||
msgstr "Podpira pakiranje datotek v &pomnilniku"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
||
msgid "Can &modify existing archives"
|
||
msgstr "Dovoljeno je &spreminjati obstoječe arhive"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
||
msgid "&Archive can contain multiple files"
|
||
msgstr "Arhiv lahko vsebuje &več datotek"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_new.caption
|
||
msgid "Can create new archi&ves"
|
||
msgstr "Dovoljeno je ustvariti nove ar&hive"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_options.caption
|
||
msgid "S&upports the options dialogbox"
|
||
msgstr "Podpira &pogovorno okno možnosti"
|
||
|
||
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
||
msgid "Allow searchin&g for text in archives"
|
||
msgstr "Dovoli iskanje &besedila v arhivih"
|
||
|
||
#: tfrmtweakplugin.lbldescription.caption
|
||
msgid "&Description:"
|
||
msgstr "&Opis:"
|
||
|
||
#: tfrmtweakplugin.lbldetectstr.caption
|
||
msgid "D&etect string:"
|
||
msgstr "Zaznava &nizov:"
|
||
|
||
#: tfrmtweakplugin.lblextension.caption
|
||
msgid "&Extension:"
|
||
msgstr "Ra&zširitev:"
|
||
|
||
#: tfrmtweakplugin.lblflags.caption
|
||
msgid "Flags:"
|
||
msgstr "Zastavice:"
|
||
|
||
#: tfrmtweakplugin.lblname.caption
|
||
msgctxt "tfrmtweakplugin.lblname.caption"
|
||
msgid "&Name:"
|
||
msgstr "&Ime:"
|
||
|
||
#: tfrmtweakplugin.lblplugin.caption
|
||
msgctxt "tfrmtweakplugin.lblplugin.caption"
|
||
msgid "&Plugin:"
|
||
msgstr "&Vstavek:"
|
||
|
||
#: tfrmtweakplugin.lblplugin1.caption
|
||
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
|
||
msgid "&Plugin:"
|
||
msgstr "&Vstavek:"
|
||
|
||
#: tfrmviewer.actabout.caption
|
||
msgid "About Viewer..."
|
||
msgstr "O pregledovalniku ..."
|
||
|
||
#: tfrmviewer.actabout.hint
|
||
msgid "Displays the About message"
|
||
msgstr "Prikaže pogovorno okno podrobnosti"
|
||
|
||
#: tfrmviewer.actchangeencoding.caption
|
||
msgid "Change encoding"
|
||
msgstr ""
|
||
|
||
#: tfrmviewer.actcopyfile.caption
|
||
msgctxt "tfrmviewer.actcopyfile.caption"
|
||
msgid "Copy File"
|
||
msgstr "Kopiraj datoteko"
|
||
|
||
#: tfrmviewer.actcopyfile.hint
|
||
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
||
msgid "Copy File"
|
||
msgstr "Kopiranje datoteke"
|
||
|
||
#: tfrmviewer.actcopytoclipboard.caption
|
||
msgctxt "TFRMVIEWER.ACTCOPYTOCLIPBOARD.CAPTION"
|
||
msgid "Copy To Clipboard"
|
||
msgstr "Kopiranje v odložišče"
|
||
|
||
#: tfrmviewer.actcopytoclipboardformatted.caption
|
||
msgid "Copy To Clipboard Formatted"
|
||
msgstr "Kopiranje oblikovanega besedila v odložišče"
|
||
|
||
#: tfrmviewer.actdeletefile.caption
|
||
msgctxt "tfrmviewer.actdeletefile.caption"
|
||
msgid "Delete File"
|
||
msgstr "Izbriši datoteko"
|
||
|
||
#: tfrmviewer.actdeletefile.hint
|
||
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
||
msgid "Delete File"
|
||
msgstr "Brisanje datoteke"
|
||
|
||
#: tfrmviewer.actexitviewer.caption
|
||
msgctxt "TFRMVIEWER.ACTEXITVIEWER.CAPTION"
|
||
msgid "E&xit"
|
||
msgstr "&Končaj"
|
||
|
||
#: tfrmviewer.actfind.caption
|
||
msgctxt "TFRMVIEWER.ACTFIND.CAPTION"
|
||
msgid "Find"
|
||
msgstr "Najdi"
|
||
|
||
#: tfrmviewer.actfindnext.caption
|
||
msgctxt "TFRMVIEWER.ACTFINDNEXT.CAPTION"
|
||
msgid "Find next"
|
||
msgstr "Najdi naslednje "
|
||
|
||
#: tfrmviewer.actfindprev.caption
|
||
msgctxt "TFRMVIEWER.ACTFINDPREV.CAPTION"
|
||
msgid "Find previous"
|
||
msgstr "Najdi predhodne"
|
||
|
||
#: tfrmviewer.actfullscreen.caption
|
||
msgctxt "TFRMVIEWER.ACTFULLSCREEN.CAPTION"
|
||
msgid "Full Screen"
|
||
msgstr "Celozaslonski način"
|
||
|
||
#: tfrmviewer.actimagecenter.caption
|
||
msgid "Center"
|
||
msgstr "Sredina"
|
||
|
||
#: tfrmviewer.actloadnextfile.caption
|
||
msgid "&Next"
|
||
msgstr "&Naslednji"
|
||
|
||
#: tfrmviewer.actloadnextfile.hint
|
||
msgid "Load Next File"
|
||
msgstr "Naloži naslednjo datoteko"
|
||
|
||
#: tfrmviewer.actloadprevfile.caption
|
||
msgid "&Previous"
|
||
msgstr "&Predhodna"
|
||
|
||
#: tfrmviewer.actloadprevfile.hint
|
||
msgid "Load Previous File"
|
||
msgstr "Naloži predhodno datoteko"
|
||
|
||
#: tfrmviewer.actmirrorhorz.caption
|
||
msgid "Mirror Horizontally"
|
||
msgstr "Zrcali vodoravno"
|
||
|
||
#: tfrmviewer.actmirrorhorz.hint
|
||
msgid "Mirror"
|
||
msgstr "Zrcaljenje"
|
||
|
||
#: tfrmviewer.actmirrorvert.caption
|
||
msgid "Mirror Vertically"
|
||
msgstr "Zrcali navpično"
|
||
|
||
#: tfrmviewer.actmovefile.caption
|
||
msgctxt "tfrmviewer.actmovefile.caption"
|
||
msgid "Move File"
|
||
msgstr "Premakni datoteko"
|
||
|
||
#: tfrmviewer.actmovefile.hint
|
||
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
||
msgid "Move File"
|
||
msgstr "Premakni datoteko"
|
||
|
||
#: tfrmviewer.actpreview.caption
|
||
msgctxt "tfrmviewer.actpreview.caption"
|
||
msgid "Preview"
|
||
msgstr "Predogled"
|
||
|
||
#: tfrmviewer.actreload.caption
|
||
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
||
msgid "Reload"
|
||
msgstr "Ponovno naloži"
|
||
|
||
#: tfrmviewer.actreload.hint
|
||
msgid "Reload current file"
|
||
msgstr "Ponovno naloži trenutno datoteko"
|
||
|
||
#: tfrmviewer.actrotate180.caption
|
||
msgid "+ 180"
|
||
msgstr "+180"
|
||
|
||
#: tfrmviewer.actrotate180.hint
|
||
msgid "Rotate 180 degrees"
|
||
msgstr "Zavrti za 180 stopinj"
|
||
|
||
#: tfrmviewer.actrotate270.caption
|
||
msgid "- 90"
|
||
msgstr "–90"
|
||
|
||
#: tfrmviewer.actrotate270.hint
|
||
msgid "Rotate -90 degrees"
|
||
msgstr "Zavrti za 90 stopinj v desno"
|
||
|
||
#: tfrmviewer.actrotate90.caption
|
||
msgid "+ 90"
|
||
msgstr "+90"
|
||
|
||
#: tfrmviewer.actrotate90.hint
|
||
msgid "Rotate +90 degrees"
|
||
msgstr "Zavrti za 90 stopinj v levo"
|
||
|
||
#: tfrmviewer.actsave.caption
|
||
msgctxt "TFRMVIEWER.ACTSAVE.CAPTION"
|
||
msgid "Save"
|
||
msgstr "Shrani"
|
||
|
||
#: tfrmviewer.actsaveas.caption
|
||
msgid "Save As..."
|
||
msgstr "Shrani kot ..."
|
||
|
||
#: tfrmviewer.actsaveas.hint
|
||
msgid "Save File As..."
|
||
msgstr "Shrani datoteko kot ..."
|
||
|
||
#: tfrmviewer.actscreenshot.caption
|
||
msgctxt "TFRMVIEWER.ACTSCREENSHOT.CAPTION"
|
||
msgid "Screenshot"
|
||
msgstr "Zaslonska slika"
|
||
|
||
#: tfrmviewer.actscreenshotdelay3sec.caption
|
||
msgid "Delay 3 sec"
|
||
msgstr "Zamakni za 3 sekunde"
|
||
|
||
#: tfrmviewer.actscreenshotdelay5sec.caption
|
||
msgid "Delay 5 sec"
|
||
msgstr "Zamakni za 5 sekund"
|
||
|
||
#: tfrmviewer.actselectall.caption
|
||
msgctxt "TFRMVIEWER.ACTSELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Izberi vse"
|
||
|
||
#: tfrmviewer.actshowasbin.caption
|
||
msgid "Show as &Bin"
|
||
msgstr "Pokaži &dvojiško"
|
||
|
||
#: tfrmviewer.actshowasbook.caption
|
||
msgid "Show as B&ook"
|
||
msgstr "Pokaži v &bralnem pogledu"
|
||
|
||
#: tfrmviewer.actshowasdec.caption
|
||
msgid "Show as &Dec"
|
||
msgstr "Pokaži &desetiško"
|
||
|
||
#: tfrmviewer.actshowashex.caption
|
||
msgid "Show as &Hex"
|
||
msgstr "Pokaži &šestnajstiško"
|
||
|
||
#: tfrmviewer.actshowastext.caption
|
||
msgid "Show as &Text"
|
||
msgstr "Pokaži kot &besedilo"
|
||
|
||
#: tfrmviewer.actshowaswraptext.caption
|
||
msgid "Show as &Wrap text"
|
||
msgstr "Pokaži kot besedilo v &prelomu"
|
||
|
||
#: tfrmviewer.actshowgraphics.caption
|
||
msgid "Graphics"
|
||
msgstr "Grafični prikaz"
|
||
|
||
#: tfrmviewer.actshowplugins.caption
|
||
msgctxt "TFRMVIEWER.ACTSHOWPLUGINS.CAPTION"
|
||
msgid "Plugins"
|
||
msgstr "Vstavki"
|
||
|
||
#: tfrmviewer.actstretchimage.caption
|
||
msgid "Stretch"
|
||
msgstr "Raztegni"
|
||
|
||
#: tfrmviewer.actstretchimage.hint
|
||
msgid "Stretch Image"
|
||
msgstr "Raztegni sliko"
|
||
|
||
#: tfrmviewer.actstretchonlylarge.caption
|
||
msgid "Stretch only large"
|
||
msgstr "Raztegni le velike"
|
||
|
||
#: tfrmviewer.actzoom.caption
|
||
msgid "Zoom"
|
||
msgstr "Približanje"
|
||
|
||
#: tfrmviewer.actzoomin.caption
|
||
msgid "Zoom In"
|
||
msgstr "Približaj"
|
||
|
||
#: tfrmviewer.actzoomout.caption
|
||
msgid "Zoom Out"
|
||
msgstr "Oddalji"
|
||
|
||
#: tfrmviewer.btncopyfile.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmviewer.btncopyfile1.hint
|
||
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
|
||
msgid "Copy"
|
||
msgstr "Kopiraj"
|
||
|
||
#: tfrmviewer.btncuttuimage.hint
|
||
msgid "Crop"
|
||
msgstr "Obreži"
|
||
|
||
#: tfrmviewer.btndeletefile.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmviewer.btndeletefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: tfrmviewer.btnfullscreen.hint
|
||
msgctxt "tfrmviewer.btnfullscreen.hint"
|
||
msgid "Full Screen"
|
||
msgstr "Celozaslonski način"
|
||
|
||
#: tfrmviewer.btngifmove.caption
|
||
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
||
msgid "||"
|
||
msgstr "||"
|
||
|
||
#: tfrmviewer.btngiftobmp.caption
|
||
msgid "S"
|
||
msgstr "S"
|
||
|
||
#: tfrmviewer.btnhightlight.hint
|
||
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
||
msgid "Highlight"
|
||
msgstr "Poudari"
|
||
|
||
#: tfrmviewer.btnmovefile.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
|
||
msgid "Move"
|
||
msgstr "Premakni"
|
||
|
||
#: tfrmviewer.btnmovefile1.hint
|
||
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
|
||
msgid "Move"
|
||
msgstr "Premakni"
|
||
|
||
#: tfrmviewer.btnnextgifframe.caption
|
||
msgid "||>"
|
||
msgstr "||>"
|
||
|
||
#: tfrmviewer.btnpaint.hint
|
||
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
||
msgid "Paint"
|
||
msgstr "Risanje"
|
||
|
||
#: tfrmviewer.btnprevgifframe.caption
|
||
msgid "<||"
|
||
msgstr "<||"
|
||
|
||
#: tfrmviewer.btnredeye.hint
|
||
msgid "Red Eyes"
|
||
msgstr "Rdeče oči"
|
||
|
||
#: tfrmviewer.btnresize.hint
|
||
msgid "Resize"
|
||
msgstr "Spremeni velikost"
|
||
|
||
#: tfrmviewer.btnundo.hint
|
||
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
||
msgid "Undo"
|
||
msgstr "Razveljavi"
|
||
|
||
#: tfrmviewer.caption
|
||
msgctxt "tfrmviewer.caption"
|
||
msgid "Viewer"
|
||
msgstr "Pregledovalnik"
|
||
|
||
#: tfrmviewer.cbslideshow.caption
|
||
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
||
msgid "Slide Show"
|
||
msgstr "Predstavitev"
|
||
|
||
#: tfrmviewer.comboboxpaint.text
|
||
msgid "Pen"
|
||
msgstr "Pisalo"
|
||
|
||
#: tfrmviewer.comboboxwidth.text
|
||
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
||
msgid "1"
|
||
msgstr "1"
|
||
|
||
#: tfrmviewer.gboxhightlight.caption
|
||
msgctxt "tfrmviewer.gboxhightlight.caption"
|
||
msgid "Highlight"
|
||
msgstr "Poudari"
|
||
|
||
#: tfrmviewer.gboxpaint.caption
|
||
msgctxt "tfrmviewer.gboxpaint.caption"
|
||
msgid "Paint"
|
||
msgstr "Risanje"
|
||
|
||
#: tfrmviewer.gboxslideshow.caption
|
||
msgctxt "tfrmviewer.gboxslideshow.caption"
|
||
msgid "Slide Show"
|
||
msgstr "Predstavitev"
|
||
|
||
#: tfrmviewer.gboxview.caption
|
||
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
||
msgid "View"
|
||
msgstr "Pogled"
|
||
|
||
#: tfrmviewer.lblhightlight.caption
|
||
msgid "0x0"
|
||
msgstr "0x0"
|
||
|
||
#: tfrmviewer.miabout.caption
|
||
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
||
msgid "About"
|
||
msgstr "O programu"
|
||
|
||
#: tfrmviewer.midiv1.caption
|
||
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv2.caption
|
||
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv3.caption
|
||
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv4.caption
|
||
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.midiv5.caption
|
||
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miedit.caption
|
||
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
||
msgid "&Edit"
|
||
msgstr "&Uredi"
|
||
|
||
#: tfrmviewer.miencoding.caption
|
||
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
||
msgid "En&coding"
|
||
msgstr "Nabor &znakov"
|
||
|
||
#: tfrmviewer.mifile.caption
|
||
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
||
msgid "&File"
|
||
msgstr "&Datoteka"
|
||
|
||
#: tfrmviewer.miimage.caption
|
||
msgid "&Image"
|
||
msgstr "&Slika"
|
||
|
||
#: tfrmviewer.miprint.caption
|
||
msgid "Print..."
|
||
msgstr "Natisni ..."
|
||
|
||
#: tfrmviewer.mirotate.caption
|
||
msgid "Rotate"
|
||
msgstr "Zavrti"
|
||
|
||
#: tfrmviewer.miscreenshot.caption
|
||
msgctxt "tfrmviewer.miscreenshot.caption"
|
||
msgid "Screenshot"
|
||
msgstr "Zaslonski posnetek"
|
||
|
||
#: tfrmviewer.miseparator.caption
|
||
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: tfrmviewer.miview.caption
|
||
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
||
msgid "&View"
|
||
msgstr "&Pogled"
|
||
|
||
#: tfrmviewer.pmiselectall.caption
|
||
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
||
msgid "Select All"
|
||
msgstr "Izberi vse"
|
||
|
||
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
|
||
msgid "When file exists"
|
||
msgstr "Če datoteka obstaja"
|
||
|
||
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Če datoteka obstaja"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION"
|
||
msgid "Copy d&ate/time"
|
||
msgstr "Kopiraj &datum in čas"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
||
msgid "Work in background (separate connection)"
|
||
msgstr "Pošlji v ozadje (ločena povezava)"
|
||
|
||
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
||
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
||
msgid "When file exists"
|
||
msgstr "Če datoteka že obstaja,"
|
||
|
||
#: uexifreader.rsdatetimeoriginal
|
||
msgid "Date taken"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsimageheight
|
||
#, fuzzy
|
||
msgctxt "uexifreader.rsimageheight"
|
||
msgid "Height"
|
||
msgstr "Višina"
|
||
|
||
#: uexifreader.rsimagewidth
|
||
#, fuzzy
|
||
msgctxt "uexifreader.rsimagewidth"
|
||
msgid "Width"
|
||
msgstr "Širina"
|
||
|
||
#: uexifreader.rsmake
|
||
msgid "Manufacturer"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsmodel
|
||
msgid "Camera model"
|
||
msgstr ""
|
||
|
||
#: uexifreader.rsorientation
|
||
msgid "Orientation"
|
||
msgstr ""
|
||
|
||
#: ulng.msgtrytolocatecrcfile
|
||
msgid ""
|
||
"This file cannot be found and could help to validate final combination of files:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Could you make it available and press \"OK\" when ready,\n"
|
||
"or press \"CANCEL\" to continue without it?\n"
|
||
msgstr ""
|
||
"Datoteke ni mogoče najti, zato ni mogoče overiti končne kombinacije datotek:\n"
|
||
"%s\n"
|
||
"\n"
|
||
"Omogočite dostop do datoteke in pritisnite gumb »V redu«,\n"
|
||
"ali pa pritisnite »Prekliči« in nadaljujte brez nje?\n"
|
||
|
||
#: ulng.rscancelfilter
|
||
msgid "Cancel Quick Filter"
|
||
msgstr "Prekliči hitri filter"
|
||
|
||
#: ulng.rscanceloperation
|
||
msgid "Cancel Current Operation"
|
||
msgstr "Prekliči trenutno opravilo"
|
||
|
||
#: ulng.rscaptionforaskingfilename
|
||
msgid "Enter filename, with extension, for dropped text"
|
||
msgstr "Vpis imena datoteke s pripono za spuščeno besedilo."
|
||
|
||
#: ulng.rscaptionfortextformattoimport
|
||
msgid "Text format to import"
|
||
msgstr "Vrsta zapisa za uvoz"
|
||
|
||
#: ulng.rschecksumverifybroken
|
||
msgid "Broken:"
|
||
msgstr "Okvarjeno:"
|
||
|
||
#: ulng.rschecksumverifygeneral
|
||
msgid "General:"
|
||
msgstr "Splošno:"
|
||
|
||
#: ulng.rschecksumverifymissing
|
||
msgid "Missing:"
|
||
msgstr "Manjkajoče:"
|
||
|
||
#: ulng.rschecksumverifyreaderror
|
||
msgid "Read error:"
|
||
msgstr "Napaka branj:"
|
||
|
||
#: ulng.rschecksumverifysuccess
|
||
msgid "Success:"
|
||
msgstr "Uspešno zaključeno:"
|
||
|
||
#: ulng.rschecksumverifytext
|
||
msgid "Enter checksum and select algorithm:"
|
||
msgstr "Vnos nadzorne vsote in izbira algoritma:"
|
||
|
||
#: ulng.rschecksumverifytitle
|
||
msgid "Verify checksum"
|
||
msgstr "Preverjanje nadzornih vsot"
|
||
|
||
#: ulng.rschecksumverifytotal
|
||
msgid "Total:"
|
||
msgstr "Skupaj:"
|
||
|
||
#: ulng.rsclearfiltersornot
|
||
msgid "Do you want to clear filters for this new search?"
|
||
msgstr "Ali želite počistiti filtre pred novim iskanjem?"
|
||
|
||
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
||
msgid "Clipboard doesn't contain any valid toolbar data."
|
||
msgstr "V odložišču ni veljavnih podatkov orodne vrstice."
|
||
|
||
#: ulng.rscmdcategorylistinorder
|
||
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
||
msgstr "Vse;Dejavno okno;Levo okno;Desno okno;Datotečna opravila;Nastavitve;Omrežje;Razno;Paralelna vrata;Tisk;Označevanje;Varnost;Odložišče;FTP;Navigacija;Pomoč;Okno;Ukazna vrstica;Orodja;Pogled;Uporabnik;Zavihki;Razvrščanje;Beleženje"
|
||
|
||
#: ulng.rscmdkindofsort
|
||
msgid "Legacy sorted;A-Z sorted"
|
||
msgstr "Opuščeno razvrščanje;Abecedno razvrščanje"
|
||
|
||
#: ulng.rscolattr
|
||
msgid "Attr"
|
||
msgstr "Atrib"
|
||
|
||
#: ulng.rscoldate
|
||
msgctxt "ulng.rscoldate"
|
||
msgid "Date"
|
||
msgstr "Datum"
|
||
|
||
#: ulng.rscolext
|
||
msgid "Ext"
|
||
msgstr "Pri"
|
||
|
||
#: ulng.rscolname
|
||
msgctxt "ulng.rscolname"
|
||
msgid "Name"
|
||
msgstr "Ime"
|
||
|
||
#: ulng.rscolsize
|
||
msgctxt "ulng.rscolsize"
|
||
msgid "Size"
|
||
msgstr "Velikost"
|
||
|
||
#: ulng.rsconfcolalign
|
||
msgid "Align"
|
||
msgstr "Poravnava"
|
||
|
||
#: ulng.rsconfcolcaption
|
||
msgid "Caption"
|
||
msgstr "Naslov"
|
||
|
||
#: ulng.rsconfcoldelete
|
||
msgctxt "ulng.rsconfcoldelete"
|
||
msgid "Delete"
|
||
msgstr "Izbriši"
|
||
|
||
#: ulng.rsconfcolfieldcont
|
||
msgid "Field contents"
|
||
msgstr "Vsebina stolpca"
|
||
|
||
#: ulng.rsconfcolmove
|
||
msgctxt "ulng.rsconfcolmove"
|
||
msgid "Move"
|
||
msgstr "Premakni"
|
||
|
||
#: ulng.rsconfcolwidth
|
||
msgctxt "ulng.rsconfcolwidth"
|
||
msgid "Width"
|
||
msgstr "Širina"
|
||
|
||
#: ulng.rsconfcustheader
|
||
msgid "Customize column"
|
||
msgstr "Prilagodi stolpec"
|
||
|
||
#: ulng.rsconfigurationfileassociation
|
||
msgid "Configure file association"
|
||
msgstr "Nastavi programsko vez"
|
||
|
||
#: ulng.rsconfirmexecution
|
||
msgid "Confirming command line and parameters"
|
||
msgstr "Potrjevanje ukazne vrstice in parametrov"
|
||
|
||
#: ulng.rscopynametemplate
|
||
msgid "Copy (%d) %s"
|
||
msgstr "Kopiraj (%d) %s"
|
||
|
||
#: ulng.rsdefaultimporteddctoolbarhint
|
||
msgid "Imported DC toolbar"
|
||
msgstr "Uvožena orodna vrstica DC"
|
||
|
||
#: ulng.rsdefaultimportedtctoolbarhint
|
||
msgid "Imported TC toolbar"
|
||
msgstr "Uvožena orodna vrstica TC"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtext
|
||
msgid "_DroppedText"
|
||
msgstr "_Spuščeno besedilo"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
||
msgid "_DroppedHTMLtext"
|
||
msgstr "_Spuščena koda HTML"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
||
msgid "_DroppedRichtext"
|
||
msgstr "_Spuščeno oblikovano besedilo"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
||
msgid "_DroppedSimpleText"
|
||
msgstr "_Spuščeno neoblikovano besedilo"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
||
msgid "_DroppedUnicodeUTF16text"
|
||
msgstr "_Spuščeno besedilo UTF16"
|
||
|
||
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
||
msgid "_DroppedUnicodeUTF8text"
|
||
msgstr "_Spuščeno besedilo UTF8"
|
||
|
||
#: ulng.rsdiffadds
|
||
msgid " Adds: "
|
||
msgstr "Dodano:"
|
||
|
||
#: ulng.rsdiffdeletes
|
||
msgid " Deletes: "
|
||
msgstr "Za izbris:"
|
||
|
||
#: ulng.rsdifffilesidentical
|
||
msgid "The two files are identical!"
|
||
msgstr "Datoteki sta enaki!"
|
||
|
||
#: ulng.rsdiffmatches
|
||
msgid " Matches: "
|
||
msgstr "Število razlik:"
|
||
|
||
#: ulng.rsdiffmodifies
|
||
msgid " Modifies: "
|
||
msgstr " Spremenjeno:"
|
||
|
||
#: ulng.rsdlgbuttonabort
|
||
msgid "Ab&ort"
|
||
msgstr "&Prekini"
|
||
|
||
#: ulng.rsdlgbuttonall
|
||
msgctxt "ulng.rsdlgbuttonall"
|
||
msgid "A&ll"
|
||
msgstr "&Vse"
|
||
|
||
#: ulng.rsdlgbuttonappend
|
||
msgid "A&ppend"
|
||
msgstr "&Pripni"
|
||
|
||
#: ulng.rsdlgbuttonautorenamesource
|
||
msgid "A&uto-rename source files"
|
||
msgstr "&Samodejno preimenuj izvorne datoteke"
|
||
|
||
#: ulng.rsdlgbuttoncancel
|
||
msgctxt "ulng.rsdlgbuttoncancel"
|
||
msgid "&Cancel"
|
||
msgstr "&Prekliči"
|
||
|
||
#: ulng.rsdlgbuttoncontinue
|
||
msgid "&Continue"
|
||
msgstr "&Nadaljuj"
|
||
|
||
#: ulng.rsdlgbuttoncopyinto
|
||
msgid "&Merge"
|
||
msgstr "Kopiraj &v"
|
||
|
||
#: ulng.rsdlgbuttoncopyintoall
|
||
msgid "Mer&ge All"
|
||
msgstr "Kopiraj v &vse"
|
||
|
||
#: ulng.rsdlgbuttonexitprogram
|
||
msgid "E&xit program"
|
||
msgstr "&Končaj program"
|
||
|
||
#: ulng.rsdlgbuttonignore
|
||
msgid "Ig&nore"
|
||
msgstr "Pre&zri"
|
||
|
||
#: ulng.rsdlgbuttonignoreall
|
||
msgid "I&gnore All"
|
||
msgstr "Izberi &vse"
|
||
|
||
#: ulng.rsdlgbuttonno
|
||
msgid "&No"
|
||
msgstr "&Ne"
|
||
|
||
#: ulng.rsdlgbuttonnone
|
||
msgid "Non&e"
|
||
msgstr "&Brez"
|
||
|
||
#: ulng.rsdlgbuttonok
|
||
msgctxt "ulng.rsdlgbuttonok"
|
||
msgid "&OK"
|
||
msgstr "&V redu"
|
||
|
||
#: ulng.rsdlgbuttonother
|
||
msgid "Ot&her"
|
||
msgstr "&Drugo"
|
||
|
||
#: ulng.rsdlgbuttonoverwrite
|
||
msgid "&Overwrite"
|
||
msgstr "&Prepiši"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteall
|
||
msgid "Overwrite &All"
|
||
msgstr "Prepiši &vse"
|
||
|
||
#: ulng.rsdlgbuttonoverwritelarger
|
||
msgid "Overwrite All &Larger"
|
||
msgstr "Prepiši vse &večje"
|
||
|
||
#: ulng.rsdlgbuttonoverwriteolder
|
||
msgid "Overwrite All Ol&der"
|
||
msgstr "Prepiši vse &starejše"
|
||
|
||
#: ulng.rsdlgbuttonoverwritesmaller
|
||
msgid "Overwrite All S&maller"
|
||
msgstr "Prepiši vse &manjše"
|
||
|
||
#: ulng.rsdlgbuttonrename
|
||
msgctxt "ulng.rsdlgbuttonrename"
|
||
msgid "R&ename"
|
||
msgstr "&Preimenuj"
|
||
|
||
#: ulng.rsdlgbuttonresume
|
||
msgid "&Resume"
|
||
msgstr "&Nadaljuj"
|
||
|
||
#: ulng.rsdlgbuttonretry
|
||
msgid "Re&try"
|
||
msgstr "Poskusi &znova"
|
||
|
||
#: ulng.rsdlgbuttonretryadmin
|
||
msgid "As Ad&ministrator"
|
||
msgstr ""
|
||
|
||
#: ulng.rsdlgbuttonskip
|
||
msgid "&Skip"
|
||
msgstr "&Preskoči"
|
||
|
||
#: ulng.rsdlgbuttonskipall
|
||
msgid "S&kip All"
|
||
msgstr "Pres&koči vse"
|
||
|
||
#: ulng.rsdlgbuttonyes
|
||
msgid "&Yes"
|
||
msgstr "&Da"
|
||
|
||
#: ulng.rsdlgcp
|
||
msgctxt "ulng.rsdlgcp"
|
||
msgid "Copy file(s)"
|
||
msgstr "Kopiraj datoteke"
|
||
|
||
#: ulng.rsdlgmv
|
||
msgid "Move file(s)"
|
||
msgstr "Premakni datoteke"
|
||
|
||
#: ulng.rsdlgoppause
|
||
msgid "Pau&se"
|
||
msgstr "Pre&mor"
|
||
|
||
#: ulng.rsdlgopstart
|
||
msgctxt "ulng.rsdlgopstart"
|
||
msgid "&Start"
|
||
msgstr "&Začni"
|
||
|
||
#: ulng.rsdlgqueue
|
||
msgid "Queue"
|
||
msgstr "V vrsto"
|
||
|
||
#: ulng.rsdlgspeed
|
||
msgid "Speed %s/s"
|
||
msgstr "Hitrost %s/s"
|
||
|
||
#: ulng.rsdlgspeedtime
|
||
msgid "Speed %s/s, time remaining %s"
|
||
msgstr "Pri hitrosti %s/s bo opravilo trajalo še %s"
|
||
|
||
#: ulng.rsdraganddroptextformat
|
||
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
||
msgstr "obogateno besedilo;zapis HTML;zapis v naboru Unikod;običajno besedilo"
|
||
|
||
#: ulng.rsdrivenolabel
|
||
msgid "<no label>"
|
||
msgstr "<brez oznake>"
|
||
|
||
#: ulng.rsdrivenomedia
|
||
msgid "<no media>"
|
||
msgstr "<ni nosilca>"
|
||
|
||
#: ulng.rseditabouttext
|
||
msgid "Internal Editor of Double Commander."
|
||
msgstr "Urejevalnik besedila programa Double Commander"
|
||
|
||
#: ulng.rseditgotolinequery
|
||
msgid "Goto line:"
|
||
msgstr "Skoči v vrstico:"
|
||
|
||
#: ulng.rseditgotolinetitle
|
||
msgid "Goto Line"
|
||
msgstr "Skoči v vrstico"
|
||
|
||
#: ulng.rseditnewfile
|
||
msgid "new.txt"
|
||
msgstr "nova_datoteka.txt"
|
||
|
||
#: ulng.rseditnewfilename
|
||
msgid "Filename:"
|
||
msgstr "Ime datoteke:"
|
||
|
||
#: ulng.rseditnewopen
|
||
msgid "Open file"
|
||
msgstr "Odpri datoteko"
|
||
|
||
#: ulng.rseditsearchback
|
||
msgid "&Backward"
|
||
msgstr "&Nazaj"
|
||
|
||
#: ulng.rseditsearchcaption
|
||
msgid "Search"
|
||
msgstr "Poišči"
|
||
|
||
#: ulng.rseditsearchfrw
|
||
msgid "&Forward"
|
||
msgstr "&Naprej"
|
||
|
||
#: ulng.rseditsearchreplace
|
||
msgctxt "ulng.rseditsearchreplace"
|
||
msgid "Replace"
|
||
msgstr "Zamenjaj"
|
||
|
||
#: ulng.rseditwithexternaleditor
|
||
msgid "with external editor"
|
||
msgstr "z zunanjim urejevalnikom"
|
||
|
||
#: ulng.rseditwithinternaleditor
|
||
msgid "with internal editor"
|
||
msgstr "z notranjim urejevalnikom"
|
||
|
||
#: ulng.rsexecuteviashell
|
||
msgctxt "ulng.rsexecuteviashell"
|
||
msgid "Execute via shell"
|
||
msgstr "Izvedi prek lupine"
|
||
|
||
#: ulng.rsexecuteviaterminalclose
|
||
msgctxt "ulng.rsexecuteviaterminalclose"
|
||
msgid "Execute via terminal and close"
|
||
msgstr "Izvedi v terminalu in zapri okno"
|
||
|
||
#: ulng.rsexecuteviaterminalstayopen
|
||
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
||
msgid "Execute via terminal and stay open"
|
||
msgstr "Izvedi v terminalu in pusti okno odprto"
|
||
|
||
#: ulng.rsfavtabspanelsideselection
|
||
msgid "Left;Right;Active;Inactive;Both;None"
|
||
msgstr "levo;desno;dejavno;nedejavno;oboje;brez"
|
||
|
||
#: ulng.rsfavtabssavedirhistory
|
||
msgid "No;Yes"
|
||
msgstr "Da;Ne"
|
||
|
||
#: ulng.rsfilenameexportedtcbarprefix
|
||
msgid "Exported_from_DC"
|
||
msgstr "Izvozi iz DC"
|
||
|
||
#: ulng.rsfileopdirectoryexistsoptions
|
||
msgid "Ask;Merge;Skip"
|
||
msgstr "vprašaj;združi;preskoči"
|
||
|
||
#: ulng.rsfileopfileexistsoptions
|
||
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
||
msgstr "Vprašaj;Prepiši;Prepiši starejše;Preskoči"
|
||
|
||
#: ulng.rsfileopsetpropertyerroroptions
|
||
msgid "Ask;Don't set anymore;Ignore errors"
|
||
msgstr "vprašaj;ne nastavljaj več;prezri napake"
|
||
|
||
#: ulng.rsfilterstatus
|
||
msgid "FILTER"
|
||
msgstr "Filter"
|
||
|
||
#: ulng.rsfinddefinetemplate
|
||
msgid "Define template"
|
||
msgstr "Določitev predloge"
|
||
|
||
#: ulng.rsfinddepth
|
||
msgid "%s level(s)"
|
||
msgstr "do %s. ravni map"
|
||
|
||
#: ulng.rsfinddepthall
|
||
msgid "all (unlimited depth)"
|
||
msgstr "vse ravni (neomejena globina)"
|
||
|
||
#: ulng.rsfinddepthcurdir
|
||
msgid "current dir only"
|
||
msgstr "le trenutno raven"
|
||
|
||
#: ulng.rsfinddirnoex
|
||
msgid "Directory %s does not exist!"
|
||
msgstr "Mapa %s ne obstaja!"
|
||
|
||
#: ulng.rsfindfound
|
||
msgid "Found: %d"
|
||
msgstr "Najdeno: %d"
|
||
|
||
#: ulng.rsfindsavetemplatecaption
|
||
msgid "Save search template"
|
||
msgstr "Shrani predlogo iskanja"
|
||
|
||
#: ulng.rsfindsavetemplatetitle
|
||
msgid "Template name:"
|
||
msgstr "Ime predloge:"
|
||
|
||
#: ulng.rsfindscanned
|
||
msgid "Scanned: %d"
|
||
msgstr "Preiskano: %d"
|
||
|
||
#: ulng.rsfindscanning
|
||
msgid "Scanning"
|
||
msgstr "Preiskovanje"
|
||
|
||
#: ulng.rsfindsearchfiles
|
||
msgctxt "ulng.rsfindsearchfiles"
|
||
msgid "Find files"
|
||
msgstr "Iskanje datotek"
|
||
|
||
#: ulng.rsfindtimeofscan
|
||
msgid "Time of scan: "
|
||
msgstr "Čas preiskovanja:"
|
||
|
||
#: ulng.rsfindwherebeg
|
||
msgid "Begin at"
|
||
msgstr "Začni pri"
|
||
|
||
#: ulng.rsfreemsg
|
||
msgid "Free %s from %s bytes"
|
||
msgstr "Sprosti %s od %s bajtov"
|
||
|
||
#: ulng.rsfreemsgshort
|
||
msgid "%s bytes free"
|
||
msgstr "%sB prostora"
|
||
|
||
#: ulng.rsfuncatime
|
||
msgid "Access date/time"
|
||
msgstr "Datum in čas zadnjega dostopa"
|
||
|
||
#: ulng.rsfuncattr
|
||
msgctxt "ulng.rsfuncattr"
|
||
msgid "Attributes"
|
||
msgstr "Atributi"
|
||
|
||
#: ulng.rsfunccomment
|
||
msgid "Comment"
|
||
msgstr "Opomba"
|
||
|
||
#: ulng.rsfunccompressedsize
|
||
msgid "Compressed size"
|
||
msgstr "Stisnjena velikost"
|
||
|
||
#: ulng.rsfuncctime
|
||
msgid "Creation date/time"
|
||
msgstr "Datum in čas ustvarjanja"
|
||
|
||
#: ulng.rsfuncext
|
||
msgid "Extension"
|
||
msgstr "Pripona"
|
||
|
||
#: ulng.rsfuncgroup
|
||
msgctxt "ulng.rsfuncgroup"
|
||
msgid "Group"
|
||
msgstr "Skupina"
|
||
|
||
#: ulng.rsfunchtime
|
||
msgid "Change date/time"
|
||
msgstr "Spremeni čas in datum"
|
||
|
||
#: ulng.rsfunclinkto
|
||
msgid "Link to"
|
||
msgstr "Povezava do"
|
||
|
||
#: ulng.rsfuncmtime
|
||
msgid "Modification date/time"
|
||
msgstr "Datum in čas spremembe"
|
||
|
||
#: ulng.rsfuncname
|
||
msgctxt "ulng.rsfuncname"
|
||
msgid "Name"
|
||
msgstr "Ime"
|
||
|
||
#: ulng.rsfuncnamenoext
|
||
msgid "Name without extension"
|
||
msgstr "Ime brez pripone"
|
||
|
||
#: ulng.rsfuncowner
|
||
msgctxt "ulng.rsfuncowner"
|
||
msgid "Owner"
|
||
msgstr "Lastnik"
|
||
|
||
#: ulng.rsfuncpath
|
||
msgctxt "ulng.rsfuncpath"
|
||
msgid "Path"
|
||
msgstr "Pot"
|
||
|
||
#: ulng.rsfuncsize
|
||
msgctxt "ulng.rsfuncsize"
|
||
msgid "Size"
|
||
msgstr "Velikost"
|
||
|
||
#: ulng.rsfunctype
|
||
msgid "Type"
|
||
msgstr "Vrsta"
|
||
|
||
#: ulng.rsharderrcreate
|
||
msgid "Error creating hardlink."
|
||
msgstr "Napaka med ustvarjanjem trde povezave."
|
||
|
||
#: ulng.rshotdirforcesortingorderchoices
|
||
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
||
msgstr "brez;ime, a–z;ime, z–a;pripona, a–z;pripona, z–a;velikost 9–0;velikost 0–9;datum 9–0;datum 0–9"
|
||
|
||
#: ulng.rshotdirwarningabortrestorebackup
|
||
msgid ""
|
||
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
||
"\n"
|
||
"Are you sure you want to proceed?\n"
|
||
msgstr ""
|
||
"Opozorilo! Med obnavljanjem datoteke varnostne kopije vročih map *.hotlist se starejša različica izbriše in je ni mogoče več povrniti.\n"
|
||
"\n"
|
||
"Ali ste prepričani, da želite nadaljevati?\n"
|
||
|
||
#: ulng.rshotkeycategorycopymovedialog
|
||
msgid "Copy/Move Dialog"
|
||
msgstr "Pogovorno okno kopiranja in premikanja"
|
||
|
||
#: ulng.rshotkeycategorydiffer
|
||
msgctxt "ulng.rshotkeycategorydiffer"
|
||
msgid "Differ"
|
||
msgstr "Primerjalnik"
|
||
|
||
#: ulng.rshotkeycategoryeditcommentdialog
|
||
msgid "Edit Comment Dialog"
|
||
msgstr "Uredi pogovorno okno opombe"
|
||
|
||
#: ulng.rshotkeycategoryeditor
|
||
msgctxt "ulng.rshotkeycategoryeditor"
|
||
msgid "Editor"
|
||
msgstr "Urejevalnik"
|
||
|
||
#: ulng.rshotkeycategoryfindfiles
|
||
msgctxt "ulng.rshotkeycategoryfindfiles"
|
||
msgid "Find files"
|
||
msgstr "Najdi datoteke"
|
||
|
||
#: ulng.rshotkeycategorymain
|
||
msgid "Main"
|
||
msgstr "Glavno"
|
||
|
||
#: ulng.rshotkeycategoryviewer
|
||
msgctxt "ulng.rshotkeycategoryviewer"
|
||
msgid "Viewer"
|
||
msgstr "Pregledovalnik"
|
||
|
||
#: ulng.rshotkeyfilealreadyexists
|
||
msgid ""
|
||
"A setup with that name already exists.\n"
|
||
"Do you want to overwrite it?\n"
|
||
msgstr ""
|
||
"Namestitev s tem imenom že obstaja.\n"
|
||
"Ali jo želite prepisati?\n"
|
||
|
||
#: ulng.rshotkeyfileconfirmdefault
|
||
msgid "Are you sure you want to restore default?"
|
||
msgstr "Ali ste prepričani, da želite obnoviti privzeto?"
|
||
|
||
#: ulng.rshotkeyfileconfirmerasure
|
||
msgid "Are you sure you want to erase setup \"%s\"?"
|
||
msgstr "Ali ste prepričani, da želite izbrisati namestitev »%s«?"
|
||
|
||
#: ulng.rshotkeyfilecopyof
|
||
msgid "Copy of %s"
|
||
msgstr "Kopija %s"
|
||
|
||
#: ulng.rshotkeyfileinputnewname
|
||
msgid "Input your new name"
|
||
msgstr "Vpis novega imena"
|
||
|
||
#: ulng.rshotkeyfilemustkeepone
|
||
msgid "You must keep at least one shortcut file."
|
||
msgstr "Ohraniti je treba vsak eno datoteko tipkovne bližnjice."
|
||
|
||
#: ulng.rshotkeyfilenewname
|
||
msgid "New name"
|
||
msgstr "Novo ime"
|
||
|
||
#: ulng.rshotkeyfilesavemodified
|
||
msgid ""
|
||
"\"%s\" setup has been modified.\n"
|
||
"Do you want to save it now?\n"
|
||
msgstr ""
|
||
"Nastavitev »%s« je spremenjena.\n"
|
||
"Ali želite spremembe shraniti?\n"
|
||
|
||
#: ulng.rshotkeynoscenter
|
||
msgid "No shortcut with \"ENTER\""
|
||
msgstr "Ni tipkovne bližnjice s tipko »ENTER«"
|
||
|
||
#: ulng.rshotkeysortorder
|
||
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
||
msgstr "po imenu ukaza;po tipkovni bližnjici (skupinjeno);po tipkovni bližnjici (ena na vrstico)"
|
||
|
||
#: ulng.rsimporttoolbarproblem
|
||
msgid "Cannot find reference to default bar file"
|
||
msgstr "Ni mogoče najti sklica na privzeto datoteko orodne vrstice"
|
||
|
||
#: ulng.rslistoffindfileswindows
|
||
msgid "List of \"Find files\" windows"
|
||
msgstr "Seznam oken dejavnih iskanj"
|
||
|
||
#: ulng.rsmarkminus
|
||
msgid "Unselect mask"
|
||
msgstr "Maska odstranitve izbire"
|
||
|
||
#: ulng.rsmarkplus
|
||
msgid "Select mask"
|
||
msgstr "Maska izbire"
|
||
|
||
#: ulng.rsmaskinput
|
||
msgid "Input mask:"
|
||
msgstr "Maska izbire:"
|
||
|
||
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
||
msgid "A columns view with that name already exists."
|
||
msgstr "Stolpčni pogled s tem imenom že obstaja"
|
||
|
||
#: ulng.rsmenuconfigurecolumnssavetochange
|
||
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
||
msgstr "Za spreminjanje trenutnega pogleda urejanja stolpcev, kopirajte, shranite ali pa izbrišite trenutne"
|
||
|
||
#: ulng.rsmenuconfigurecustomcolumns
|
||
msgid "Configure custom columns"
|
||
msgstr "Nastavitve stolpcev po meri"
|
||
|
||
#: ulng.rsmenuconfigureentercustomcolumnname
|
||
msgid "Enter new custom columns name"
|
||
msgstr "Vpis novega imena stolpca po meri"
|
||
|
||
#: ulng.rsmnuactions
|
||
msgctxt "ulng.rsmnuactions"
|
||
msgid "Actions"
|
||
msgstr "Dejanja"
|
||
|
||
#: ulng.rsmnucontentdefault
|
||
msgid "<Default>"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnucontentoctal
|
||
msgid "Octal"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmnucopynetnamestoclip
|
||
msgid "Copy names with UNC path"
|
||
msgstr "Kopiraj imena s potjo UNC"
|
||
|
||
#: ulng.rsmnudisconnectnetworkdrive
|
||
msgid "Disconnect Network Drive..."
|
||
msgstr "Odklopi omrežno pogon ..."
|
||
|
||
#: ulng.rsmnuedit
|
||
msgctxt "ulng.rsmnuedit"
|
||
msgid "Edit"
|
||
msgstr "Uredi"
|
||
|
||
#: ulng.rsmnueject
|
||
msgid "Eject"
|
||
msgstr "Izvrzi"
|
||
|
||
#: ulng.rsmnuextracthere
|
||
msgid "Extract here..."
|
||
msgstr "Odpakiraj v to mapo ..."
|
||
|
||
#: ulng.rsmnumapnetworkdrive
|
||
msgid "Map Network Drive..."
|
||
msgstr "Preslikaj omrežni pogon ..."
|
||
|
||
#: ulng.rsmnumount
|
||
msgid "Mount"
|
||
msgstr "Priklopi"
|
||
|
||
#: ulng.rsmnunew
|
||
msgctxt "ulng.rsmnunew"
|
||
msgid "New"
|
||
msgstr "Novo"
|
||
|
||
#: ulng.rsmnunomedia
|
||
msgid "No media available"
|
||
msgstr "Nosilec ni na voljo"
|
||
|
||
#: ulng.rsmnuopen
|
||
msgctxt "ulng.rsmnuopen"
|
||
msgid "Open"
|
||
msgstr "Odpri"
|
||
|
||
#: ulng.rsmnuopenwith
|
||
msgid "Open with"
|
||
msgstr "Odpri s programom"
|
||
|
||
#: ulng.rsmnuopenwithother
|
||
msgctxt "ulng.rsmnuopenwithother"
|
||
msgid "Other..."
|
||
msgstr "Drugo ..."
|
||
|
||
#: ulng.rsmnupackhere
|
||
msgid "Pack here..."
|
||
msgstr "Zapakiraj datoteke v to mapo ..."
|
||
|
||
#: ulng.rsmnusortby
|
||
msgid "Sort by"
|
||
msgstr "Razvrsti po"
|
||
|
||
#: ulng.rsmnuumount
|
||
msgid "Unmount"
|
||
msgstr "Odklopi"
|
||
|
||
#: ulng.rsmnuview
|
||
msgctxt "ulng.rsmnuview"
|
||
msgid "View"
|
||
msgstr "Poglej"
|
||
|
||
#: ulng.rsmsgaccount
|
||
msgid "Account:"
|
||
msgstr "Račun:"
|
||
|
||
#: ulng.rsmsgalldcintcmds
|
||
msgid "All Double Commander internal commands"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgarchivercustomparams
|
||
msgid "Additional parameters for archiver command-line:"
|
||
msgstr "Dodatni parametri arhiva v ukazni vrstici:"
|
||
|
||
#: ulng.rsmsgaskquoteornot
|
||
msgid "Do you want to enclose between quotes?"
|
||
msgstr "Ali želite niz zapreti z oklepajem?"
|
||
|
||
#: ulng.rsmsgbadcrc32
|
||
msgid ""
|
||
"Bad CRC32 for resulting file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Do you want to keep the resulting corrupted file anyway?\n"
|
||
msgstr ""
|
||
"Napaka nadzorne vsote CRC32 za datoteko:\n"
|
||
"»%s«\n"
|
||
"\n"
|
||
"Ali želite obdržati okvarjeno datoteko?\n"
|
||
|
||
#: ulng.rsmsgcannotcopymoveitself
|
||
msgid "You can not copy/move a file \"%s\" to itself!"
|
||
msgstr "Datoteke »%s« ni mogoče kopirati oziroma premakniti samo vase!"
|
||
|
||
#: ulng.rsmsgcannotdeletedirectory
|
||
msgid "Cannot delete directory %s"
|
||
msgstr "Ni mogoče izbrisati mape %s"
|
||
|
||
#: ulng.rsmsgcannotoverwritedirectory
|
||
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
||
msgstr "Mape »%s« ni mogoče prepisati s predmetom »%s«, ki ni mapa!"
|
||
|
||
#: ulng.rsmsgchdirfailed
|
||
msgid "ChDir to [%s] failed!"
|
||
msgstr "Ukaz chdir v [%s] je spodletel!"
|
||
|
||
#: ulng.rsmsgcloseallinactivetabs
|
||
msgid "Remove all inactive tabs?"
|
||
msgstr "Ali naj se odstranijo vsi nedejavni zavihki?"
|
||
|
||
#: ulng.rsmsgcloselockedtab
|
||
msgid "This tab (%s) is locked! Close anyway?"
|
||
msgstr "Zavihek (%s) je zaklenjen! Ali naj se vseeno zapre?"
|
||
|
||
#: ulng.rsmsgcofirmuserparam
|
||
msgid "Confirmation of parameter"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgconfirmquit
|
||
msgid "Are you sure you want to quit?"
|
||
msgstr "Ali ste prepričani, da želite končati?"
|
||
|
||
#: ulng.rsmsgcopybackward
|
||
msgid "The file %s has changed. Do you want to copy it backward?"
|
||
msgstr "Datoteka %s je spremenjena. Ali želite kopirati vsebino nazaj?"
|
||
|
||
#: ulng.rsmsgcouldnotcopybackward
|
||
msgid "Could not copy backward - do you want to keep the changed file?"
|
||
msgstr "Ni mogoče kopirati nazaj – ali želite ohraniti spremenjeno datoteko?"
|
||
|
||
#: ulng.rsmsgcpfldr
|
||
msgid "Copy %d selected files/directories?"
|
||
msgstr "Ali naj se kopira %d izbranih datotek ali map?"
|
||
|
||
#: ulng.rsmsgcpsel
|
||
msgid "Copy selected \"%s\"?"
|
||
msgstr "Ali naj se »%s« kopira v:"
|
||
|
||
#: ulng.rsmsgcreateanewfiletype
|
||
msgid "< Create a new file type \"%s files\" >"
|
||
msgstr "< Ustvari novo vrsto »datotek %s« >"
|
||
|
||
#: ulng.rsmsgdctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a DC Toolbar file"
|
||
msgstr "Vpis mesta in imena datoteke, kamor naj se shrani datoteka orodne vrstice DC"
|
||
|
||
#: ulng.rsmsgdefaultcustomactionname
|
||
msgid "Custom action"
|
||
msgstr "Dejanje po meri"
|
||
|
||
#: ulng.rsmsgdeletepartiallycopied
|
||
msgid "Delete the partially copied file ?"
|
||
msgstr "Ali naj se delno kopirana datoteka izbriše?"
|
||
|
||
#: ulng.rsmsgdelfldr
|
||
msgid "Delete %d selected files/directories?"
|
||
msgstr "Ali naj se izbrani predmeti izbrišejo (%d predmetov)?"
|
||
|
||
#: ulng.rsmsgdelfldrt
|
||
msgid "Delete %d selected files/directories into trash can?"
|
||
msgstr "Ali naj se izbrani predmeti premaknejo v smeti (%d predmetov)?"
|
||
|
||
#: ulng.rsmsgdelsel
|
||
msgid "Delete selected \"%s\"?"
|
||
msgstr "Ali naj se »%s« izbriše?"
|
||
|
||
#: ulng.rsmsgdelselt
|
||
msgid "Delete selected \"%s\" into trash can?"
|
||
msgstr "Ali naj se »%s« premakne v smeti?"
|
||
|
||
#: ulng.rsmsgdeltotrashforce
|
||
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
||
msgstr "Predmeta »%s« ni mogoče premakniti v smeti. Ali naj se izbriše trajno?"
|
||
|
||
#: ulng.rsmsgdisknotavail
|
||
msgid "Disk is not available"
|
||
msgstr "Disk ni na voljo"
|
||
|
||
#: ulng.rsmsgentercustomaction
|
||
msgid "Enter custom action name:"
|
||
msgstr "Vpis imena dejanja po meri:"
|
||
|
||
#: ulng.rsmsgenterfileext
|
||
msgid "Enter file extension:"
|
||
msgstr "Vpis pripone datoteke:"
|
||
|
||
#: ulng.rsmsgentername
|
||
msgid "Enter name:"
|
||
msgstr "Vnos imena:"
|
||
|
||
#: ulng.rsmsgenternewfiletypename
|
||
msgid "Enter name of new file type to create for extension \"%s\""
|
||
msgstr "Vpis imena nove vrste datotek za razširitev »%s«"
|
||
|
||
#: ulng.rsmsgerrbadarchive
|
||
msgid "CRC error in archive data"
|
||
msgstr "Napaka CRC v podatkih arhiva"
|
||
|
||
#: ulng.rsmsgerrbaddata
|
||
msgid "Data is bad"
|
||
msgstr "Slabi podatki"
|
||
|
||
#: ulng.rsmsgerrcannotconnect
|
||
msgid "Can not connect to server: \"%s\""
|
||
msgstr "Ni se mogoče povezati s strežnikom: »%s«"
|
||
|
||
#: ulng.rsmsgerrcannotcopyfile
|
||
msgid "Cannot copy file %s to %s"
|
||
msgstr "Ni mogoče kopirati datoteke %s v %s"
|
||
|
||
#: ulng.rsmsgerrcreatefiledirectoryexists
|
||
msgid "There already exists a directory named \"%s\"."
|
||
msgstr "Mapa z imenom »%s« že obstaja."
|
||
|
||
#: ulng.rsmsgerrdatenotsupported
|
||
msgid "Date %s is not supported"
|
||
msgstr "Datum %s ni podprt!"
|
||
|
||
#: ulng.rsmsgerrdirexists
|
||
msgid "Directory %s exists!"
|
||
msgstr "Mapa %s že obstaja!"
|
||
|
||
#: ulng.rsmsgerreaborted
|
||
msgid "Function aborted by user"
|
||
msgstr "Ukaz je prekinjen na zahtevo uporabnika"
|
||
|
||
#: ulng.rsmsgerreclose
|
||
msgid "Error closing file"
|
||
msgstr "Napaka med zapiranjem datoteke"
|
||
|
||
#: ulng.rsmsgerrecreate
|
||
msgid "Cannot create file"
|
||
msgstr "Ni mogoče ustvariti datoteke"
|
||
|
||
#: ulng.rsmsgerrendarchive
|
||
msgid "No more files in archive"
|
||
msgstr "V arhivu ni več datotek"
|
||
|
||
#: ulng.rsmsgerreopen
|
||
msgid "Cannot open existing file"
|
||
msgstr "Ni mogoče odpreti obstoječe datoteke"
|
||
|
||
#: ulng.rsmsgerreread
|
||
msgid "Error reading from file"
|
||
msgstr "Napaka med branjem iz datoteke"
|
||
|
||
#: ulng.rsmsgerrewrite
|
||
msgid "Error writing to file"
|
||
msgstr "Napaka med pisanjem v datoteko"
|
||
|
||
#: ulng.rsmsgerrforcedir
|
||
msgid "Can not create directory %s!"
|
||
msgstr "Ni mogoče ustvariti mape %s!"
|
||
|
||
#: ulng.rsmsgerrinvalidlink
|
||
msgid "Invalid link"
|
||
msgstr "Neveljavna povezava"
|
||
|
||
#: ulng.rsmsgerrnofiles
|
||
msgid "No files found"
|
||
msgstr "Ni najdenih datotek"
|
||
|
||
#: ulng.rsmsgerrnomemory
|
||
msgid "Not enough memory"
|
||
msgstr "Ni dovolj pomnilnika"
|
||
|
||
#: ulng.rsmsgerrnotsupported
|
||
msgid "Function not supported!"
|
||
msgstr "Funkcija ni podprta!"
|
||
|
||
#: ulng.rsmsgerrorincontextmenucommand
|
||
msgid "Error in context menu command"
|
||
msgstr "Napaka v ukazu vsebinskega menija"
|
||
|
||
#: ulng.rsmsgerrorloadingconfiguration
|
||
msgid "Error when loading configuration"
|
||
msgstr "Napaka med nalaganjem nastavitev"
|
||
|
||
#: ulng.rsmsgerrregexpsyntax
|
||
msgid "Syntax error in regular expression!"
|
||
msgstr "Napaka skladnje logičnega izraza!"
|
||
|
||
#: ulng.rsmsgerrrename
|
||
msgid "Cannot rename file %s to %s"
|
||
msgstr "Ni mogoče preimenovati datoteke %s v %s"
|
||
|
||
#: ulng.rsmsgerrsaveassociation
|
||
msgid "Can not save association!"
|
||
msgstr "Vezi ni mogoče shraniti!"
|
||
|
||
#: ulng.rsmsgerrsavefile
|
||
msgid "Cannot save file"
|
||
msgstr "Ni mogoče shraniti datoteke"
|
||
|
||
#: ulng.rsmsgerrsetattribute
|
||
msgid "Can not set attributes for \"%s\""
|
||
msgstr "Ni mogoče določiti atributov za »%s«"
|
||
|
||
#: ulng.rsmsgerrsetdatetime
|
||
msgid "Can not set date/time for \"%s\""
|
||
msgstr "Datuma in časa za datoteko »%s« ni mogoče določiti."
|
||
|
||
#: ulng.rsmsgerrsetownership
|
||
msgid "Can not set owner/group for \"%s\""
|
||
msgstr "Ni mogoče določiti lastništva in skupine za »%s«"
|
||
|
||
#: ulng.rsmsgerrsetpermissions
|
||
msgid "Can not set permissions for \"%s\""
|
||
msgstr "Ni mogoče nastaviti dovoljenj za »%s«"
|
||
|
||
#: ulng.rsmsgerrsmallbuf
|
||
msgid "Buffer too small"
|
||
msgstr "Medpomnilnik je premajhen"
|
||
|
||
#: ulng.rsmsgerrtoomanyfiles
|
||
msgid "Too many files to pack"
|
||
msgstr "Izbranih je preveč datotek za pakiranje"
|
||
|
||
#: ulng.rsmsgerrunknownformat
|
||
msgid "Archive format unknown"
|
||
msgstr "Vrsta arhiva ni znana"
|
||
|
||
#: ulng.rsmsgfavoritetabsdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
||
msgstr "Ali ste prepričani, da želite odstraniti vse vnose priljubljenih zavihkov (dejanja ni mogoče povrniti)?"
|
||
|
||
#: ulng.rsmsgfavoritetabsdraghereentry
|
||
msgid "Drag here other entries"
|
||
msgstr "Sem povlecite druge vrednosti"
|
||
|
||
#: ulng.rsmsgfavoritetabsentername
|
||
msgid "Enter a name this Favorite Tabs entry"
|
||
msgstr "Vnos imena novega priljubljenega predmeta"
|
||
|
||
#: ulng.rsmsgfavoritetabsenternametitle
|
||
msgid "Saving a new Favorite Tabs entry"
|
||
msgstr "Shranjevanje novega priljubljenega zavihka"
|
||
|
||
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
||
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
||
msgstr "Uspešno izvoženi priljubljeni zavihki: %d na %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsextramode
|
||
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
||
msgstr "Privzete dodatne nastavitve za shranjevanje zgodovine za nove priljubljene zavihke:"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
||
msgid "Number of file(s) imported successfully: %d on %d"
|
||
msgstr "Uspešno uvožene datoteke: %d na %d"
|
||
|
||
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
||
msgid "Legacy tabs imported"
|
||
msgstr "Opuščeni zavihki so uvoženi"
|
||
|
||
#: ulng.rsmsgfavoritetabsimporttitle
|
||
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
||
msgstr "Izbor datotek .tab za uvoz (izbrati je dovoljeno več kot eno!)"
|
||
|
||
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
||
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
||
msgstr "Zadnje spremembe priljubljenih zavihkov še niso shranjene. Ali jih želite shraniti pred nadaljevanjem?"
|
||
|
||
#: ulng.rsmsgfavoritetabssimplemode
|
||
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
||
msgid "Keep saving dir history with Favorite Tabs:"
|
||
msgstr "Shranjuj zgodovino mape s priljubljenimi zavihki:"
|
||
|
||
#: ulng.rsmsgfavoritetabssubmenuname
|
||
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Ime podrejenega menija"
|
||
|
||
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
||
msgid "This will load the Favorite Tabs: \"%s\""
|
||
msgstr "Naloženi bodo priljubljeni zavihki: »%s«"
|
||
|
||
#: ulng.rsmsgfavortietabssaveoverexisting
|
||
msgid "Save current tabs over existing Favorite Tabs entry"
|
||
msgstr "Shrani trenutne zavihke preko obstoječih priljubljenih zavihkov"
|
||
|
||
#: ulng.rsmsgfilechangedsave
|
||
msgid "File %s changed, save?"
|
||
msgstr "Datoteka %s je spremenjena. Ali naj se spremembe shranijo?"
|
||
|
||
#: ulng.rsmsgfileexistsfileinfo
|
||
msgid "%s bytes, %s"
|
||
msgstr "%s bajtov, %s"
|
||
|
||
#: ulng.rsmsgfileexistsoverwrite
|
||
msgid "Overwrite:"
|
||
msgstr "Prepiši:"
|
||
|
||
#: ulng.rsmsgfileexistsrwrt
|
||
msgid "File %s exists, overwrite?"
|
||
msgstr "Datoteka %s že obstaja. Ali naj bo prepisana?"
|
||
|
||
#: ulng.rsmsgfileexistswithfile
|
||
msgid "With file:"
|
||
msgstr "Z datoteko:"
|
||
|
||
#: ulng.rsmsgfilenotfound
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Datoteke »%s« ni mogoče najti."
|
||
|
||
#: ulng.rsmsgfileoperationsactive
|
||
msgid "File operations active"
|
||
msgstr "Zaznana so dejavna datotečna opravila"
|
||
|
||
#: ulng.rsmsgfileoperationsactivelong
|
||
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
||
msgstr "Nekatera opravila datotek še niso končana. S predčasnim končanjem programa lahko pride do izgube podatkov."
|
||
|
||
#: ulng.rsmsgfilepathovermaxpath
|
||
msgid ""
|
||
"The target name length (%d) is more than %d characters!\n"
|
||
"%s\n"
|
||
"Most programs will not be able to access a file/directory with such a long name!\n"
|
||
msgstr ""
|
||
"Dolžina imena cilja (%d) je več kot %d znakov!\n"
|
||
"%s\n"
|
||
"Mnogi programi imajo lahko težave s tako dolgimi imeni datotek in map!\n"
|
||
|
||
#: ulng.rsmsgfilereadonly
|
||
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
||
msgstr "Datoteka %s je označena skrita, sistemska ali le za branje. Ali naj se vseeno izbriše?"
|
||
|
||
#: ulng.rsmsgfilesizetoobig
|
||
msgid "The file size of \"%s\" is too big for destination file system!"
|
||
msgstr "Datoteka velikosti »%s« je prevelika za ciljni datotečni sistem!"
|
||
|
||
#: ulng.rsmsgfolderexistsrwrt
|
||
msgid "Folder %s exists, merge?"
|
||
msgstr "Mapa %s že obstaja. Ali želite datoteke združiti v to mapo?"
|
||
|
||
#: ulng.rsmsgfollowsymlink
|
||
msgid "Follow symlink \"%s\"?"
|
||
msgstr "Ali naj se sledi simbolni povezavi »%s«?"
|
||
|
||
#: ulng.rsmsgfortextformattoimport
|
||
msgid "Select the text format to import"
|
||
msgstr "Izbor vrste zapisa za uvoz"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectories
|
||
msgid "Add %d selected dirs"
|
||
msgstr "Dodaj %d izbranih map"
|
||
|
||
#: ulng.rsmsghotdiraddselecteddirectory
|
||
msgid "Add selected dir: "
|
||
msgstr "Dodaj izbrano mapo:"
|
||
|
||
#: ulng.rsmsghotdiraddthisdirectory
|
||
msgid "Add current dir: "
|
||
msgstr "Dodaj trenutno mapo:"
|
||
|
||
#: ulng.rsmsghotdircommandname
|
||
msgid "Do command"
|
||
msgstr "Izvedi ukaz"
|
||
|
||
#: ulng.rsmsghotdircommandsample
|
||
msgid "cm_somthing"
|
||
msgstr "cm_nek_ukaz"
|
||
|
||
#: ulng.rsmsghotdirconfighotlist
|
||
msgctxt "ulng.rsmsghotdirconfighotlist"
|
||
msgid "Configuration of Directory Hotlist"
|
||
msgstr "Nastavitev seznama hitrih map"
|
||
|
||
#: ulng.rsmsghotdirdeleteallentries
|
||
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
||
msgstr "Ali ste prepričani, da želite odstraniti vse vnose seznama hitrih map (dejanja ni mogoče povrniti)?"
|
||
|
||
#: ulng.rsmsghotdirdemocommand
|
||
msgid "This will execute the following command:"
|
||
msgstr "Izveden bo naslednji ukaz:"
|
||
|
||
#: ulng.rsmsghotdirdemoname
|
||
msgid "This is hot dir named "
|
||
msgstr "To je hitra mapa z imenom "
|
||
|
||
#: ulng.rsmsghotdirdemopath
|
||
msgid "This will change active frame to the following path:"
|
||
msgstr "S tem bo spremenjeno dejavno okna na pot:"
|
||
|
||
#: ulng.rsmsghotdirdemotarget
|
||
msgid "And inactive frame would change to the following path:"
|
||
msgstr "Nedejavno okno sledi naslednji poti:"
|
||
|
||
#: ulng.rsmsghotdirerrorbackuping
|
||
msgid "Error backuping entries..."
|
||
msgstr "Napaka ustvarjanja varnostne kopije vnosov ..."
|
||
|
||
#: ulng.rsmsghotdirerrorexporting
|
||
msgid "Error exporting entries..."
|
||
msgstr "Napaka med izvažanjem vnosov ..."
|
||
|
||
#: ulng.rsmsghotdirexportall
|
||
msgid "Export all!"
|
||
msgstr "Izvozi vse!"
|
||
|
||
#: ulng.rsmsghotdirexporthotlist
|
||
msgid "Export Directory Hotlist - Select the entries you want to export"
|
||
msgstr "Izvozi seznam hitrih map – izbor vnosov za izvoz"
|
||
|
||
#: ulng.rsmsghotdirexportsel
|
||
msgid "Export selected"
|
||
msgstr "Izvozi izbrano"
|
||
|
||
#: ulng.rsmsghotdirimportall
|
||
msgctxt "ulng.rsmsghotdirimportall"
|
||
msgid "Import all!"
|
||
msgstr "Uvozi vse!"
|
||
|
||
#: ulng.rsmsghotdirimporthotlist
|
||
msgid "Import Directory Hotlist - Select the entries you want to import"
|
||
msgstr "Uvoz seznama hitrih map – izbor vnosov za uvoz"
|
||
|
||
#: ulng.rsmsghotdirimportsel
|
||
msgctxt "ulng.rsmsghotdirimportsel"
|
||
msgid "Import selected"
|
||
msgstr "Uvozi izbrano"
|
||
|
||
#: ulng.rsmsghotdirjustpath
|
||
msgctxt "ulng.rsmsghotdirjustpath"
|
||
msgid "&Path:"
|
||
msgstr "Pot"
|
||
|
||
#: ulng.rsmsghotdirlocatehotlistfile
|
||
msgid "Locate \".hotlist\" file to import"
|
||
msgstr "Najdi datoteko ».hotlist« za uvoz"
|
||
|
||
#: ulng.rsmsghotdirname
|
||
msgid "Hotdir name"
|
||
msgstr "Ime vroče mape"
|
||
|
||
#: ulng.rsmsghotdirnbnewentries
|
||
msgid "Number of new entries: %d"
|
||
msgstr "Število novih vnosov: %d"
|
||
|
||
#: ulng.rsmsghotdirnothingtoexport
|
||
msgid "Nothing selected to export!"
|
||
msgstr "In izbranih predmetov za izvoz!"
|
||
|
||
#: ulng.rsmsghotdirpath
|
||
msgid "Hotdir path"
|
||
msgstr "Pot do vroče mape"
|
||
|
||
#: ulng.rsmsghotdirreaddselecteddirectory
|
||
msgid "Re-Add selected dir: "
|
||
msgstr "Ponovno dodaj izbrano mapo:"
|
||
|
||
#: ulng.rsmsghotdirreaddthisdirectory
|
||
msgid "Re-Add current dir: "
|
||
msgstr "Ponovno dodaj trenutno mapo:"
|
||
|
||
#: ulng.rsmsghotdirrestorewhat
|
||
msgid "Enter location and filename of Directory Hotlist to restore"
|
||
msgstr "Vpis mesta in imena datoteke seznama hitrih map za obnovitev"
|
||
|
||
#: ulng.rsmsghotdirsimplecommand
|
||
msgctxt "ulng.rsmsghotdirsimplecommand"
|
||
msgid "Command:"
|
||
msgstr "Ukaz:"
|
||
|
||
#: ulng.rsmsghotdirsimpleendofmenu
|
||
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
||
msgid "(end of sub menu)"
|
||
msgstr "(konec podrejenega menija)"
|
||
|
||
#: ulng.rsmsghotdirsimplemenu
|
||
msgctxt "ulng.rsmsghotdirsimplemenu"
|
||
msgid "Menu &name:"
|
||
msgstr "Ime menija:"
|
||
|
||
#: ulng.rsmsghotdirsimplename
|
||
msgctxt "ulng.rsmsghotdirsimplename"
|
||
msgid "&Name:"
|
||
msgstr "Ime:"
|
||
|
||
#: ulng.rsmsghotdirsimpleseparator
|
||
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
||
msgid "(separator)"
|
||
msgstr "(ločilnik)"
|
||
|
||
#: ulng.rsmsghotdirsubmenuname
|
||
msgctxt "ulng.rsmsghotdirsubmenuname"
|
||
msgid "Submenu name"
|
||
msgstr "Ime podrejenega menija"
|
||
|
||
#: ulng.rsmsghotdirtarget
|
||
msgid "Hotdir target"
|
||
msgstr "Cilj vroče mape"
|
||
|
||
#: ulng.rsmsghotdirtiporderpath
|
||
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Določilo, ali naj bo dejavno okno razvrščeno na trenuten način tudi po zamenjavi mape"
|
||
|
||
#: ulng.rsmsghotdirtipordertarget
|
||
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
||
msgstr "Določilo, ali naj bo nedejavno okno razvrščeno na trenuten način tudi po zamenjavi mape"
|
||
|
||
#: ulng.rsmsghotdirtipspecialdirbut
|
||
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
||
msgstr "Nekatere funkcije za izbor ustrezne poti; relativne, absolutne, posebne mape ..."
|
||
|
||
#: ulng.rsmsghotdirtotalbackuped
|
||
msgid ""
|
||
"Total entries saved: %d\n"
|
||
"\n"
|
||
"Backup filename: %s\n"
|
||
msgstr ""
|
||
"Skupno shranjenih vnosov: %d\n"
|
||
"\n"
|
||
"Ime datoteke varnostne kopije: %s\n"
|
||
|
||
#: ulng.rsmsghotdirtotalexported
|
||
msgid "Total entries exported: "
|
||
msgstr "Število izvoženih vnosov:"
|
||
|
||
#: ulng.rsmsghotdirwhattodelete
|
||
msgid ""
|
||
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
||
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
||
msgstr ""
|
||
"Ali ste želeli izbrisati vse predmete znotraj podrejenega menija [%s]?\n"
|
||
"Če izberete NE, bodo izbrisani le ločilniki menija, predmeti pa bodo ohranjeni.\n"
|
||
|
||
#: ulng.rsmsghotdirwheretosave
|
||
msgid "Enter location and filename where to save a Directory Hotlist file"
|
||
msgstr "Vpis mesta in imena datoteke, kamor naj se shrani seznam hitrih map"
|
||
|
||
#: ulng.rsmsgincorrectfilelength
|
||
msgid "Incorrect resulting filelength for file : \"%s\""
|
||
msgstr "Nepravilni podatki dolžine datoteke za: »%s«"
|
||
|
||
#: ulng.rsmsginsertnextdisk
|
||
msgid ""
|
||
"Please insert next disk or something similar.\n"
|
||
"\n"
|
||
"It is to allow writing this file:\n"
|
||
"\"%s\"\n"
|
||
"\n"
|
||
"Number of bytes still to write: %d\n"
|
||
msgstr ""
|
||
"Vstavite dodatni disk, ključ oziroma drug pogon.\n"
|
||
"\n"
|
||
"S tem omogočite zapis datoteke:\n"
|
||
"»%s«\n"
|
||
"\n"
|
||
"Zapisati je treba še: %d\n"
|
||
|
||
#: ulng.rsmsginvalidcommandline
|
||
msgid "Error in command line"
|
||
msgstr "Napaka v ukazni vrstici"
|
||
|
||
#: ulng.rsmsginvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Neveljavno ime datoteke"
|
||
|
||
#: ulng.rsmsginvalidformatofconfigurationfile
|
||
msgid "Invalid format of configuration file"
|
||
msgstr "Neveljaven zapis nastavitvene datoteke"
|
||
|
||
#: ulng.rsmsginvalidpath
|
||
msgid "Invalid path"
|
||
msgstr "Neveljavna pot"
|
||
|
||
#: ulng.rsmsginvalidpathlong
|
||
msgid "Path %s contains forbidden characters."
|
||
msgstr "Pot %s vsebuje nedovoljene znake."
|
||
|
||
#: ulng.rsmsginvalidplugin
|
||
msgid "This is not a valid plugin!"
|
||
msgstr "Ta vrsta vstavka ni podprta!"
|
||
|
||
#: ulng.rsmsginvalidpluginarchitecture
|
||
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
||
msgstr "Ta vstavek je izgrajen za različico %s.%s. Z različico %s ne deluje."
|
||
|
||
#: ulng.rsmsginvalidquoting
|
||
msgid "Invalid quoting"
|
||
msgstr "Neveljavno navajanje"
|
||
|
||
#: ulng.rsmsginvalidselection
|
||
msgid "Invalid selection."
|
||
msgstr "Neveljaven izbor datotek"
|
||
|
||
#: ulng.rsmsgloadingfilelist
|
||
msgid "Loading file list..."
|
||
msgstr "Nalaganje seznama datotek ..."
|
||
|
||
#: ulng.rsmsglocatetcconfiguation
|
||
msgid "Locate TC configuration file (wincmd.ini)"
|
||
msgstr "Najdi nastavitveno datoteko programa TotalCommander (wincmd.ini)"
|
||
|
||
#: ulng.rsmsglocatetcexecutable
|
||
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
||
msgstr "Določi pot do izvedljive datoteke TC (totalcmd.exe ali totalcmd64.exe)"
|
||
|
||
#: ulng.rsmsglogcopy
|
||
msgid "Copy file %s"
|
||
msgstr "Kopiraj datoteko %s"
|
||
|
||
#: ulng.rsmsglogdelete
|
||
msgid "Delete file %s"
|
||
msgstr "Izbriši datoteko %s"
|
||
|
||
#: ulng.rsmsglogerror
|
||
msgid "Error: "
|
||
msgstr "Napaka:"
|
||
|
||
#: ulng.rsmsglogextcmdlaunch
|
||
msgid "Launch external"
|
||
msgstr "Zaženi zunanji program"
|
||
|
||
#: ulng.rsmsglogextcmdresult
|
||
msgid "Result external"
|
||
msgstr "Zunanji rezultati"
|
||
|
||
#: ulng.rsmsglogextract
|
||
msgid "Extract file %s"
|
||
msgstr "Razširi datoteko %s"
|
||
|
||
#: ulng.rsmsgloginfo
|
||
msgid "Info: "
|
||
msgstr "Podrobnosti:"
|
||
|
||
#: ulng.rsmsgloglink
|
||
msgid "Create link %s"
|
||
msgstr "Ustvari povezavo %s"
|
||
|
||
#: ulng.rsmsglogmkdir
|
||
msgid "Create directory %s"
|
||
msgstr "Ustvari mapo %s"
|
||
|
||
#: ulng.rsmsglogmove
|
||
msgid "Move file %s"
|
||
msgstr "Premakni datoteko %s"
|
||
|
||
#: ulng.rsmsglogpack
|
||
msgid "Pack to file %s"
|
||
msgstr "Zapakiraj v datoteko %s"
|
||
|
||
#: ulng.rsmsglogrmdir
|
||
msgid "Remove directory %s"
|
||
msgstr "Odstrani mapo %s"
|
||
|
||
#: ulng.rsmsglogsuccess
|
||
msgid "Done: "
|
||
msgstr "Končano:"
|
||
|
||
#: ulng.rsmsglogsymlink
|
||
msgid "Create symlink %s"
|
||
msgstr "Ustvari simbolno povezavo %s"
|
||
|
||
#: ulng.rsmsglogtest
|
||
msgid "Test file integrity %s"
|
||
msgstr "Preizkusi celovitost datoteke %s"
|
||
|
||
#: ulng.rsmsglogwipe
|
||
msgid "Wipe file %s"
|
||
msgstr "Varno izbriši %s"
|
||
|
||
#: ulng.rsmsglogwipedir
|
||
msgid "Wipe directory %s"
|
||
msgstr "Neobnovljivo izbriši mapo %s"
|
||
|
||
#: ulng.rsmsgmasterpassword
|
||
msgid "Master Password"
|
||
msgstr "Glavno geslo"
|
||
|
||
#: ulng.rsmsgmasterpasswordenter
|
||
msgid "Please enter the master password:"
|
||
msgstr "Vnesite glavno geslo:"
|
||
|
||
#: ulng.rsmsgnewfile
|
||
msgid "New file"
|
||
msgstr "Nova datoteka"
|
||
|
||
#: ulng.rsmsgnextvolunpack
|
||
msgid "Next volume will be unpacked"
|
||
msgstr "Odpakiran bo naslednji del arhiva"
|
||
|
||
#: ulng.rsmsgnofiles
|
||
msgid "No files"
|
||
msgstr "Ni datotek"
|
||
|
||
#: ulng.rsmsgnofilesselected
|
||
msgid "No files selected."
|
||
msgstr "Ni izbranih datotek."
|
||
|
||
#: ulng.rsmsgnofreespacecont
|
||
msgid "No enough free space on target drive, Continue?"
|
||
msgstr "Ni dovolj prostora na ciljnem pogonu. Ali naj se opravilo vseeno nadaljuje?"
|
||
|
||
#: ulng.rsmsgnofreespaceretry
|
||
msgid "No enough free space on target drive, Retry?"
|
||
msgstr "Ni dovolj prostora na ciljnem pogonu. Ali naj se prostor ponovno izračuna?"
|
||
|
||
#: ulng.rsmsgnotdelete
|
||
msgid "Can not delete file %s"
|
||
msgstr "Ni mogoče izbrisati datoteke %s"
|
||
|
||
#: ulng.rsmsgnotimplemented
|
||
msgid "Not implemented."
|
||
msgstr "Ni podprto."
|
||
|
||
#: ulng.rsmsgobjectnotexists
|
||
msgid "Object does not exist!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmsgpanelpreview
|
||
msgctxt "ulng.rsmsgpanelpreview"
|
||
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
||
msgstr "Spodaj je okno predogleda. S premikanjem kazalnika in izborom datoteke se pokažejo različne prilagoditve nastavitev."
|
||
|
||
#: ulng.rsmsgpassword
|
||
msgid "Password:"
|
||
msgstr "Geslo:"
|
||
|
||
#: ulng.rsmsgpassworddiff
|
||
msgid "Passwords are different!"
|
||
msgstr "Gesli sta različni!"
|
||
|
||
#: ulng.rsmsgpasswordenter
|
||
msgid "Please enter the password:"
|
||
msgstr "Vnesite geslo:"
|
||
|
||
#: ulng.rsmsgpasswordfirewall
|
||
msgid "Password (Firewall):"
|
||
msgstr "Geslo (požarni zid):"
|
||
|
||
#: ulng.rsmsgpasswordverify
|
||
msgid "Please re-enter the password for verification:"
|
||
msgstr "Ponovno vnesite geslo za overitev:"
|
||
|
||
#: ulng.rsmsgpopuphotdelete
|
||
msgid "&Delete %s"
|
||
msgstr "&Izbriši %s"
|
||
|
||
#: ulng.rsmsgpresetalreadyexists
|
||
msgid "Preset \"%s\" already exists. Overwrite?"
|
||
msgstr "Shranjen predmet »%s« že obstaja. Ali naj se prepiše?"
|
||
|
||
#: ulng.rsmsgproblemexecutingcommand
|
||
msgid "Problem executing command (%s)"
|
||
msgstr "Napaka izvajanja ukaza (%s)"
|
||
|
||
#: ulng.rsmsgpromptaskingfilename
|
||
msgid "Filename for dropped text:"
|
||
msgstr "Ime datoteke za spuščeno besedilo:"
|
||
|
||
#: ulng.rsmsgprovidethisfile
|
||
msgid "Please, make this file available. Retry?"
|
||
msgstr "Ta datoteka mora biti na voljo. Ali želite poskusiti znova?"
|
||
|
||
#: ulng.rsmsgrenamefavtabs
|
||
msgid "Enter new friendly name for this Favorite Tabs"
|
||
msgstr "Vnos imena novega priljubljenega predmeta"
|
||
|
||
#: ulng.rsmsgrenamefavtabsmenu
|
||
msgid "Enter new name for this menu"
|
||
msgstr "Vnos imena tega meni"
|
||
|
||
#: ulng.rsmsgrenfldr
|
||
msgid "Rename/move %d selected files/directories?"
|
||
msgstr "Ali naj se izbrani predmeti preimenujejo oziroma premaknejo (%d predmetov)?"
|
||
|
||
#: ulng.rsmsgrensel
|
||
msgid "Rename/move selected \"%s\"?"
|
||
msgstr "Ali naj se predmet »%s« preimenuje oziroma premakne?"
|
||
|
||
#: ulng.rsmsgrestartforapplychanges
|
||
msgid "Please, restart Double Commander in order to apply changes"
|
||
msgstr "Za uveljavitev sprememb je treba program ponovno zagnati."
|
||
|
||
#: ulng.rsmsgsekectfiletype
|
||
msgid "Select to which file type to add extension \"%s\""
|
||
msgstr "Izberite vrsto datoteke za dodajanje razširitve »%s«"
|
||
|
||
#: ulng.rsmsgselectedinfo
|
||
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
||
msgstr "Izbrano: %s od %s, datoteke: %d od %d, mape: %d od %d"
|
||
|
||
#: ulng.rsmsgselectexecutablefile
|
||
msgid "Select executable file for"
|
||
msgstr "Izbor izvedljive datoteke za"
|
||
|
||
#: ulng.rsmsgselectonlychecksumfiles
|
||
msgid "Please select only checksum files!"
|
||
msgstr "Izbrati je treba le datoteko nadzorne vsote!"
|
||
|
||
#: ulng.rsmsgsellocnextvol
|
||
msgid "Please select location of next volume"
|
||
msgstr "Izberite mesto za naslednji del arhiva"
|
||
|
||
#: ulng.rsmsgsetvolumelabel
|
||
msgid "Set volume label"
|
||
msgstr "Določi oznako dela arhiva"
|
||
|
||
#: ulng.rsmsgspecialdir
|
||
msgid "Special Dirs"
|
||
msgstr "Posebne mape"
|
||
|
||
#: ulng.rsmsgspecialdiraddacti
|
||
msgid "Add path from active frame"
|
||
msgstr "Dodaj pot iz dejavnega okna"
|
||
|
||
#: ulng.rsmsgspecialdiraddnonacti
|
||
msgid "Add path from inactive frame"
|
||
msgstr "Dodaj pot iz nedejavnega okna"
|
||
|
||
#: ulng.rsmsgspecialdirbrowssel
|
||
msgid "Browse and use selected path"
|
||
msgstr "Prebrskaj in uporabi izbrano pot"
|
||
|
||
#: ulng.rsmsgspecialdirenvvar
|
||
msgid "Use environment variable..."
|
||
msgstr "Uporabi okoljske spremenljivke"
|
||
|
||
#: ulng.rsmsgspecialdirgotodc
|
||
msgid "Go to Double Commander special path..."
|
||
msgstr "Programska pot DC ..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoenvvar
|
||
msgid "Go to environment variable..."
|
||
msgstr "Pot do okoljske spremenljivke ..."
|
||
|
||
#: ulng.rsmsgspecialdirgotoother
|
||
msgid "Go to other Windows special folder..."
|
||
msgstr "Uporabi drugo posebno mapo Windows ..."
|
||
|
||
#: ulng.rsmsgspecialdirgototc
|
||
msgid "Go to Windows special folder (TC)..."
|
||
msgstr "Uporabi posebno mapo Windows ..."
|
||
|
||
#: ulng.rsmsgspecialdirmakereltohotdir
|
||
msgid "Make relative to hotdir path"
|
||
msgstr "Pokaži kot relativno pot do vroče mape ..."
|
||
|
||
#: ulng.rsmsgspecialdirmkabso
|
||
msgid "Make path absolute"
|
||
msgstr "Uporabi pot kot absolutno pot"
|
||
|
||
#: ulng.rsmsgspecialdirmkdcrel
|
||
msgid "Make relative to Double Commander special path..."
|
||
msgstr "Pokaži kot relativno pot do posebne poti DC ..."
|
||
|
||
#: ulng.rsmsgspecialdirmkenvrel
|
||
msgid "Make relative to environment variable..."
|
||
msgstr "Pokaži kot relativno pot do okoljske spremenljivke ..."
|
||
|
||
#: ulng.rsmsgspecialdirmktctel
|
||
msgid "Make relative to Windows special folder (TC)..."
|
||
msgstr "Pokaži kot relativno pot do posebne mape Windows (TC) ..."
|
||
|
||
#: ulng.rsmsgspecialdirmkwnrel
|
||
msgid "Make relative to other Windows special folder..."
|
||
msgstr "Pokaži kot relativno pot do posebne mape Windows ..."
|
||
|
||
#: ulng.rsmsgspecialdirusedc
|
||
msgid "Use Double Commander special path..."
|
||
msgstr "Uporabi posebno pot ..."
|
||
|
||
#: ulng.rsmsgspecialdirusehotdir
|
||
msgid "Use hotdir path"
|
||
msgstr "Uporabi pot do vroče mape"
|
||
|
||
#: ulng.rsmsgspecialdiruseother
|
||
msgid "Use other Windows special folder..."
|
||
msgstr "Uporabi drugo posebno mapo Windows ..."
|
||
|
||
#: ulng.rsmsgspecialdirusetc
|
||
msgid "Use Windows special folder (TC)..."
|
||
msgstr "Uporabi posebno mapo Windows ..."
|
||
|
||
#: ulng.rsmsgtabforopeninginnewtab
|
||
msgid "This tab (%s) is locked! Open directory in another tab?"
|
||
msgstr "Zavihek (%s) je zaklenjen! Ali želite odpreti mapo v novem zavihku?"
|
||
|
||
#: ulng.rsmsgtabrenamecaption
|
||
msgid "Rename tab"
|
||
msgstr "Preimenuj zavihek"
|
||
|
||
#: ulng.rsmsgtabrenameprompt
|
||
msgid "New tab name:"
|
||
msgstr "Novo ime zavihka:"
|
||
|
||
#: ulng.rsmsgtargetdir
|
||
msgid "Target path:"
|
||
msgstr "Ciljna pot:"
|
||
|
||
#: ulng.rsmsgtcconfignotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration file:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Napaka: ni mogoče najti nastavitvene datoteke programa Total Commander:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcexecutablenotfound
|
||
msgid ""
|
||
"Error! Cannot find the TC configuration executable:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Napaka: ni mogoče najti izvedbene datoteke programa Total Commander:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtcisrunning
|
||
msgid ""
|
||
"Error! TC is still running but it should be closed for this operation.\n"
|
||
"Close it and press OK or press CANCEL to abort.\n"
|
||
msgstr ""
|
||
"Napaka: program Total Commander je zagnan, kar pa za to dejanje ne sme biti.\n"
|
||
"Zaprite program ali prekličite opravilo\n"
|
||
|
||
#: ulng.rsmsgtctoolbarnotfound
|
||
msgid ""
|
||
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Napaka! Ni mogoče najti žele odvodne mape orodne vrstice TC:\n"
|
||
"%s\n"
|
||
|
||
#: ulng.rsmsgtctoolbarwheretosave
|
||
msgid "Enter location and filename where to save a TC Toolbar file"
|
||
msgstr "Vpis mesta in imena datoteke, kamor naj se shrani datoteka orodne vrstice DC"
|
||
|
||
#: ulng.rsmsgthisisnowinclipboard
|
||
msgid "\"%s\" is now in the clipboard"
|
||
msgstr "Datoteka »%s« je kopirana v odložišče"
|
||
|
||
#: ulng.rsmsgtitleextnotinfiletype
|
||
msgid "Extension of selected file is not in any recognized file types"
|
||
msgstr "Razširitev te datoteke ni med znanimi vrstami datotek"
|
||
|
||
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
||
msgid "Locate \".toolbar\" file to import"
|
||
msgstr "Najdi datoteko »*.toolbars« za uvoz"
|
||
|
||
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
||
msgid "Locate \".BAR\" file to import"
|
||
msgstr "Najdi datoteko »*.bar« za uvoz"
|
||
|
||
#: ulng.rsmsgtoolbarrestorewhat
|
||
msgid "Enter location and filename of Toolbar to restore"
|
||
msgstr "Vpišite mesto in ime datoteke orodne vrstice za obnovitev"
|
||
|
||
#: ulng.rsmsgtoolbarsaved
|
||
msgid ""
|
||
"Saved!\n"
|
||
"Toolbar filename: %s\n"
|
||
msgstr ""
|
||
"Shranjeno.\n"
|
||
"Ime orodne vrstice: %s'\n"
|
||
|
||
#: ulng.rsmsgtoomanyfilesselected
|
||
msgid "Too many files selected."
|
||
msgstr "Izbranih je preveč datotek."
|
||
|
||
#: ulng.rsmsgundeterminednumberoffile
|
||
msgid "Undetermined"
|
||
msgstr "Nedoločeno"
|
||
|
||
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
||
msgid "ERROR: Unexpected Tree View Menu usage!"
|
||
msgstr "NAPAKA: nepričakovana raba menija drevesnega pogleda!"
|
||
|
||
#: ulng.rsmsgurl
|
||
msgid "URL:"
|
||
msgstr "Naslov URL:"
|
||
|
||
#: ulng.rsmsguserdidnotsetextension
|
||
msgid "<NO EXT>"
|
||
msgstr "<brez pripone>"
|
||
|
||
#: ulng.rsmsguserdidnotsetname
|
||
msgid "<NO NAME>"
|
||
msgstr "<brez imena>"
|
||
|
||
#: ulng.rsmsgusername
|
||
msgid "User name:"
|
||
msgstr "Uporabniško ime:"
|
||
|
||
#: ulng.rsmsgusernamefirewall
|
||
msgid "User name (Firewall):"
|
||
msgstr "Uporabniško ime (požarni zid):"
|
||
|
||
#: ulng.rsmsgvolumelabel
|
||
msgid "Volume label:"
|
||
msgstr "Oznaka dela arhiva:"
|
||
|
||
#: ulng.rsmsgvolumesizeenter
|
||
msgid "Please enter the volume size:"
|
||
msgstr "Velikost dela arhiva:"
|
||
|
||
# This should be multiple plural !!!!
|
||
#: ulng.rsmsgwipefldr
|
||
msgid "Wipe %d selected files/directories?"
|
||
msgstr "Ali naj se izbrane datoteke oziroma mape neobnovljivo izbrišejo (%d)?"
|
||
|
||
#: ulng.rsmsgwipesel
|
||
msgid "Wipe selected \"%s\"?"
|
||
msgstr "Ali naj se »%s« neobnovljivo izbriše?"
|
||
|
||
#: ulng.rsmsgwithactionwith
|
||
msgid "with"
|
||
msgstr "z"
|
||
|
||
#: ulng.rsmulrenautorename
|
||
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmulrenfilenamestylelist
|
||
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
||
msgstr "Brez spremembe;VELIKE ČRKE;male črke;Prva črka je velika;Prva Črka Vsake Besede Je Velika;"
|
||
|
||
#: ulng.rsmulrenwarningduplicate
|
||
msgid "Warning, duplicate names!"
|
||
msgstr ""
|
||
|
||
#: ulng.rsmulrenwronglinesnumber
|
||
msgid "File contains wrong number of lines: %d, should be %d!"
|
||
msgstr "Datoteka vsebuje napačno število vrstic; zaznana vrednost je %d, pričakovana pa %d!"
|
||
|
||
#: ulng.rsnewsearchclearfilteroptions
|
||
msgid "Keep;Clear;Prompt"
|
||
msgstr "ohrani;počisti;vprašaj"
|
||
|
||
#: ulng.rsnoequivalentinternalcommand
|
||
msgid "No internal equivalent command"
|
||
msgstr "Ni ustreznega notranjega ukaza"
|
||
|
||
#: ulng.rsnofindfileswindowyet
|
||
msgid "Sorry, no \"Find files\" window yet..."
|
||
msgstr "Ni še začetega okna »iskanja datotek« ..."
|
||
|
||
#: ulng.rsnootherfindfileswindowtoclose
|
||
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
||
msgstr "Ni še drugih oken »iskanja datotek« za zapiranje in sproščanje pomnilnika ..."
|
||
|
||
#: ulng.rsoperaborted
|
||
msgid "Aborted"
|
||
msgstr "Preklicano"
|
||
|
||
#: ulng.rsopercalculatingchecksum
|
||
msgid "Calculating checksum"
|
||
msgstr "Izračunavanje nadzorne vsote"
|
||
|
||
#: ulng.rsopercalculatingchecksumin
|
||
msgid "Calculating checksum in \"%s\""
|
||
msgstr "Izračunavanje nadzorne vsote v »%s«"
|
||
|
||
#: ulng.rsopercalculatingchecksumof
|
||
msgid "Calculating checksum of \"%s\""
|
||
msgstr "Izračunavanje nadzorne vsote »%s«"
|
||
|
||
#: ulng.rsopercalculatingstatictics
|
||
msgid "Calculating"
|
||
msgstr "Preračunavanje"
|
||
|
||
#: ulng.rsopercalculatingstatisticsin
|
||
msgid "Calculating \"%s\""
|
||
msgstr "Preračunavanje »%s«"
|
||
|
||
#: ulng.rsopercombining
|
||
msgid "Joining"
|
||
msgstr "Združevanje"
|
||
|
||
#: ulng.rsopercombiningfromto
|
||
msgid "Joining files in \"%s\" to \"%s\""
|
||
msgstr "Združevanje datotek iz »%s« v »%s«"
|
||
|
||
#: ulng.rsopercopying
|
||
msgid "Copying"
|
||
msgstr "Kopiranje"
|
||
|
||
#: ulng.rsopercopyingfromto
|
||
msgid "Copying from \"%s\" to \"%s\""
|
||
msgstr "Kopiranje iz »%s« v »%s«"
|
||
|
||
#: ulng.rsopercopyingsomethingto
|
||
msgid "Copying \"%s\" to \"%s\""
|
||
msgstr "Kopiranje »%s« v »%s«"
|
||
|
||
#: ulng.rsopercreatingdirectory
|
||
msgid "Creating directory"
|
||
msgstr "Ustvarjanje mape"
|
||
|
||
#: ulng.rsopercreatingsomedirectory
|
||
msgid "Creating directory \"%s\""
|
||
msgstr "Ustvarjanje mape »%s«"
|
||
|
||
#: ulng.rsoperdeleting
|
||
msgid "Deleting"
|
||
msgstr "Brisanje"
|
||
|
||
#: ulng.rsoperdeletingin
|
||
msgid "Deleting in \"%s\""
|
||
msgstr "Brisanje v »%s«"
|
||
|
||
#: ulng.rsoperdeletingsomething
|
||
msgid "Deleting \"%s\""
|
||
msgstr "Brisanje »%s«"
|
||
|
||
#: ulng.rsoperexecuting
|
||
msgid "Executing"
|
||
msgstr "Izvajanje"
|
||
|
||
#: ulng.rsoperexecutingsomething
|
||
msgid "Executing \"%s\""
|
||
msgstr "Izvajanje »%s«"
|
||
|
||
#: ulng.rsoperextracting
|
||
msgid "Extracting"
|
||
msgstr "Poteka odpakiranje"
|
||
|
||
#: ulng.rsoperextractingfromto
|
||
msgid "Extracting from \"%s\" to \"%s\""
|
||
msgstr "Odpakitanje iz »%s« v »%s«"
|
||
|
||
#: ulng.rsoperfinished
|
||
msgid "Finished"
|
||
msgstr "Končano"
|
||
|
||
#: ulng.rsoperlisting
|
||
msgid "Listing"
|
||
msgstr "Izpisovanje"
|
||
|
||
#: ulng.rsoperlistingin
|
||
msgid "Listing \"%s\""
|
||
msgstr "Izpisovanje seznama »%s«"
|
||
|
||
#: ulng.rsopermoving
|
||
msgid "Moving"
|
||
msgstr "Premikanje"
|
||
|
||
#: ulng.rsopermovingfromto
|
||
msgid "Moving from \"%s\" to \"%s\""
|
||
msgstr "Premikanje iz »%s« v »%s«"
|
||
|
||
#: ulng.rsopermovingsomethingto
|
||
msgid "Moving \"%s\" to \"%s\""
|
||
msgstr "Premikanje »%s« v »%s«"
|
||
|
||
#: ulng.rsopernotstarted
|
||
msgid "Not started"
|
||
msgstr "Ni začeto"
|
||
|
||
#: ulng.rsoperpacking
|
||
msgid "Packing"
|
||
msgstr "Pakiranje"
|
||
|
||
#: ulng.rsoperpackingfromto
|
||
msgid "Packing from \"%s\" to \"%s\""
|
||
msgstr "Pakiranje iz »%s« v »%s«"
|
||
|
||
#: ulng.rsoperpackingsomethingto
|
||
msgid "Packing \"%s\" to \"%s\""
|
||
msgstr "Pakiranje »%s« v »%s«"
|
||
|
||
#: ulng.rsoperpaused
|
||
msgid "Paused"
|
||
msgstr "V premoru"
|
||
|
||
#: ulng.rsoperpausing
|
||
msgid "Pausing"
|
||
msgstr "V premoru"
|
||
|
||
#: ulng.rsoperrunning
|
||
msgid "Running"
|
||
msgstr "Zagnano"
|
||
|
||
#: ulng.rsopersettingproperty
|
||
msgid "Setting property"
|
||
msgstr "Nastavljanje lastnosti"
|
||
|
||
#: ulng.rsopersettingpropertyin
|
||
msgid "Setting property in \"%s\""
|
||
msgstr "Nastavljanje lastnosti v »%s«"
|
||
|
||
#: ulng.rsopersettingpropertyof
|
||
msgid "Setting property of \"%s\""
|
||
msgstr "Nastavljanje lastnosti »%s«"
|
||
|
||
#: ulng.rsopersplitting
|
||
msgid "Splitting"
|
||
msgstr "Razdeljevanje"
|
||
|
||
#: ulng.rsopersplittingfromto
|
||
msgid "Splitting \"%s\" to \"%s\""
|
||
msgstr "Razdeljevanje »%s« v »%s«"
|
||
|
||
#: ulng.rsoperstarting
|
||
msgid "Starting"
|
||
msgstr "Začenjanje"
|
||
|
||
#: ulng.rsoperstopped
|
||
msgid "Stopped"
|
||
msgstr "Zaustavljeno"
|
||
|
||
#: ulng.rsoperstopping
|
||
msgid "Stopping"
|
||
msgstr "Zaustavljanje"
|
||
|
||
#: ulng.rsopertesting
|
||
msgid "Testing"
|
||
msgstr "Preizkušanje"
|
||
|
||
#: ulng.rsopertestingin
|
||
msgid "Testing in \"%s\""
|
||
msgstr "Preizkušanje v »%s«"
|
||
|
||
#: ulng.rsopertestingsomething
|
||
msgid "Testing \"%s\""
|
||
msgstr "Preizkušanje »%s«"
|
||
|
||
#: ulng.rsoperverifyingchecksum
|
||
msgid "Verifying checksum"
|
||
msgstr "Preverjanje nadzorne vsote"
|
||
|
||
#: ulng.rsoperverifyingchecksumin
|
||
msgid "Verifying checksum in \"%s\""
|
||
msgstr "Preverjanje nadzorne vsote »%s«"
|
||
|
||
#: ulng.rsoperverifyingchecksumof
|
||
msgid "Verifying checksum of \"%s\""
|
||
msgstr "Preverjanje nadzorne vsote »%s«"
|
||
|
||
#: ulng.rsoperwaitingforconnection
|
||
msgid "Waiting for access to file source"
|
||
msgstr "Čakanje na dostop do vira datoteke."
|
||
|
||
#: ulng.rsoperwaitingforfeedback
|
||
msgid "Waiting for user response"
|
||
msgstr "Čakanje na odziv uporabnika"
|
||
|
||
#: ulng.rsoperwiping
|
||
msgid "Wiping"
|
||
msgstr "Neobnovljivo brisanje"
|
||
|
||
#: ulng.rsoperwipingin
|
||
msgid "Wiping in \"%s\""
|
||
msgstr "Neobnovljivo brisanje v »%s«"
|
||
|
||
#: ulng.rsoperwipingsomething
|
||
msgid "Wiping \"%s\""
|
||
msgstr "Neobnovljivo brisanje »%s«"
|
||
|
||
#: ulng.rsoperworking
|
||
msgid "Working"
|
||
msgstr "Izvajanje opravila"
|
||
|
||
#: ulng.rsoptaddfrommainpanel
|
||
msgid "Add at &beginning;Add at the end;Smart add"
|
||
msgstr "dodaj na začetek;dodaj na konec;pametno dodajanje"
|
||
|
||
#: ulng.rsoptarchivedelete
|
||
msgid "Delete:"
|
||
msgstr "Izbriši:"
|
||
|
||
#: ulng.rsoptarchiveextractwithoutpath
|
||
msgid "Extract without path:"
|
||
msgstr "Odpakiraj brez navedbe poti:"
|
||
|
||
#: ulng.rsoptarchiveformmode
|
||
msgid "Format parsing mode:"
|
||
msgstr "Način razčlenjevanja oblike:"
|
||
|
||
#: ulng.rsoptarchiveid
|
||
msgid "ID:"
|
||
msgstr "ID:"
|
||
|
||
#: ulng.rsoptarchiveidpos
|
||
msgid "ID Position:"
|
||
msgstr "Položaj ID:"
|
||
|
||
#: ulng.rsoptarchiveidseekrange
|
||
msgid "ID Seek Range:"
|
||
msgstr "ID obsega iskanja:"
|
||
|
||
#: ulng.rsoptarchiveparam
|
||
msgid "Parameter"
|
||
msgstr "Parameter"
|
||
|
||
#: ulng.rsoptarchivepasswordquery
|
||
msgid "Password query string:"
|
||
msgstr "Niz poizvedbe gesla:"
|
||
|
||
#: ulng.rsoptarchiveselfextract
|
||
msgid "Create self extracting archive:"
|
||
msgstr "Ustvari arhiv za samodejno odpakiranje:"
|
||
|
||
#: ulng.rsoptarchivetest
|
||
msgid "Test:"
|
||
msgstr "Preizkus:"
|
||
|
||
#: ulng.rsoptarchivetypename
|
||
msgid "Archive type name:"
|
||
msgstr "Ime vrste arhiva:"
|
||
|
||
#: ulng.rsoptarchivevalue
|
||
msgctxt "ulng.rsoptarchivevalue"
|
||
msgid "Value"
|
||
msgstr "Vrednost"
|
||
|
||
#: ulng.rsoptassocpluginwith
|
||
msgid "Associate plugin \"%s\" with:"
|
||
msgstr "Vzpostavi programsko vez vstavka »%s« z:"
|
||
|
||
#: ulng.rsoptautosizecolumn
|
||
msgid "First;Last;"
|
||
msgstr "prvega stolpca;zadnjega stolpca;"
|
||
|
||
#: ulng.rsoptconfigsortorder
|
||
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
||
msgstr "običajno, privzet način;abecedno (razdelek »Jezik« je vedno na vrhu)"
|
||
|
||
#: ulng.rsoptdifferframeposition
|
||
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
||
msgstr "Dejavno okno na levi, nedejavno na desni (opuščeno);Levo okno na levi, desno na desni"
|
||
|
||
#: ulng.rsoptdisable
|
||
msgid "Disable"
|
||
msgstr "Onemogoči"
|
||
|
||
#: ulng.rsoptenable
|
||
msgid "Enable"
|
||
msgstr "Omogoči"
|
||
|
||
#: ulng.rsoptenterext
|
||
msgid "Enter extension"
|
||
msgstr "Vnos pripone"
|
||
|
||
#: ulng.rsoptfavoritetabswheretoaddinlist
|
||
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
||
msgstr "dodaj na začetek;dodaj na konec;abecedno razvrščanje"
|
||
|
||
#: ulng.rsoptfileoperationsprogresskind
|
||
msgid "separate window;minimized separate window;operations panel"
|
||
msgstr "ločenem oknu;skrčenem ločenem oknu;oknu opravil"
|
||
|
||
#: ulng.rsoptfilesizeformat
|
||
msgid "float;B;K;M;G"
|
||
msgstr "plavajoče;B;K;M;G"
|
||
|
||
#: ulng.rsopthotkeysadddeleteshortcutlong
|
||
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
||
msgstr "Bližnjica %s za ukaz cm_Delete bo vpisana, zato jo bo mogoče uporabiti za povrnitev te nastavitve."
|
||
|
||
#: ulng.rsopthotkeysaddhotkey
|
||
msgid "Add hotkey for %s"
|
||
msgstr "Dodaj hitro tipko za %s"
|
||
|
||
#: ulng.rsopthotkeysaddshortcutbutton
|
||
msgid "Add shortcut"
|
||
msgstr "Dodaj bližnjico"
|
||
|
||
#: ulng.rsopthotkeyscannotsetshortcut
|
||
msgid "Cannot set shortcut"
|
||
msgstr "Ni mogoče nastaviti tipkovne bližnjice"
|
||
|
||
#: ulng.rsopthotkeyschangeshortcut
|
||
msgid "Change shortcut"
|
||
msgstr "Spremeni tipkovno bližnjico"
|
||
|
||
#: ulng.rsopthotkeyscommand
|
||
msgctxt "ulng.rsopthotkeyscommand"
|
||
msgid "Command"
|
||
msgstr "Ukaz"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
||
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
||
msgstr "Tipkovna bližnjica %s za ukaz cm_Delete ima določen parametre, ki prekliče nastavitev. Ali želite spremeniti ta parameter za uporabo splošnih nastavitev?"
|
||
|
||
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
||
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
||
msgstr "Tipkovna bližnjica %s za cm_Delete mora imeti parameter spremenjen tako, da ustreza tipkovni bližnjici %s. Ali jo želite spremeniti?"
|
||
|
||
#: ulng.rsopthotkeysdescription
|
||
msgctxt "ulng.rsopthotkeysdescription"
|
||
msgid "Description"
|
||
msgstr "Opis"
|
||
|
||
#: ulng.rsopthotkeysedithotkey
|
||
msgid "Edit hotkey for %s"
|
||
msgstr "Uredi hitro tipko za %s"
|
||
|
||
#: ulng.rsopthotkeysfixparameter
|
||
msgid "Fix parameter"
|
||
msgstr "Popravi parameter"
|
||
|
||
#: ulng.rsopthotkeyshotkey
|
||
msgctxt "ulng.rsopthotkeyshotkey"
|
||
msgid "Hotkey"
|
||
msgstr "Hitra tipka"
|
||
|
||
#: ulng.rsopthotkeyshotkeys
|
||
msgctxt "ulng.rsopthotkeyshotkeys"
|
||
msgid "Hotkeys"
|
||
msgstr "Hitre tipke"
|
||
|
||
#: ulng.rsopthotkeysnohotkey
|
||
msgid "<none>"
|
||
msgstr "<brez>"
|
||
|
||
#: ulng.rsopthotkeysparameters
|
||
msgctxt "ulng.rsopthotkeysparameters"
|
||
msgid "Parameters"
|
||
msgstr "Parametri"
|
||
|
||
#: ulng.rsopthotkeyssetdeleteshortcut
|
||
msgid "Set shortcut to delete file"
|
||
msgstr "Dodaj bližnjico za brisanje datotek"
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
||
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
||
msgstr "Za povezavo te možnosti s tipkovno bližnjico %s mora biti ta določena za cm_Delete, vendar je povezana z možnostjo %s. Ali jo želite spremeniti."
|
||
|
||
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
||
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
||
msgstr "Tipkovna bližnjica %s za cm_Delete je tipkovna bližnjica zaporedja ukazov za katerega obratnega ukaza ni mogoče določiti. Nastavitev najverjetneje ne bo delovala."
|
||
|
||
#: ulng.rsopthotkeysshortcutused
|
||
msgid "Shortcut in use"
|
||
msgstr "Tipkovna bližnjica v uporabi"
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext1
|
||
msgid "Shortcut %s is already used."
|
||
msgstr "Tipkovna bližnjica %s je že v uporabi."
|
||
|
||
#: ulng.rsopthotkeysshortcutusedtext2
|
||
msgid "Change it to %s?"
|
||
msgstr "Ali naj se zamenja v %s?"
|
||
|
||
#: ulng.rsopthotkeysusedby
|
||
msgid "used for %s in %s"
|
||
msgstr "uporabljeno za %s v %s"
|
||
|
||
#: ulng.rsopthotkeysusedwithdifferentparams
|
||
msgid "used for this command but with different parameters"
|
||
msgstr "uporabljeno za ta ukaz, vendar z drugačnimi parametri"
|
||
|
||
#: ulng.rsoptionseditorarchivers
|
||
msgid "Archivers"
|
||
msgstr "Pakirniki"
|
||
|
||
#: ulng.rsoptionseditorautorefresh
|
||
msgid "Auto refresh"
|
||
msgstr "Samodejno osveževanje"
|
||
|
||
#: ulng.rsoptionseditorbehavior
|
||
msgid "Behaviors"
|
||
msgstr "Obnašanje"
|
||
|
||
#: ulng.rsoptionseditorbriefview
|
||
msgid "Brief"
|
||
msgstr "Datotečni pogled"
|
||
|
||
#: ulng.rsoptionseditorcolors
|
||
msgid "Colors"
|
||
msgstr "Barve"
|
||
|
||
#: ulng.rsoptionseditorcolumnsview
|
||
msgid "Columns"
|
||
msgstr "Stolpci"
|
||
|
||
#: ulng.rsoptionseditorconfiguration
|
||
msgctxt "ulng.rsoptionseditorconfiguration"
|
||
msgid "Configuration"
|
||
msgstr "Nastavitve"
|
||
|
||
#: ulng.rsoptionseditorcustomcolumns
|
||
msgid "Custom columns"
|
||
msgstr "Stolpci po meri"
|
||
|
||
#: ulng.rsoptionseditordirectoryhotlist
|
||
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
||
msgid "Directory Hotlist"
|
||
msgstr "Seznam hitrih map"
|
||
|
||
#: ulng.rsoptionseditordraganddrop
|
||
msgid "Drag & drop"
|
||
msgstr "Povleci in spusti"
|
||
|
||
#: ulng.rsoptionseditordriveslistbutton
|
||
msgid "Drives list button"
|
||
msgstr "Gumb seznama pogonov"
|
||
|
||
#: ulng.rsoptionseditorfavoritetabs
|
||
msgid "Favorite Tabs"
|
||
msgstr "Priljubljeni zavihki"
|
||
|
||
#: ulng.rsoptionseditorfileassicextra
|
||
msgid "File associations extra"
|
||
msgstr "Dodatne programske &vezi"
|
||
|
||
#: ulng.rsoptionseditorfileassoc
|
||
msgid "File associations"
|
||
msgstr "Programske vezi"
|
||
|
||
#: ulng.rsoptionseditorfilenewfiletypes
|
||
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
||
msgid "New"
|
||
msgstr "Novo"
|
||
|
||
#: ulng.rsoptionseditorfileoperations
|
||
msgid "File operations"
|
||
msgstr "Datotečna opravila"
|
||
|
||
#: ulng.rsoptionseditorfilepanels
|
||
msgid "File panels"
|
||
msgstr "Okna datotek"
|
||
|
||
#: ulng.rsoptionseditorfilesearch
|
||
msgctxt "ulng.rsoptionseditorfilesearch"
|
||
msgid "File search"
|
||
msgstr "Iskanje datotek"
|
||
|
||
#: ulng.rsoptionseditorfilesviews
|
||
msgid "Files views"
|
||
msgstr "Pogled datotek"
|
||
|
||
#: ulng.rsoptionseditorfiletypes
|
||
msgctxt "ulng.rsoptionseditorfiletypes"
|
||
msgid "File types"
|
||
msgstr "Vrste datotek"
|
||
|
||
#: ulng.rsoptionseditorfoldertabs
|
||
msgid "Folder tabs"
|
||
msgstr "Zavihki map"
|
||
|
||
#: ulng.rsoptionseditorfoldertabsextra
|
||
msgid "Folder tabs extra"
|
||
msgstr "Zavihki map"
|
||
|
||
#: ulng.rsoptionseditorfonts
|
||
msgid "Fonts"
|
||
msgstr "Pisave"
|
||
|
||
#: ulng.rsoptionseditorhighlighters
|
||
msgid "Highlighters"
|
||
msgstr "Poudarjalniki"
|
||
|
||
#: ulng.rsoptionseditorhotkeys
|
||
msgid "Hot keys"
|
||
msgstr "Hitre tipke"
|
||
|
||
#: ulng.rsoptionseditoricons
|
||
msgid "Icons"
|
||
msgstr "Ikone"
|
||
|
||
#: ulng.rsoptionseditorignorelist
|
||
msgid "Ignore list"
|
||
msgstr "Seznam prezrtih datotek in map"
|
||
|
||
#: ulng.rsoptionseditorkeyboard
|
||
msgid "Keys"
|
||
msgstr "Tipke"
|
||
|
||
#: ulng.rsoptionseditorlanguage
|
||
msgid "Language"
|
||
msgstr "Jezik"
|
||
|
||
#: ulng.rsoptionseditorlayout
|
||
msgid "Layout"
|
||
msgstr "Razporeditev"
|
||
|
||
#: ulng.rsoptionseditorlog
|
||
msgid "Log"
|
||
msgstr "Dnevniki"
|
||
|
||
#: ulng.rsoptionseditormiscellaneous
|
||
msgid "Miscellaneous"
|
||
msgstr "Različne možnosti"
|
||
|
||
#: ulng.rsoptionseditormouse
|
||
msgid "Mouse"
|
||
msgstr "Miška"
|
||
|
||
#: ulng.rsoptionseditoroptionschanged
|
||
msgid ""
|
||
"Options have changed in \"%s\"\n"
|
||
"\n"
|
||
"Do you want to save modifications?\n"
|
||
msgstr ""
|
||
"Spremenjene so možnosti »%s«\n"
|
||
"\n"
|
||
"Ali želite shraniti spremembe?\n"
|
||
|
||
#: ulng.rsoptionseditorplugins
|
||
msgctxt "ulng.rsoptionseditorplugins"
|
||
msgid "Plugins"
|
||
msgstr "Vstavki"
|
||
|
||
#: ulng.rsoptionseditorquicksearch
|
||
msgid "Quick search/filter"
|
||
msgstr "Hitro iskanje/Filtriranje"
|
||
|
||
#: ulng.rsoptionseditorterminal
|
||
msgctxt "ulng.rsoptionseditorterminal"
|
||
msgid "Terminal"
|
||
msgstr "Terminal"
|
||
|
||
#: ulng.rsoptionseditortoolbar
|
||
msgid "Toolbar"
|
||
msgstr "Orodna vrstica"
|
||
|
||
#: ulng.rsoptionseditortools
|
||
msgid "Tools"
|
||
msgstr "Orodja"
|
||
|
||
#: ulng.rsoptionseditortooltips
|
||
msgid "Tooltips"
|
||
msgstr "Orodni namigi"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenu
|
||
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
||
msgid "Tree View Menu"
|
||
msgstr "Meni drevesnega pogleda"
|
||
|
||
#: ulng.rsoptionseditortreeviewmenucolors
|
||
msgid "Tree View Menu Colors"
|
||
msgstr "Barve menija drevesnega pogleda"
|
||
|
||
#: ulng.rsoptletters
|
||
msgid "None;Command Line;Quick Search;Quick Filter"
|
||
msgstr "Brez;Ukazna vrstica;Hitro iskanje;Hitri filter"
|
||
|
||
#: ulng.rsoptmouseselectionbutton
|
||
msgid "Left button;Right button;"
|
||
msgstr "z desnim gumbom;z levim gumbom;"
|
||
|
||
#: ulng.rsoptnewfilesposition
|
||
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
||
msgstr "na vrhu seznama datotek;za mapami (če so mape razvrščene pred datotekami);na mestu razvrščanja;na dnu seznama datotek"
|
||
|
||
#: ulng.rsoptpluginalreadyassigned
|
||
msgid "Plugin %s is already assigned for the following extensions:"
|
||
msgstr "Vstavek %s je že vezan na naslednje pripone datotek:"
|
||
|
||
#: ulng.rsoptpluginsactive
|
||
msgctxt "ulng.rsoptpluginsactive"
|
||
msgid "Active"
|
||
msgstr "Dejavno"
|
||
|
||
#: ulng.rsoptpluginsfilename
|
||
msgctxt "ulng.rsoptpluginsfilename"
|
||
msgid "File name"
|
||
msgstr "Ime datoteke"
|
||
|
||
#: ulng.rsoptpluginsname
|
||
msgctxt "ulng.rsoptpluginsname"
|
||
msgid "Name"
|
||
msgstr "Ime"
|
||
|
||
#: ulng.rsoptpluginsregisteredfor
|
||
msgctxt "ulng.rsoptpluginsregisteredfor"
|
||
msgid "Registered for"
|
||
msgstr "Vpisano za"
|
||
|
||
#: ulng.rsoptsearchcase
|
||
msgid "&Sensitive;&Insensitive"
|
||
msgstr "&občutljivo;&neobčutljivo"
|
||
|
||
#: ulng.rsoptsearchitems
|
||
msgid "&Files;Di&rectories;Files a&nd Directories"
|
||
msgstr "&Datoteke;&Mape;Datoteke &in Mape"
|
||
|
||
#: ulng.rsoptsearchopt
|
||
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
||
msgstr "&Skrij okno filtra, kadar ni v žarišču;Nadaljuj s shranjevanjem sprememb za naslednjo sejo"
|
||
|
||
#: ulng.rsoptsortcasesens
|
||
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
||
msgstr "ne upošteva velikosti črk;upošteva glede na jezikovno nastavitev sistema (aAbBcC);najprej velike, nato male črke (ABCabc)"
|
||
|
||
#: ulng.rsoptsortfoldermode
|
||
msgid "sort by name and show first;sort like files and show first;sort like files"
|
||
msgstr "razvrsti po imenu in najprej pokaži; razvrsti kot datoteke in najprej pokaži; razvrsti kot datoteke"
|
||
|
||
#: ulng.rsoptsortmethod
|
||
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
||
msgstr "abecedno, upoštevajoč znakovne naglase;naravno, številčno in abecedno"
|
||
|
||
#: ulng.rsopttabsposition
|
||
msgid "Top;Bottom;"
|
||
msgstr "zgoraj;spodaj;"
|
||
|
||
#: ulng.rsopttoolbarbuttontype
|
||
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
||
msgstr "&Ločilnik;&Notranji ukaz;&Zunanji ukaz;&Meni"
|
||
|
||
#: ulng.rsopttypeofduplicatedrename
|
||
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
||
msgstr "opuščen slog DC – Kopija (x) ime_datoteke.pri;slog Windows – ime datoteke (x).pri;skrčen slog – ime_datoteke(x).pri"
|
||
|
||
#: ulng.rsoptupdatedfilesposition
|
||
msgid "don't change position;use the same setting as for new files;to sorted position"
|
||
msgstr "ne spremeni mesta;uporabi enake nastavitve kot za nove datoteke;na razvrščeno mesto"
|
||
|
||
#: ulng.rspropscontains
|
||
msgid "Files: %d, folders: %d"
|
||
msgstr "Datoteke: %d; Mape: %d"
|
||
|
||
#: ulng.rspropserrchmod
|
||
msgid "Can not change access rights for \"%s\""
|
||
msgstr "Ni mogoče spremeniti dovoljenj dostopa za »%s«"
|
||
|
||
#: ulng.rspropserrchown
|
||
msgid "Can not change owner for \"%s\""
|
||
msgstr "Lastnika »%s« ni mogoče spremeniti."
|
||
|
||
#: ulng.rspropsfile
|
||
msgid "File"
|
||
msgstr "Datoteka"
|
||
|
||
#: ulng.rspropsfolder
|
||
msgctxt "ulng.rspropsfolder"
|
||
msgid "Directory"
|
||
msgstr "Mapa"
|
||
|
||
#: ulng.rspropsnmdpipe
|
||
msgid "Named pipe"
|
||
msgstr "Imenovan cevovod"
|
||
|
||
#: ulng.rspropssocket
|
||
msgid "Socket"
|
||
msgstr "Vtič"
|
||
|
||
#: ulng.rspropsspblkdev
|
||
msgid "Special block device"
|
||
msgstr "Posebna bločna naprava"
|
||
|
||
#: ulng.rspropsspchrdev
|
||
msgid "Special character device"
|
||
msgstr "Posebna znakovna naprava"
|
||
|
||
#: ulng.rspropssymlink
|
||
msgid "Symbolic link"
|
||
msgstr "Simbolna povezava"
|
||
|
||
#: ulng.rspropsunknowntype
|
||
msgid "Unknown type"
|
||
msgstr "neznana vrsta"
|
||
|
||
#: ulng.rssearchresult
|
||
msgid "Search result"
|
||
msgstr "Rezultati iskanja"
|
||
|
||
#: ulng.rssearchstatus
|
||
msgid "SEARCH"
|
||
msgstr "Iskanje"
|
||
|
||
#: ulng.rssearchtemplateunnamed
|
||
msgid "<unnamed template>"
|
||
msgstr "<neimenovana predloga>"
|
||
|
||
#: ulng.rssearchwithdsxplugininprogress
|
||
msgid ""
|
||
"A file search using DSX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Iskanje datotek z uporabo vstavka DSX je že v teku.\n"
|
||
"Pred začetkom novega iskanja z vstavkom mora biti predhodno končano.\n"
|
||
|
||
#: ulng.rssearchwithwdxplugininprogress
|
||
msgid ""
|
||
"A file search using WDX plugin is already in progress.\n"
|
||
"We need that one to be completed before to launch a new one.\n"
|
||
msgstr ""
|
||
"Iskanje datotek z uporabo vstavka WDX je že v teku.\n"
|
||
"Pred začetkom novega iskanja z vstavkom mora biti predhodno končano.\n"
|
||
|
||
#: ulng.rsselectdir
|
||
msgid "Select a directory"
|
||
msgstr "Izbor mape"
|
||
|
||
#: ulng.rsselectyoufindfileswindow
|
||
msgid "Select your window"
|
||
msgstr "Izbor okna"
|
||
|
||
#: ulng.rsshowhelpfor
|
||
msgid "&Show help for %s"
|
||
msgstr "&Pokaži pomoč za %s"
|
||
|
||
#: ulng.rssimplewordall
|
||
msgctxt "ulng.rssimplewordall"
|
||
msgid "All"
|
||
msgstr "Vse"
|
||
|
||
#: ulng.rssimplewordcategory
|
||
msgctxt "ulng.rssimplewordcategory"
|
||
msgid "Category"
|
||
msgstr "Kategorija"
|
||
|
||
#: ulng.rssimplewordcolumnsingular
|
||
msgid "Column"
|
||
msgstr "Stolpec"
|
||
|
||
#: ulng.rssimplewordcommand
|
||
msgctxt "ulng.rssimplewordcommand"
|
||
msgid "Command"
|
||
msgstr "Ukaz"
|
||
|
||
#: ulng.rssimplewordfilename
|
||
msgid "Filename"
|
||
msgstr "Ime datoteke"
|
||
|
||
#: ulng.rssimplewordfiles
|
||
msgid "files"
|
||
msgstr "datoteke"
|
||
|
||
#: ulng.rssimplewordletter
|
||
msgid "Letter"
|
||
msgstr "Pismo"
|
||
|
||
#: ulng.rssimplewordparameter
|
||
msgid "Param"
|
||
msgstr "Parametri"
|
||
|
||
#: ulng.rssimplewordresult
|
||
msgid "Result"
|
||
msgstr "Rezultat"
|
||
|
||
#: ulng.rssimplewordworkdir
|
||
msgid "WorkDir"
|
||
msgstr "Delovna mapa"
|
||
|
||
#: ulng.rssizeunitbytes
|
||
msgid "Bytes"
|
||
msgstr "Bajti"
|
||
|
||
#: ulng.rssizeunitgbytes
|
||
msgid "Gigabytes"
|
||
msgstr "Gigabajti"
|
||
|
||
#: ulng.rssizeunitkbytes
|
||
msgid "Kilobytes"
|
||
msgstr "Kilobajti"
|
||
|
||
#: ulng.rssizeunitmbytes
|
||
msgid "Megabytes"
|
||
msgstr "Megabajti"
|
||
|
||
#: ulng.rssizeunittbytes
|
||
msgid "Terabytes"
|
||
msgstr "Terabajti"
|
||
|
||
#: ulng.rsspacemsg
|
||
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
||
msgstr "Datoteke: %d, Mape: %d, Velikost: %s (%s bajtov)"
|
||
|
||
#: ulng.rsspliterrdirectory
|
||
msgid "Unable to create target directory!"
|
||
msgstr "Ciljne mape ni mogoče ustvariti!"
|
||
|
||
#: ulng.rsspliterrfilesize
|
||
msgid "Incorrect file size format!"
|
||
msgstr "Nepravilen zapis velikosti datoteke!"
|
||
|
||
#: ulng.rsspliterrsplitfile
|
||
msgid "Unable to split the file!"
|
||
msgstr "Ni mogoče razdeliti datoteke!"
|
||
|
||
#: ulng.rssplitmsgmanyparts
|
||
msgid "The number of parts is more than 100! Continue?"
|
||
msgstr "Število delov presega vrednost 100! Ali naj se opravilo vseeno izvede?"
|
||
|
||
#: ulng.rssplitpredefinedsizes
|
||
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
||
msgstr "Samodejno;1457664B – 3.5\" Visoke gostote 1.44M;1213952B – 5.25\" Visoke gostote 1.2M;730112B – 3.5\" Dvojne gostote 720K;362496B – 5.25\" Dvojne gostote 360K;98078KB – ZIP 100MB;650MB – CD 650MB;700MB – CD 700MB;4482MB - DVD+R"
|
||
|
||
#: ulng.rssplitseldir
|
||
msgid "Select directory:"
|
||
msgstr "Izbor mape:"
|
||
|
||
#: ulng.rsstraccents
|
||
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
||
|
||
#: ulng.rsstraccentsstripped
|
||
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
||
|
||
#: ulng.rsstrpreviewjustpreview
|
||
msgid "Just preview"
|
||
msgstr "Le predogled"
|
||
|
||
#: ulng.rsstrpreviewothers
|
||
msgid "Others"
|
||
msgstr "Ostalo"
|
||
|
||
#: ulng.rsstrpreviewsearchingletters
|
||
msgid "OU"
|
||
msgstr "OU"
|
||
|
||
#: ulng.rsstrpreviewsidenote
|
||
msgid "Side note"
|
||
msgstr "Opomba:"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched1
|
||
msgid "Flat"
|
||
msgstr "Ploski"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched2
|
||
msgid "Limited"
|
||
msgstr "Omejeno"
|
||
|
||
#: ulng.rsstrpreviewwordwithoutsearched3
|
||
msgid "Simple"
|
||
msgstr "Enostavno"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched1
|
||
msgid "Fabulous"
|
||
msgstr "Izjemen"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched2
|
||
msgid "Marvelous"
|
||
msgstr "Čudovit"
|
||
|
||
#: ulng.rsstrpreviewwordwithsearched3
|
||
msgid "Tremendous"
|
||
msgstr "Velikanski"
|
||
|
||
#: ulng.rsstrtvmchoosedirhistory
|
||
msgid "Choose your directory from Dir History"
|
||
msgstr "Izbor mape iz zgodovine obiskanih map"
|
||
|
||
#: ulng.rsstrtvmchoosefavoritetabs
|
||
msgid "Choose you Favorite Tabs:"
|
||
msgstr "Izbor priljubljenih zavihkov:"
|
||
|
||
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
||
msgid "Choose your command from Command Line History"
|
||
msgstr "Izbor ukaza iz zgodovine uporabljenih ukazov"
|
||
|
||
#: ulng.rsstrtvmchoosefrommainmenu
|
||
msgid "Choose your action from Main Menu"
|
||
msgstr "Izbor dejanj iz glavnega menija"
|
||
|
||
#: ulng.rsstrtvmchoosefromtoolbar
|
||
msgid "Choose your action from Maintool bar"
|
||
msgstr "Izbor dejanj iz glavne orodne vrstice"
|
||
|
||
#: ulng.rsstrtvmchoosehotdirectory
|
||
msgid "Choose your directory from Hot Directory:"
|
||
msgstr "Izbor mape izmed vročih map"
|
||
|
||
#: ulng.rsstrtvmchooseviewhistory
|
||
msgid "Choose your directory from File View History"
|
||
msgstr "Izbor mape iz zgodovine datotečnega pogleda"
|
||
|
||
#: ulng.rsstrtvmchooseyourfileordir
|
||
msgid "Choose your file or your directory"
|
||
msgstr "Izbor datoteke ali mape"
|
||
|
||
#: ulng.rssymerrcreate
|
||
msgid "Error creating symlink."
|
||
msgstr "Napaka med ustvarjanjem simbolne povezave."
|
||
|
||
#: ulng.rssyndefaulttext
|
||
msgid "Default text"
|
||
msgstr "Privzeto besedilo"
|
||
|
||
#: ulng.rssynlangplaintext
|
||
msgid "Plain text"
|
||
msgstr "Golo besedilo"
|
||
|
||
#: ulng.rstabsactionondoubleclickchoices
|
||
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
||
msgstr "ne naredi ničesar;zapri zavihek;dostopi do priljubljenih zavihkov;pokaži pojavni meni zavihkov"
|
||
|
||
#: ulng.rstimeunitday
|
||
msgid "Day(s)"
|
||
msgstr "dni"
|
||
|
||
#: ulng.rstimeunithour
|
||
msgid "Hour(s)"
|
||
msgstr "ure"
|
||
|
||
#: ulng.rstimeunitminute
|
||
msgid "Minute(s)"
|
||
msgstr "minute"
|
||
|
||
#: ulng.rstimeunitmonth
|
||
msgid "Month(s)"
|
||
msgstr "meseci"
|
||
|
||
#: ulng.rstimeunitsecond
|
||
msgid "Second(s)"
|
||
msgstr "sekunde"
|
||
|
||
#: ulng.rstimeunitweek
|
||
msgid "Week(s)"
|
||
msgstr "tedni"
|
||
|
||
#: ulng.rstimeunityear
|
||
msgid "Year(s)"
|
||
msgstr "leta"
|
||
|
||
#: ulng.rstitlerenamefavtabs
|
||
msgid "Rename Favorite Tabs"
|
||
msgstr "Preimenuj priljubljene zavihke"
|
||
|
||
#: ulng.rstitlerenamefavtabsmenu
|
||
msgid "Rename Favorite Tabs sub-menu"
|
||
msgstr "Preimenuj priljubljene zavihke"
|
||
|
||
#: ulng.rstooldiffer
|
||
msgctxt "ulng.rstooldiffer"
|
||
msgid "Differ"
|
||
msgstr "Primerjalnik"
|
||
|
||
#: ulng.rstooleditor
|
||
msgctxt "ulng.rstooleditor"
|
||
msgid "Editor"
|
||
msgstr "Urejevalnik"
|
||
|
||
#: ulng.rstoolerroropeningdiffer
|
||
msgid "Error opening differ"
|
||
msgstr "Napaka med odpiranjem primerjalnika"
|
||
|
||
#: ulng.rstoolerroropeningeditor
|
||
msgid "Error opening editor"
|
||
msgstr "Napaka odpiranja urejevalnika"
|
||
|
||
#: ulng.rstoolerroropeningterminal
|
||
msgid "Error opening terminal"
|
||
msgstr "Napaka odpiranja terminala"
|
||
|
||
#: ulng.rstoolerroropeningviewer
|
||
msgid "Error opening viewer"
|
||
msgstr "Napaka odpiranja pregledovalnika"
|
||
|
||
#: ulng.rstoolterminal
|
||
msgctxt "ulng.rstoolterminal"
|
||
msgid "Terminal"
|
||
msgstr "Terminal"
|
||
|
||
#: ulng.rstoolviewer
|
||
msgctxt "ulng.rstoolviewer"
|
||
msgid "Viewer"
|
||
msgstr "Pregledovalnik"
|
||
|
||
#: ulng.rsunhandledexceptionmessage
|
||
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
||
msgstr "Pošljite poročilo napake s podrobnim opisom in datoteko: %s. Pritisnite %s za nadaljevanje ali pa %s za končanje programa."
|
||
|
||
#: ulng.rsvarbothpanelactivetoinactive
|
||
msgid "Both panels, from active to inactive"
|
||
msgstr "Obe okni, od dejavne proti nedejavni"
|
||
|
||
#: ulng.rsvarbothpanellefttoright
|
||
msgid "Both panels, from left to right"
|
||
msgstr "Obe okni, z leve proti desni"
|
||
|
||
#: ulng.rsvarcurrentpath
|
||
msgid "Path of panel"
|
||
msgstr "Pot okna"
|
||
|
||
#: ulng.rsvarencloseelement
|
||
msgid "Enclose each name in brackets or what you want"
|
||
msgstr "Z oklepajem označite vsako ime, ki ga želite"
|
||
|
||
#: ulng.rsvarfilenamenoext
|
||
msgid "Just filename, no extension"
|
||
msgstr "Le ime datoteke brez pripone"
|
||
|
||
#: ulng.rsvarfullpath
|
||
msgid "Complete filename (path+filename)"
|
||
msgstr "Polno ime datoteke (pot in ime)"
|
||
|
||
#: ulng.rsvarhelpwith
|
||
msgid "Help with \"%\" variables"
|
||
msgstr "Pomoč z uporabo spremenljivk »%«"
|
||
|
||
#: ulng.rsvarinputparam
|
||
msgid "Will request request user to enter a parameter with a default suggested value"
|
||
msgstr "Zahteva od uporabnika vpis parametra s predlagano privzeto vrednostjo"
|
||
|
||
#: ulng.rsvarleftpanel
|
||
msgid "Left panel"
|
||
msgstr "Levo okno"
|
||
|
||
#: ulng.rsvarlistfilename
|
||
msgid "Temporary filename of list of filenames"
|
||
msgstr "Začasno ime datoteke seznama imen datotek"
|
||
|
||
#: ulng.rsvarlistfullfilename
|
||
msgid "Temporary filename of list of complete filenames (path+filename)"
|
||
msgstr "Začasno ime datoteke popolnega seznama imen datotek (pot in ime datoteke)"
|
||
|
||
#: ulng.rsvarlistinutf16
|
||
msgid "Filenames in list in UTF-16 with BOM"
|
||
msgstr "Imena datotek v seznamu v UTF16 z BOM"
|
||
|
||
#: ulng.rsvarlistinutf16quoted
|
||
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
||
msgstr "Imena datotek v seznamu v UTF16 z BOM znotraj dvojnih narekovajev"
|
||
|
||
#: ulng.rsvarlistinutf8
|
||
msgid "Filenames in list in UTF-8"
|
||
msgstr "Imena datotek v seznamu v UTF8 "
|
||
|
||
#: ulng.rsvarlistinutf8quoted
|
||
msgid "Filenames in list in UTF-8, inside double quotes"
|
||
msgstr "Imena datotek v seznamu v UTF8 z BOM znotraj dvojnih narekovajev"
|
||
|
||
#: ulng.rsvarlistrelativefilename
|
||
msgid "Temporary filename of list of filenames with relative path"
|
||
msgstr "Začasno ime datoteke seznama imen datotek z relativno potjo"
|
||
|
||
#: ulng.rsvaronlyextension
|
||
msgid "Only file extension"
|
||
msgstr "Le pripona datoteke"
|
||
|
||
#: ulng.rsvaronlyfilename
|
||
msgid "Only filename"
|
||
msgstr "Le ime datoteke"
|
||
|
||
#: ulng.rsvarotherexamples
|
||
msgid "Other example of what's possible"
|
||
msgstr "Drug primer možnosti"
|
||
|
||
#: ulng.rsvarpath
|
||
#, fuzzy
|
||
#| msgid "Path, with ending delimiter"
|
||
msgid "Path, without ending delimiter"
|
||
msgstr "Pot s končnim ločilnikom"
|
||
|
||
#: ulng.rsvarpercentchangetopound
|
||
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
||
msgstr "Od kazalke do konca vrstice je določilnik spremenljivke odstotka znak »#«"
|
||
|
||
#: ulng.rsvarpercentsign
|
||
msgid "Return the percent sign"
|
||
msgstr "Vrne znak za odstotek"
|
||
|
||
#: ulng.rsvarpoundchangetopercent
|
||
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
||
msgstr "Od kazalke do konca vrstice je določilnik spremenljivke odstotka spet znak »%«"
|
||
|
||
#: ulng.rsvarprependelement
|
||
msgid "Prepend each name with \"-a \" or what you want"
|
||
msgstr "Dodaj predpono »-a« vsakemu imenu oziroma karkoli drugega"
|
||
|
||
#: ulng.rsvarpromptuserforparam
|
||
msgid "%[Prompt user for param;Default value proposed]"
|
||
msgstr "%[Zahtevaj uporabniške parametre;Predlagaj privzete vrednosti]"
|
||
|
||
#: ulng.rsvarrelativepathandfilename
|
||
msgid "Filename with relative path"
|
||
msgstr "Ime datoteke z relativno potjo"
|
||
|
||
#: ulng.rsvarrightpanel
|
||
msgid "Right panel"
|
||
msgstr "Desno okno"
|
||
|
||
#: ulng.rsvarsecondelementrightpanel
|
||
msgid "Full path of second selected file in right panel"
|
||
msgstr "Polna pot druge izbrane datoteke v desnem oknu"
|
||
|
||
#: ulng.rsvarshowcommandprior
|
||
msgid "Show command prior execute"
|
||
msgstr "Pokaži ukaz pred izvedbo"
|
||
|
||
#: ulng.rsvarsimplemessage
|
||
msgid "%[Simple message]"
|
||
msgstr "%[Enostavno sporočilo]"
|
||
|
||
#: ulng.rsvarsimpleshowmessage
|
||
msgid "Will show a simple message"
|
||
msgstr "Prikazano bo enostavno sporočilo"
|
||
|
||
#: ulng.rsvarsourcepanel
|
||
msgid "Active panel (source)"
|
||
msgstr "Dejavno okno (vir)"
|
||
|
||
#: ulng.rsvartargetpanel
|
||
msgid "Inactive panel (target)"
|
||
msgstr "Nedejavno okno (cilj)"
|
||
|
||
#: ulng.rsvarwillbequoted
|
||
msgid "Filenames will be quoted from here (default)"
|
||
msgstr "Imena datotek bodo navedena od tu (privzeto)"
|
||
|
||
#: ulng.rsvarwilldointerminal
|
||
msgid "Command will be done in terminal, remaining opened at the end"
|
||
msgstr "Ukazi bodo izvršeni v terminalu, ki bo po izvajanju ostal odprt"
|
||
|
||
#: ulng.rsvarwillhaveendingdelimiter
|
||
msgid "Paths will have ending delimiter"
|
||
msgstr "Poti bodo zapisane s končnim ločilnikom (privzeto)"
|
||
|
||
#: ulng.rsvarwillnotbequoted
|
||
msgid "Filenames will not be quoted from here"
|
||
msgstr "Imena datotek ne bodo navedena od tu"
|
||
|
||
#: ulng.rsvarwillnotdointerminal
|
||
msgid "Command will be done in terminal, closed at the end"
|
||
msgstr "Ukazi bodo izvršeni v terminalu, ki bo po izvajanju končan"
|
||
|
||
#: ulng.rsvarwillnothaveendingdelimiter
|
||
msgid "Paths will not have ending delimiter (default)"
|
||
msgstr "Poti bodo zapisane brez končnega ločilnika (privzeto)"
|
||
|
||
#: ulng.rsvfsnetwork
|
||
msgctxt "ulng.rsvfsnetwork"
|
||
msgid "Network"
|
||
msgstr "Omrežje"
|
||
|
||
#: ulng.rsviewabouttext
|
||
msgid "Internal Viewer of Double Commander."
|
||
msgstr "Pregledovalnik programa Double Commander."
|
||
|
||
#: ulng.rsviewbadquality
|
||
msgid "Bad Quality"
|
||
msgstr "Slaba kakovost"
|
||
|
||
#: ulng.rsviewencoding
|
||
msgctxt "ulng.rsviewencoding"
|
||
msgid "Encoding"
|
||
msgstr "Nabor znakov"
|
||
|
||
#: ulng.rsviewimagetype
|
||
msgid "Image Type"
|
||
msgstr "Vrsta slike"
|
||
|
||
#: ulng.rsviewnewsize
|
||
msgctxt "ulng.rsviewnewsize"
|
||
msgid "New Size"
|
||
msgstr "Nova velikost"
|
||
|
||
#: ulng.rsviewnotfound
|
||
msgid "%s not found!"
|
||
msgstr "%s ni mogoče najti!"
|
||
|
||
#: ulng.rsviewwithexternalviewer
|
||
msgid "with external viewer"
|
||
msgstr "z zunanjim pregledovalnikom"
|
||
|
||
#: ulng.rsviewwithinternalviewer
|
||
msgid "with internal viewer"
|
||
msgstr "z notranjim pregledovalnikom"
|
||
|
||
#: ulng.rsxreplacements
|
||
msgid "Number of replacement: %d"
|
||
msgstr "Število zamenjav: %d"
|
||
|
||
#: ulng.rszeroreplacement
|
||
msgid "No replacement took place."
|
||
msgstr "Zamenjava ni bila izvršena."
|
||
|