doublecmd/language/doublecmd.cs.po
2018-03-11 14:16:12 +00:00

12068 lines
334 KiB
Text

# Lukáš Novotný <lenochod@tiscali.cz>, 2016.
msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.7.0 beta\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2016-12-17 16:14+0100\n"
"Last-Translator: Lukáš Novotný <lenochod@tiscali.cz>\n"
"Language-Team: čeština <info@pestasoft.com>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: čeština\n"
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
"X-Generator: Gtranslator 2.91.7\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Porovnávám... %d%% (pro zrušení použijte ESC)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Vpravo: Smazáno %d soubor(ů)"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Nalezeno souborů: %d (Stejných: %d, Rozdílných: %d, Unikátních vlevo: %d, Unikátních vpravo: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Zleva doprva: Kopírované soubory %d, Celková velikost: %d bajtů"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Zprava doleva: Kopírované soubory %d, Celková velikost: %d byjtů"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Vybrat šablonu..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Z&kontrolovat volné místo"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Kopírova&t atributy"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Kopírovat v&lastnictví"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Kopírovat o&právnění"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopírovat d&atum/čas"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Opravit odka&zy"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgid "Drop readonly fla&g"
msgstr "Zrušit pří&znak jen pro čtení"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "V&yloučit prázdné adresáře"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Ná&sledovat odkazy"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "&Rezervní prostor"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr "O&věřit"
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Co dělat, když nelze nastavit čas souboru, atributy, atd."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Použít šablonu souboru"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Pokud adr&esář existuje"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgid "When &file exists"
msgstr "Pokud &soubor existuje"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Pokud ne&lze nastavit vlastnost"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<žádná šablona>"
#: tfrmabout.btnclose.caption
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavřít"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Kopírovat do schránky"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Sestavení"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Domovská stránka:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revize"
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Verze"
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "Ob&novit"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Vyberte atributy"
#: tfrmattributesedit.cbarchive.caption
msgid "&Archive"
msgstr "&Archív"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Ko&mprimováno"
#: tfrmattributesedit.cbdirectory.caption
msgid "&Directory"
msgstr "&Adresář"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "Š&ifrováno"
#: tfrmattributesedit.cbhidden.caption
msgid "&Hidden"
msgstr "&Skryté"
#: tfrmattributesedit.cbreadonly.caption
msgid "Read o&nly"
msgstr "Pouze pro č&tení"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "Ř&ídké"
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Sticky"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Symbolický odkaz"
#: tfrmattributesedit.cbsystem.caption
msgid "S&ystem"
msgstr "S&ystém"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Dočasné"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Atributy NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Obecné atributy"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitů:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Skupina"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ostatní"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlastník"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Spustit"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čtení"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Jako te&xt:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zápis"
#: tfrmbenchmark.caption
msgid "Benchmark"
msgstr ""
#: tfrmbenchmark.lblbenchmarksize.caption
msgid "Benchmark data size: %d MB"
msgstr ""
#: tfrmbenchmark.stgresult.columns[0].title.caption
msgid "Hash"
msgstr ""
#: tfrmbenchmark.stgresult.columns[1].title.caption
msgid "Time (ms)"
msgstr ""
#: tfrmbenchmark.stgresult.columns[2].title.caption
msgid "Speed (MB/s)"
msgstr ""
#: tfrmchecksumcalc.caption
msgctxt "TFRMCHECKSUMCALC.CAPTION"
msgid "Calculate checksum..."
msgstr "Výpočet kontrolního součtu..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Otevřít soubor po vytvoření kontrolního součtu"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "V&ytvořit samostatný kontrolní součet pro každý soubor"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "&Uložit soubor(y) s kontrolním součtem do:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavřít"
#: tfrmchecksumverify.caption
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Kontrola kontrolního součtu..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "P&řidat"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "P&řipojit"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "&Vymazat"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Upravit"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Správce připojení"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Připojit k:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "Při&dat do fronty"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "M&ožnosti"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "Ul&ožit tyto možnosti jako výchozí"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Kopírovat soubor(y)"
#: tfrmcopydlg.mnunewqueue.caption
msgid "New queue"
msgstr "Nová fronta"
#: tfrmcopydlg.mnuqueue1.caption
msgid "Queue 1"
msgstr "Fronta 1"
#: tfrmcopydlg.mnuqueue2.caption
msgid "Queue 2"
msgstr "Fronta 2"
#: tfrmcopydlg.mnuqueue3.caption
msgid "Queue 3"
msgstr "Fronta 3"
#: tfrmcopydlg.mnuqueue4.caption
msgid "Queue 4"
msgstr "Fronta 4"
#: tfrmcopydlg.mnuqueue5.caption
msgid "Queue 5"
msgstr "Fronta 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Uložit popis"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Komentář souboru/adresáře"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "U&pravit komentář pro:"
#: tfrmdescredit.lblencoding.caption
msgid "&Encoding:"
msgstr "&Kódování:"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Automaticky porovnat"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Binární režim"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Zrušit"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Zrušit"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Kopírovat pravý blok"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Kopírovat pravý blok"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Kopírovat levý blok"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Kopírovat levý blok"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Vyjmout"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Vymazat"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Vložit"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Opakovat"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Vybrat &vše"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Zpět"
#: tfrmdiffer.actexit.caption
msgctxt "TFRMDIFFER.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Konec"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION"
msgid "First Difference"
msgstr "První rozdíl"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "První rozdíl"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Ignorovat velikost znaků"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Ignorovat mezery"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Udržovat rolování"
#: tfrmdiffer.actlastdifference.caption
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION"
msgid "Last Difference"
msgstr "Poslední rozdíl"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Poslední rozdíl"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Rozdíly řádky"
#: tfrmdiffer.actnextdifference.caption
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION"
msgid "Next Difference"
msgstr "Další rozdíl"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Další rozdíl"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Otevřít levý..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Otevřít pravý..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Kreslit pozadí"
#: tfrmdiffer.actprevdifference.caption
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION"
msgid "Previous Difference"
msgstr "Předchozí rozdíl"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Předchozí rozdíl"
#: tfrmdiffer.actreload.caption
msgid "&Reload"
msgstr "&Znovu načíst"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Znovu načíst"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Uložit"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Uložit"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Uložit jako..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Uložit jako..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Uložit levý"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Uložit levý"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Uložit levý jako..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Uložit levý jako..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Uložit pravý"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Uložit pravý"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Uložit pravý jako..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Uložit pravý jako..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Porovnat"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Porovnat"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Kódování"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Kódování"
#: tfrmdiffer.caption
msgid "Compare files"
msgstr "Porovnat soubory"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Vlevo"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "&Vpravo"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Akce"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Upravit"
#: tfrmdiffer.mnuencoding.caption
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "Kó&dování"
#: tfrmdiffer.mnufile.caption
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "&Soubor"
#: tfrmdiffer.mnuoptions.caption
msgid "&Options"
msgstr "M&ožnosti"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Přidá novou zkratku do sekvence"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Odstraní poslední zkratku ze sekvence"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr "Vybere zkratku ze seznamu zbývajících volně dostupných klíčů"
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr "Pouze pro tyto prvky"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parametry (každý na zvláštní řádce):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Zkratky:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "O programu"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Nastavení"
#: tfrmeditor.actconfhigh.hint
msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT"
msgid "Configuration"
msgstr "Nastavení"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Vyjmout"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Vyjmout"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Vymazat"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Vymazat"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Hledat"
#: tfrmeditor.acteditfind.hint
msgctxt "TFRMEDITOR.ACTEDITFIND.HINT"
msgid "Find"
msgstr "Hledat"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Hledat další"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Hledat další"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Najít předchozí"
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr "Přejít na řadek..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Vložit"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Vložit"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Opakovat"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Opakovat"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Nahradit"
#: tfrmeditor.acteditrplc.hint
msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT"
msgid "Replace"
msgstr "Nahradit"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Vybrat &vše"
#: tfrmeditor.acteditselectall.hint
msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT"
msgid "Select All"
msgstr "Vybrat vše"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Zpět"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Zpět"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavřít"
#: tfrmeditor.actfileclose.hint
msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT"
msgid "Close"
msgstr "Zavřít"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Konec"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Ukončit"
#: tfrmeditor.actfilenew.caption
msgid "&New"
msgstr "&Nový"
#: tfrmeditor.actfilenew.hint
msgctxt "TFRMEDITOR.ACTFILENEW.HINT"
msgid "New"
msgstr "Nový"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Otevřít"
#: tfrmeditor.actfileopen.hint
msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT"
msgid "Open"
msgstr "Otevřít"
#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Uložit"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Uložit"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Uložit &"
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Uložit jako"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "&Uložit vše"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Uložit vše"
#: tfrmeditor.caption
msgctxt "TFRMEDITOR.CAPTION"
msgid "Editor"
msgstr "Editor"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "&Nápověda"
#: tfrmeditor.menuitem1.caption
msgctxt "tfrmeditor.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Upravit"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Kó&dování"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Otevřít jako"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Uložit jako"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Soubor"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Zvýrazňování syntaxe"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Konec řádky"
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n5.caption
msgctxt "TFRMEDITOR.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgid "C&ase sensitivity"
msgstr "&Rozlišovat velikost"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgid "S&earch from caret"
msgstr "H&ledat od ukazatele"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgid "&Regular expressions"
msgstr "&Regulární výrazy"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgid "Selected &text only"
msgstr "Pouze vybraný &text"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgid "&Whole words only"
msgstr "&Pouze celá slova"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgid "Option"
msgstr "Možnost"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgid "&Replace with:"
msgstr "&Nahradit čím:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgid "&Search for:"
msgstr "&Vyhledat:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgid "Direction"
msgstr "Směr"
#: tfrmextractdlg.caption
msgid "Unpack files"
msgstr "Rozbalení souborů"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Rozbalit i s cestou, pokud je uložena"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Rozbalit do oddělených po&dadresářů (podle názvu archívu)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "P&řepsat existující soubory"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Do &adresáře:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "Rozbalit soubory odpovídající masc&e souborů:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "&Heslo pro šifrované soubory:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavřít"
#: tfrmfileexecuteyourself.caption
msgid "Wait..."
msgstr "Čekejte..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Název souboru:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "Z:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Klikněte na Zavřít, až bude moci být odstraněn dočasný soubor!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&Na panel"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Zobrazit vše"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Aktuální operace:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Z:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Do:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavřít"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "&Nastavení vlastností"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Nastavit na &všech vybraných souborech"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Pře&skočit tento soubor"
#: tfrmfileproperties.caption
msgctxt "TFRMFILEPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Vlastnosti"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Sticky"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Vlastník"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitů:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Skupina"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ostatní"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlastník"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Text:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Obsahuje:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Spustit"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Název souboru"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Název souboru"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Cesta:"
#: tfrmfileproperties.lblgroupstr.caption
msgid "&Group"
msgstr "&Skupina"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Poslední přístup:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Poslední změna:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Poslední změna stavu:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Osmičkově:"
#: tfrmfileproperties.lblownerstr.caption
msgid "O&wner"
msgstr "V&lastník"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čtení"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Velikost:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Sym. odkaz na:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Typ:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zápis"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Název"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Hodnota"
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributy"
#: tfrmfileproperties.tsplugins.caption
#, fuzzy
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Doplňky"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Vlastnosti"
#: tfrmfinddlg.actcancel.caption
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "Z&rušit"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "&Zavřít"
#: tfrmfinddlg.actclose.caption
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "Zavřít"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Nastavit klávesové zkratky"
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Upravit"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "Výsledek do &okna"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr "Zrušit hledání, zavřít a uvolnit paměť"
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr "Pro všechny ostatní \"Najít soubory\", zrušit, zavřít a uvolnit paměť"
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Jdi k souboru"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Najít data"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Poslední hledání"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Nové hledání"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr "Nové hledání (vymazat filtry)"
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Jít na stránku \"Pokročilé\""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Jít na stránku \"Načíst/Uložit\""
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Jít na stránku \"Doplňky\""
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Jít na stránku \"Výsledky\""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Jít na stránku \"Standardní\""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Spustit"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Zobrazit"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Přidat"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Nápověda"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Uložit"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Vymazat"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "&Načíst"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "&Uložit"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Ulo&žit s \"Začátek v adresáři\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Pokud je uloženo, pak \"Začátek v adresáři \" se obnoví při načítání šablony. Použijte, pokud chcete opravit hledání v určitém adresáři"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Použít šablonu"
#: tfrmfinddlg.caption
msgctxt "TFRMFINDDLG.CAPTION"
msgid "Find files"
msgstr "Hledat soubory"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Rozlišovat velikost"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "&Datum od:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Dat&um do:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "V&elikost od:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Ve&likost do:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "&Hledat v archivech"
#: tfrmfinddlg.cbfindtext.caption
msgid "Find &text in file"
msgstr "Vyhledat &text"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgid "Follow s&ymlinks"
msgstr "Následovat s&ymbolické odkazy"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgid "Find files N&OT containing the text"
msgstr "Hledat soubory NEobsahující text"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "N&ení starší, než:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Otevřené záložky"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Hled&at části jména souboru"
#: tfrmfinddlg.cbregexp.caption
msgid "&Regular expression"
msgstr "&Regulární výrazy"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "Nahradit &pomocí"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Vybrané adresáře a &soubory"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "R&egulární výrazy"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "&Čas od:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "Ča&s do:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "Po&užít vyhledávací doplněk:"
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Zadejte názvy adresářů, které mají být vyloučeny z hledání, oddělených \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Zadejte názvy souborů, které mají být vyloučeny z hledání, oddělených \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Zadejte názvy souborů oddělených s \";\""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION"
msgid "Directories"
msgstr "Adresáře"
#: tfrmfinddlg.gbfiles.caption
msgctxt "TFRMFINDDLG.GBFILES.CAPTION"
msgid "Files"
msgstr "Soubory"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Vyhledávat v obsahu"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Atri&buty"
#: tfrmfinddlg.lblencoding.caption
msgid "Encodin&g:"
msgstr "Kódován&í:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "V&yloučené podadresáře"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "&Vyloučené soubory"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "Souborová maska"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Spustit v a&dresáři"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Prohledat po&dadresáře:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Předchozí hledání:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr "&Akce"
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr "Pro všechny ostatní, zrušit, zavřít a uvolnit paměť"
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Otevřít v nové záložce"
#: tfrmfinddlg.mioptions.caption
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Možnosti"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Odebrat ze seznamu"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr "&Výsledek"
#: tfrmfinddlg.miseparator1.caption
msgctxt "tfrmfinddlg.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.miseparator2.caption
msgctxt "tfrmfinddlg.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Zobrazit všechny nalezené položky"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Ukázat v editoru"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Zobrazit v prohlížeči"
#: tfrmfinddlg.miviewtab.caption
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Zobrazit"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Rozšířené"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Načíst/uložit"
#: tfrmfinddlg.tsplugins.caption
msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Doplňky"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Výsledky"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Standard"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Hledat"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Hledat"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "C&itlivé na velikost znaků"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Vytvořit hardlink"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Cíl, na který bude odkaz ukazovat"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "&Název odkazu"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTALL.CAPTION"
msgid "Import all!"
msgstr "Importovat vše!!"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTIONDONE.CAPTION"
msgid "Import selected"
msgstr "Importovat vybrané"
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr "Vyberte položky, které chcete importovat"
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Při kliknutí na podnabídku, bude vybrána celá nabídka"
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Podržte CTRL a klikejte pro vybrání vycenásebných položek"
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgid "Linker"
msgstr "Spojování souborů"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Uložit do..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Položka"
#: tfrmlinker.lblfilename.caption
msgid "&File name"
msgstr "&Název souboru"
#: tfrmlinker.spbtndown.caption
msgid "Do&wn"
msgstr "Do&lů"
#: tfrmlinker.spbtndown.hint
msgid "Down"
msgstr "Dolů"
#: tfrmlinker.spbtnrem.caption
msgctxt "TFRMLINKER.SPBTNREM.CAPTION"
msgid "&Remove"
msgstr "&Smazat"
#: tfrmlinker.spbtnrem.hint
msgctxt "TFRMLINKER.SPBTNREM.HINT"
msgid "Delete"
msgstr "Vymazat"
#: tfrmlinker.spbtnup.caption
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "&Nahoru"
#: tfrmlinker.spbtnup.hint
msgid "Up"
msgstr "Nahoru"
#: tfrmmain.actabout.caption
msgid "&About"
msgstr "&O programu"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Přidat název souboru do příkazového řádku"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr "Žádost nového hledání..."
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Uložit cestu a název souboru do příkazového řádku"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Kopírovat cestu do příkazového řádku"
#: tfrmmain.actbriefview.caption
msgid "Brief view"
msgstr "Stručné zobrazení"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Stručné zobrazení"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Spočítat &obsazené místo..."
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Změnit adresář"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Přejde do domácího adresáře"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Změnit adresář na nadřazený"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Jít do kořenového adresáře disku"
#: tfrmmain.actchecksumcalc.caption
msgid "Calculate Check&sum..."
msgstr "Spočítat kontrolní &součet..."
#: tfrmmain.actchecksumverify.caption
msgid "&Verify Checksum..."
msgstr "&Ověřit kontrolní součet..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Vyčistit soubor protokolu"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Vymazat okno protokolu"
#: tfrmmain.actclosealltabs.caption
msgid "Close &All Tabs"
msgstr "Zavřít &všechny záložky"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Zavřít duplicitní záložky"
#: tfrmmain.actclosetab.caption
msgid "&Close Tab"
msgstr "&Zavřít záložku"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Další příkazová řádka"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Nastavení příkazového řádku na následující příkaz v historii"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Předchozí příkazová řádka"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Nastavení příkazového řádku na předchozí příkaz v historii"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Plný"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Sloupcové zobrazení"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Porovnat pod&le obsahu"
#: tfrmmain.actcomparedirectories.caption
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
msgid "Compare Directories"
msgstr "Porovnat adresáře"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Porovnat adresáře"
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "TFRMMAIN.ACTCONFIGDIRHOTLIST.CAPTION"
msgid "Configuration of Directory Hotlist"
msgstr "Nastavit rychlé adresáře"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Nastavit oblíbené záložky"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Nastavit adresáře záložek"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Nastavení klávesových zkratek"
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Uložit nastavení"
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr "Nastavit hledání"
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Nástrojová lišta"
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Nastavení stromové nabídky"
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Nastavení barev stromové nabídky"
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Zobrazit místní nabídku"
#: tfrmmain.actcopy.caption
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Kopírovat všechny záložky na druhou stranu"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Kopí&rovat všechny zobrazené sloupce"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Kopírovat název(y) souboru(ů) s úplnou &cestou"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Kopírovat název(y) souboru(ů) do schránky"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Kopírovat soubory bez dotazu na potvrzení"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr "Kopírovat úplnou cestu k vybraným souborům bez posledního oddělovače adresářů"
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Kopírovat úplnou cestu k vybraným souborům"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Kopírovat do stejného panelu"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "Kopírovat"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Zo&brazit obsazené místo"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Vyjmout"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Zobrazit parametry příkazu"
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Vymazat"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr "Pro všechny hledání, zrušit, zavřit a uvolnit paměť"
#: tfrmmain.actdirhistory.caption
msgid "Directory history"
msgstr "Historie adresářů"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "&Rychlé adresáře"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Vybrat jakýkoliv příkaz a spustit ho"
#: tfrmmain.actedit.caption
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Upravit"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Upravit ko&mentář..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Editovat nový soubor"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Upravit cestu pole nad souborem seznamu"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Zaměnit &panely"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr "Spustit skript"
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Konec"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "&Rozbalit soubory..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Konfigurov&at přidružení souboru"
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "Spojit sou&bory..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Zobrazit &vlastnosti souboru"
#: tfrmmain.actfilespliter.caption
msgid "Spl&it File..."
msgstr "Rozděl&it soubor..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "Pří&mé zobrazení"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Zaměřit příkazový řádek"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Umístit kurzor na první soubor v seznamu"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Umístit kurzor na poslední soubor v seznamu"
#: tfrmmain.acthardlink.caption
msgid "Create &Hard Link..."
msgstr "Vytvořit &hardlink..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Obsah"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "&Vodorovný režim panelů"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Klávesnice"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Stručné zobrazení v levé záložce"
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Sloupcové zobrazení v levé záložce"
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Levý &= Pravý"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "&Přímé zobrazení v levé záložce"
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Otevřít levý seznam disků"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Opačné pořadí v le&vé záložce"
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Seřadit levou záložku podle &atributů"
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Seřadit levou záložku podle &datumu"
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "S&eřadit levou záložku podle přípony"
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "Seřadit levou záložku podle &názvu"
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Seřadit levou záložku podle veliko&sti"
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Zobrazit miniatury v levé záložce"
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "Načíst záložku z oblíbených"
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Načíst výběr ze schrán&ky"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "&Načíst výběr ze souboru..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "Načíst zá&ložky ze souboru"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "Vytvořit a&dresář"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Vybrat vše se stejnou &příponou"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr "Vybrat všechny soubory s stejným názvem"
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr "Vybrat všechny soubory s stejným názvem a příponou"
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr "Vybrat vše v stejné cestě"
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "Převrát&it výběr"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "&Vybrat vše"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "Zrušit výběr sk&upiny..."
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "Výběr &skupiny..."
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "&Zrušit výběr všeho"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimalizovat okno"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Nástroj pro h&romadné přejmenování"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "&Připojit síť..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "&Odpojit síť"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Síť &rychle připojit..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Nová záložka"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr "Načíst následující oblíbenou záložku v seznamu"
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Přepnou&t do nové záložky"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Otevřít"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Zkusit otevřít archív"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Otevřít bar soubor"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Otevřít &adresář v nové záložce"
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgid "Open &VFS List"
msgstr "Otevřít &VFS seznam"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "P&rohlížeč operací"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "M&ožnosti..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "&Zabalit soubory..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Nastavit pozici dělící čáry"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "Vložit"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Načíst předchozí oblíbenou záložku v seznamu"
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Přepno&ut do předešlé záložky"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Rychlý filtr"
#: tfrmmain.actquicksearch.caption
msgid "Quick search"
msgstr "Rychlé hledání"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "&Panel rychlého prohlížení"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Obnovit"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Znovu načíst posledně načtené oblíbené záložky"
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Přesunout"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Přesunout/přejmenovat soubory bez dotazu na potvrzení"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Přejmenovat"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "&Přejmenovat záložku"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Znovu uložit do posledně načtené oblíbené záložky"
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Obnovit výběr"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "O&brácené pořadí"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Stručné zobrazení v pravé záložce"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Sloupcové zobrazení v pravé záložce"
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Pravý &= Levý"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "&Přímé zobrazení v pravé záložce"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Otevřít pravý seznam disků"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "Opačné pořadí v pra&vé záložce"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Seřadit pravou záložku podle &atributů"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Seřadit pravou záložku podle &datumu"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "S&eřadit pravou záložku podle přípony"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Seřadit pravou záložku podle &názvu"
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Seřadit pravou záložku podle veliko&sti"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Zobrazit miniatury v pravé záložce"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Spustit &terminál"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Uložit aktuální záložku mezi oblíbené"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Uložit &výběr"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Uložit vý&běr do souboru..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "Uložit záložky do &souboru"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Hledat..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Uzamknout všechny záložky s otevřením adresáře v nové záložce "
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Nastavit všechny záložky na Normální"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Nastavit všechny záložky na Uzamčeno"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Uzamknout všechny záložky s povolením změny adresáře"
#: tfrmmain.actsetfileproperties.caption
msgid "Change &Attributes..."
msgstr "Změnit &atributy..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Uzamčeno s otevřením adresáře v nové &záložce"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normální"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Uzamčeno"
#: tfrmmain.actsettaboptionpathresets.caption
msgid "Locked with &Directory Changes Allowed"
msgstr "Uzamčeno s povolenou změnou a&dresáře"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Otevřít"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Otevřít s pomocí přidružení nastavených v systému"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Zobrazit tlačítkovou nabídku"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Zobrazit historii příkazového řádku"
#: tfrmmain.actshowmainmenu.caption
msgid "Menu"
msgstr "Nabídka"
#: tfrmmain.actshowsysfiles.caption
msgid "Show &Hidden/System Files"
msgstr "&Zobrazit skryté/systémové soubory"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Řadit podle &atributů"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Řadit podle &data"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Řadit podl&e přípony"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Řadit podle &názvu"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Řadit podle veliko&sti"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Otevřít seznam disků"
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Povolit/zakázat seznam ignorování souborů, aby nezobrazoval jména souborů"
#: tfrmmain.actsymlink.caption
msgid "Create Symbolic &Link..."
msgstr "Vytvořit symbolický o&dkaz..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr "Synchronizovat adresáře..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Cíl &= Zdroj"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "&Testovat archív(y)"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Miniatury"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Zobrazení miniatur"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr "Přepnout režim konzoly na celou obrazovku"
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Přenést adresář pod kurzorem do levého okna"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Přenést adresář pod kurzorem do pravého okna"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "S&tromové zobrazení"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr "Seřadit podle parametrů"
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Zrušit označení všech se stejnou &příponou"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr "Zrušit označení všech souborů s stejným názvem"
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr "Zrušit označení všech souborů s stejným názvem a příponou"
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr "Zrušit označení všech v stejné cestě"
#: tfrmmain.actview.caption
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Zobrazit"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Zobrazit historii navštívených cest pro aktivní pohled"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Jít na další položku v historii"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Jít na předchozí položku v historii"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Zobrazit soubor protokolu"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr "Zobrazit aktuální hledání"
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "Na&vštívit domovskou stránku"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Nevratně smazat"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr "Pracovat s rychlýma adresářema a parametrama"
#: tfrmmain.btnf10.caption
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Ukončit"
#: tfrmmain.btnf7.caption
msgctxt "TFRMMAIN.BTNF7.CAPTION"
msgid "Directory"
msgstr "Adresář"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Vymazat"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminál"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Rychlé adresáře"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Zobrazit aktuální adresář pravého panelu na levém panelu"
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Jít do domovského adresáře"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Jít do kořenového adresáře"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Jít do nadřízeného adresáře"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Rychlé adresáře"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Zobrazit aktuální adresář levého panelu na pravém panelu"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Cesta"
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Zrušit"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Kopírovat..."
#: tfrmmain.mihardlink.caption
msgid "Create link..."
msgstr "Vytvořit odkaz..."
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline10.caption
msgctxt "tfrmmain.miline10.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline11.caption
msgctxt "tfrmmain.miline11.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline21.caption
msgctxt "tfrmmain.miline21.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline23.caption
msgctxt "tfrmmain.miline23.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline26.caption
msgctxt "tfrmmain.miline26.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline33.caption
msgctxt "TFRMMAIN.MILINE33.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline37.caption
msgctxt "TFRMMAIN.MILINE37.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline38.caption
msgctxt "TFRMMAIN.MILINE38.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline39.caption
msgctxt "tfrmmain.miline39.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline40.caption
msgctxt "tfrmmain.miline40.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline50.caption
msgctxt "TFRMMAIN.MILINE50.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline55.caption
msgctxt "tfrmmain.miline55.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Vymazat"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Skrýt"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Vybrat vše"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Přesunout..."
#: tfrmmain.misymlink.caption
msgid "Create symlink..."
msgstr "Vytvořit symbolický odkaz..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Možnosti záložky"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Konec"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Obnovit"
#: tfrmmain.mnualloperpause.caption
msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Začátek"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Zrušit"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Příkazy"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "N&astavení"
#: tfrmmain.mnucontextline1.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mnucontextline2.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Oblíbené"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Soubory"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "&Nápověda"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Označit"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Síť"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Zobrazit"
#: tfrmmain.mnutaboptions.caption
msgid "Tab &Options"
msgstr "M&ožnosti záložky"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Záložky"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Vyjmout"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Vymazat"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Upravit"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Vložit"
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr "Vyberte vnitřní příkaz"
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Starší řazení"
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
msgid "Legacy sorted"
msgstr "Starší řazení"
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Jako výchozí, vybrat všechny kategorie"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Vybráno:"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "&Kategorie:"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "&Název příkazu:"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Filtr:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Rada:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Klávesová zkratka:"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr "cm_název"
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDCATEGORY.CAPTION"
msgid "Category"
msgstr "Kategorie"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDHELP.CAPTION"
msgid "Help"
msgstr "Nápověda"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Rada"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "TFRMMAINCOMMANDSDLG.LBLSELECTEDCOMMANDHOTKEY.CAPTION"
msgid "Hotkey"
msgstr "Klávesová zkratka"
#: tfrmmaskinputdlg.btnaddattribute.caption
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Přid&at"
#: tfrmmaskinputdlg.btnattrshelp.caption
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "&Nápověda"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Určit..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Rozlišovat velikost znaků"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr "Ignorovat přízvuky a zpřežky"
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr "Atri&buty:"
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Maska vstupu:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "Ne&bo vyberte předdefinovaný typ výběru:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Vytvořit nový adresář"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "&Zadejte nový název adresáře:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "TFRMMODVIEW.CAPTION"
msgid "New Size"
msgstr "Nová velikost"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Výška :"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Kvalita komprese Jpg"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Šířka :"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Výška"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Šířka"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr "456456465465465"
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavřít"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Vymazat"
#: tfrmmultirename.btnedit.caption
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "&Upravit"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "&Načíst"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Přejmenovat"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Obnovit &vše"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Uložit"
#: tfrmmultirename.caption
msgid "MultiRename"
msgstr "Hromadné přejmenování"
#: tfrmmultirename.cblog.caption
msgid "Ena&ble"
msgstr "Povo&lit"
#: tfrmmultirename.cbregexp.caption
msgid "Regular e&xpressions"
msgstr "&Regulární výrazy"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "Po&užít náhradu"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Přípona"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Počítadlo"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Vyhledat a Nahradit"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Výsledek protokolu"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Maska"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Předvolby"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "&Přípona"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "&Hledat..."
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "&Interval"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "&Název souboru"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "Nah&radit..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "Č&íslovat od"
#: tfrmmultirename.lbwidth.caption
msgid "&Width"
msgstr "&Šířka"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Počítadlo"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Den"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Den (2 cifry)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Den v týdnu (krátký, např. \"pon\")"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Den v týdnu (dlouhý, např.\"pondělí\")"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Znak na pozici x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Znaky od pozice x do y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Hodina"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Hodin (2 cifry)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minuta"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minut (2 cifry)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Měsíc"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Měsíc (2 cifry)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Název měsíce (krátké, např. \"led\")"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Název měsíce (dlouhé, např. \"leden\")"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Název"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Znak na pozici x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Znaky od pozice x do y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Čas..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Přípona..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Název..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Doplněk"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Sekund"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Sekund (2 cifry)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Rok (2 cifry)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Rok (4 cifry)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Upravit jména..."
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Načíst jména ze souboru..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgid "Old File Name"
msgstr "Starý název souboru"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgid "New File Name"
msgstr "Nový název souboru"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgid "File Path"
msgstr "Cesta k souboru"
#: tfrmmultirenamewait.caption
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr "Klikněte OK až uzavřete editor pro načtení změn jmen!"
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Vybrat aplikaci"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Vlastní příkaz"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Uložit přidružení"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Nastavit zvolenou aplikaci jako výchozí akci"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Typ souboru, který se má otevřít: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Několik názvů souborů"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Více URI"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Jeden název souboru"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "Jeden URI"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgid "&Apply"
msgstr "&Použít"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmoptions.caption
msgctxt "TFRMOPTIONS.CAPTION"
msgid "Options"
msgstr "Možnosti"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Prosím, zvolte jednu z podstránek, tato stránka neobsahuje žádné nastavení."
#: tfrmoptionsarchivers.btnautoconfig.caption
msgid "A&uto Configure"
msgstr "N&astavit automaticky"
#: tfrmoptionsarchivers.btnmultiarcadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
msgid "A&dd"
msgstr "P&řidat"
#: tfrmoptionsarchivers.btnmultiarcapply.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCAPPLY.CAPTION"
msgid "A&pply"
msgstr "P&oužít"
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCDELETE.CAPTION"
msgid "D&elete"
msgstr "V&ymazat"
#: tfrmoptionsarchivers.btnmultiarcrename.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
msgid "&Rename"
msgstr "&Přejmenovat"
#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "TFRMOPTIONSARCHIVERS.BTNRELATIVEARCHIVER.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
msgid "De&bug mode"
msgstr "La&dící režim"
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
msgid "E&nabled"
msgstr "P&ovoleno"
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
msgid "S&how console output"
msgstr "U&kázat výstup konzoly"
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
msgid "Options"
msgstr "Možnosti"
#: tfrmoptionsarchivers.lblarchiveadd.caption
msgid "Add&ing:"
msgstr "Př&idat:"
#: tfrmoptionsarchivers.lblarchiveextension.caption
msgid "E&xtension:"
msgstr "P&řípona:"
#: tfrmoptionsarchivers.lblarchiveextract.caption
msgid "Ex&tract:"
msgstr "Rozbali&t:"
#: tfrmoptionsarchivers.lblarchivelist.caption
msgid "&List:"
msgstr "&Seznam:"
#: tfrmoptionsarchivers.lblarchivelistend.caption
msgid "Listing &finish (optional):"
msgstr "Konec &výpisu (volitelné):"
#: tfrmoptionsarchivers.lblarchivelistformat.caption
msgid "Listing for&mat:"
msgstr "Form&át výpisu:"
#: tfrmoptionsarchivers.lblarchiveliststart.caption
msgid "Listin&g start (optional):"
msgstr "Začáte&k výpisu (volitelné):"
#: tfrmoptionsarchivers.lblarchiver.caption
msgid "Arc&hiver:"
msgstr "Arch&ivátor:"
#: tfrmoptionsarchivers.lbldescription.caption
msgid "De&scription:"
msgstr "Po&pis:"
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgid "Additional"
msgstr "Přídavné"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
msgid "General"
msgstr "Obecné"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgid "When &size, date or attributes change"
msgstr "Při změně &velikosti, data, nebo atributů"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Pro následující &cesty a jejich podadresáře:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgid "When &files are created, deleted or renamed"
msgstr "Při vytvoření, smazání, nebo přejmenování &souborů"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgid "When application is in the &background"
msgstr "Když je aplikace na &pozadí"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgid "Disable auto-refresh"
msgstr "Zakázat automatické obnovení"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgid "Refresh file list"
msgstr "Obnovit seznam souborů"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgid "Al&ways show tray icon"
msgstr "Vž&dy zobrazit ikonu v oznamovací oblasti"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Automaticky &skrýt nepřipojená zařízení"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgid "Mo&ve icon to system tray when minimized"
msgstr "Přesunout do oznamo&vací oblasti pokud je minimalizováno"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgid "A&llow only one copy of DC at a time"
msgstr "P&ovolit pouze jednu kopii DC ve stejný čas"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Zde můžete zadat jednu nebo více jednotek nebo připojovacích bodů oddělených \";\"."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "&Seznam zakázaných disků"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Velikost sloupce"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Zobrazit přípony souborů"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "Zarovnat (na konec slou&pce )"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "Přímo za názvem soubo&ru"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Automaticky"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Počet pevných sloupců"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Pevná šířka sloupce"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "Oříznout &text na šířku sloupce"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "&Vodorovné čáry"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "&Svislé čáry"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "A&utomaticky naplnit sloupce"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Zobrazit mřížku"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Automatická velikost sloupců"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Automatická ve&likost sloupce:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "P&oužít"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "&Upravit"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "Hi&storie příkazového řádku"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgid "&Directory history"
msgstr "&Historie adresářů"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "&Historie použitých masek"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "Ul&ožit nastavení"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "Historie hle&dání/nahrazení"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Adresáře"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Umístění konfiguračních souborů"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Uložit při ukončení"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Řazení pořadí levého konfiguračního stromu"
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Nastavit na příkazové řádce"
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "Adresář p&rogramu (přenosná verze)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "&Domovský adresář uživatele"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFONT.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
msgid "All"
msgstr "Vše"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
msgid "Apply modification to all columns"
msgstr "Provede úpravy pro všechny sloupce"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORBORDERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
msgid "&Delete"
msgstr "&Smazat"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Přejít na nastavení"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
msgid "New"
msgstr "Nový"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "Další"
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "Předchozí"
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
msgid "Rename"
msgstr "Přejmenovat"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORBORDER.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
msgid "R"
msgstr "O"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
msgid "Reset to default"
msgstr "Obnoví na výchozí hodnoty"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
msgid "Save as"
msgstr "Uložit jako"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
msgid "Save"
msgstr "Uložit"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBALLOWOVERCOLOR.CAPTION"
msgid "Allow Overcolor"
msgstr "Povolit barvu přes"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "Při provedení jakékoliv změny ji aplikovat na všechny sloupce"
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
msgid "General"
msgstr "Obecné"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCURSORBORDER.CAPTION"
msgid "Cursor border"
msgstr "Ohraničení kurzoru"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Použít ohraničení kurzoru"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Použít barvu neaktivního výběru"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Použít obrácený výběr"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Použít vlastní písmo a barvu pro toto zobrazení"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgid "BackGround:"
msgstr "Pozadí:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgid "Background 2:"
msgstr "Pozadí 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Kon&figurace sloupcového zobrazení:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Jméno aktuálního sloupce]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgid "Cursor Color:"
msgstr "Barva kurzoru:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgid "Cursor Text:"
msgstr "Text kurzoru:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgid "Font:"
msgstr "Písmo:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
msgid "Size:"
msgstr "Velikost:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgid "Text Color:"
msgstr "Barva písma:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Barva neaktivního kurzoru:"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Barva neaktivního označení:"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgid "Mark Color:"
msgstr "Barva označených:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLPREVIEWTOP.CAPTION"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Níže je náhled. Můžeme pohybovat kurzorem a vybrat soubory, a okamžitě získáme aktuální vzhled podle různých nastavení."
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Nastavení pro sloupec:"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgid "Add column"
msgstr "Přidat sloupec"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Umístění záložky v rámu po porovnání:"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgid "Add a copy of the selected entry"
msgstr "Přidat kopii vybrané položky"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgid "Add a separator"
msgstr "Přidat oddělovač"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgid "Add directory I will type"
msgstr "Přidat adresář, budeme dopňovat"
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Sbalit vše"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Smazat vybranou položku"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgid "Insert directory I will type"
msgstr "Vložit adresář, budeme doplňovat"
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Otevřít všechny položky"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Přidat..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Zálohovat..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Vymazat..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Exportovat..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "Nápověda"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Importovat..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Vložit..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "Různé..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgid "Some functions to select appropriate target"
msgstr "Některé funkce pro výběr příslušného cíle"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Seřadit..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "Když přidávám adresář, přidat také cíl"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Vždy rozbalit strom"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Zobrazit pouze ověřenou proměnnou prostředí"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr "V roletovém menu, zobrazit [také cestu]"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRPATH.TEXT"
msgid "Name, a-z"
msgstr "Název, a-z"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr "Název, a-z"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Rychlé adresáře (lze přeskupit přetáhnutím)"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Další možnosti"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr "Název:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr "Cesta:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgid "&Target:"
msgstr "Cíl:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "...pouze aktuální úroveň z vybraných položek "
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Prohledat všechny cesty rychlých adresářů pro ověření že skutečně existují"
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "Prohledat všechny cesty a cíle rychlých adresářů pro ověření že skutečně existují"
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "do adresáře souboru hotlist (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "do \"wincmd.ini\" z TC (neměnit existující)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "do \"wincmd.ini\" z TC (smazat existující)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "jít k souvisejícím konfiguracím TC"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
msgid "Go to &configure TC related info"
msgstr "jít k souvisejícím konfiguracím TC"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "TestovacíNabídkaRychléhoAdresáře"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "z adresáře souboru hotlist (.hotlist)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "z \"wincmd.ini\" od TC"
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "obnovit zálohu adresáře hotlist"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "uložit zálohu aktuálního adresáře hotlist"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Vyhledat a nahradit..."
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...vše, od A do Z!"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "...pouze jednu skupinu položek"
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "...obsah vybrané podnabídky, ne podúrovně"
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "...obsah vybrané podnabídky, a všech podúrovní"
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MITESTRESULTINGHOTLISTMENU.CAPTION"
msgid "Test resultin&g menu"
msgstr "Otestovat výsledné zobrazení nabídky"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr "Přidá z hlavního panelu:"
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Vždy se zeptat, který z podporovaných formátů se má použít"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Při ukládání textu Unicode ho uloží ve formátu UTF8 (jinak v UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Po upuštění textu, generovat název souboru automaticky (jinak vyzve uživatele)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "&Zobrazit potvrzovací dialog po upuštění"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Když přetáhnete text na záložky:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Umístěte nejžádanější formát v seznamu nahoru (použijte přetáhnutí):"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(v případě, že nejžádanější není přítomen, vezmeme druhý formát atd.)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(pokud nastane z nějakého důvodu problém s aplikací, zkuste zrušit zaškrtnutí)"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Zobrazit &souborový systém"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Zobrazit vol&né místo"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Zobrazit &štítek"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Seznam disků"
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Stříšku podél konci řádku"
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Zobrazit speciální znaky"
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Možnosti interního editoru"
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Po&zadí"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "Po&zadí"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Obnovit"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr "Uložit"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Atributy prvku"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Po&předí"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "Po&předí"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "&Text-značka"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Použít (a upravit) &globální systém nastavení"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Použít &místní systém nastavení"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Tučný"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Pře&vrátit"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Vy&pnout"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "Za&pnout"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Kurzíva"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Pře&vrátit"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Vy&pnout"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "Za&pnout"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "&Vyškrtnout"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Pře&vrátit"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "Vy&pnout"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "Za&pnout"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "&Podtrhnout"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "Pře&vrátit"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "Vy&pnout"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "Za&pnout"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr "Přidat..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr "Vymazat..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Importovat/Exportovat"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr "Vložit..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Přejmenovat"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr "Seřadit..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Žádná"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr "Vždy rozbalit strom"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Ne"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Levý"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Pravý"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Seznam oblíbených záložek (lze přeskupit přetáhnutím)"
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr "Další možnosti"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr "Co kam obnovit pro vybranou položku:"
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Zachovat existující záložku:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Uložit historii adresáře:"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr "Záložky uložené vlevo budou obnoveny do:"
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr "Záložky uložené vpravo budou obnoveny do:"
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr "oddělovač"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Přidat oddělovač"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr "podnabídku"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr "Přidat podnabídku"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr "Sbalit vše"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr "...pouze aktuální úroveň z vybraných položek"
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Vyjmout"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr "vymazat vše!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr "podnabídku a všechny její prvky"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr "jen podnabídky, prvky zůstanou"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr "vybranou položku"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr "Smazat vybranou položku"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr "Exportovat zvolené do starších souborů .tab"
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr "FavoriteTabsTestMenu"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr "Importovat starší .tab soubor(y) podle výchozího nastavení"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Importovat starší .tab soubor(y) na vybranou pozici"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Importovat starší .tab soubor(y) na vybranou pozici"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr "Importovat starší .tab soubor(y) na vybranou pozici v podnabídce"
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Vložit oddělovač"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Vložit podnabídku"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr "Otevřít všechny položky"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Vložit"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Přejmenovat"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr "...vše, od A do Z!"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr "...pouze jednu skupinu položek"
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr "Seřadit pouze jednu skupinu položek"
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "...obsah vybrané podnabídky, ne podúrovně"
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "...obsah vybrané podnabídky, a všech podúrovní"
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr "Otestovat výsledné zobrazení nabídky"
#: tfrmoptionsfileassoc.btnaddact.caption
msgid "Add"
msgstr "Přidat"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
msgid "&Add"
msgstr "&Přidat"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
msgid "A&dd"
msgstr "P&řidat"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr "Klonovat"
#: tfrmoptionsfileassoc.btndownact.caption
msgid "&Down"
msgstr "&Dolů"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION"
msgid "Edit"
msgstr "Upravit"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Vložit"
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION"
msgid "Insert"
msgstr "Vložit"
#: tfrmoptionsfileassoc.btnremoveact.caption
msgid "Remo&ve"
msgstr "Sma&zat"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgid "Re&move"
msgstr "Sm&azat"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
msgid "&Remove"
msgstr "&Smazat"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNRENAMETYPE.CAPTION"
msgid "R&ename"
msgstr "Př&ejmenovat"
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
msgid "&Up"
msgstr "&Nahoru"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr "Výchozí cesta k příkazu. Nikdy tento řetězec nevkládat do uvovozovek."
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr "Název akce. Není nikdy předán do systému, je to jen symbolické jméno vybrané od vás, pro vás"
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr "Parametr bude předán příkazu. Dlouhý název s mezerami by měly být uzavřen do uvozovek."
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr "Příkaz k vykonání. Dlouhý název s mezerou by měly být uzavřen do uvozovek."
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr "Popis akce:"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "TFRMOPTIONSFILEASSOC.GBACTIONS.CAPTION"
msgid "Actions"
msgstr "Akce"
#: tfrmoptionsfileassoc.gbexts.caption
msgid "Extensions"
msgstr "Přípony"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Může být seřazeno přetáhnutím"
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "TFRMOPTIONSFILEASSOC.GBFILETYPES.CAPTION"
msgid "File types"
msgstr "Typy souborů"
#: tfrmoptionsfileassoc.gbicon.caption
msgid "Icon"
msgstr "Ikona"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Akce mohou být seřazeny přetáhnutím"
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Přípony mohou být seřazeny přetáhnutím"
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Typy souborů mohou být seřazeny přetáhnutím"
#: tfrmoptionsfileassoc.lblaction.caption
msgid "Action name:"
msgstr "Název akce:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgid "&Command:"
msgstr "&Příkaz:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "TFRMOPTIONSFILEASSOC.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parametr&y:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "TFRMOPTIONSFILEASSOC.LBLSTARTPATH.CAPTION"
msgid "Start pat&h:"
msgstr "Výchozí cest&a:"
#: tfrmoptionsfileassoc.menuitem1.caption
msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Vlastní s..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Vlastní"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
msgid "Edit"
msgstr "Upravit"
#: tfrmoptionsfileassoc.mieditor.caption
msgid "Open in Editor"
msgstr "Otevřít v editoru"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Upravit s..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgid "Get output from command"
msgstr "Získat výstup příkazu"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Otevřít s vnitřním editorem"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Otevřít s vnitřním prohlížečem"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
msgid "Open"
msgstr "Otevřít"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Otevřít s..."
#: tfrmoptionsfileassoc.miseparator.caption
msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgid "Run in terminal"
msgstr "Spustit v terminálu"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
msgid "View"
msgstr "Zobrazit"
#: tfrmoptionsfileassoc.miviewer.caption
msgid "Open in Viewer"
msgstr "Otevřít v prohlížeči"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Zobrazit s..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Klikni pro změnu ikony!"
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXECUTEVIASHELL.CAPTION"
msgid "Execute via shell"
msgstr "Spustit přes shell"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Rozšířená místní nabídka"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXTENDEDCONTEXTMENU.HINT"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Při přidružení souboru, nabídne přidat aktuální vybraný soubor, pokud již není zahrnut v seznamu nakonfigurovaných typů souboru"
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Konfigurační soubor přidružení"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr "Nabídnout přidání přidružení souboru, pokud již není zahrnutý"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Při přidružení souboru, nabídne přidat aktuální vybraný soubor, pokud již není zahrnut v seznamu nakonfigurovaných typů souboru"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBOPENSYSTEMWITHTERMINALCLOSE.CAPTION"
msgid "Execute via terminal and close"
msgstr "Spustit přes terminál a zavřít"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBOPENSYSTEMWITHTERMINALSTAYOPEN.CAPTION"
msgid "Execute via terminal and stay open"
msgstr "Spustit přes terminál a ponechat otevřený"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Rozšířené položky:"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgid "Show confirmation window for:"
msgstr "Zobrazit potvrzovací okno pro:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Kopí&rovat operaci"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "&Smazat operaci"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Odstra&nit do koše (klávesa Shift převrací toto nastavení)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "V&yhodit operaci do koše"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgid "D&rop readonly flag"
msgstr "Z&rušit příznak jen pro čtení"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "&Přesunout operaci"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "&Zpracovat komentáře složek/souborů"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Při přejmenování vybrat pouze název &souboru (bez přípony)"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Zobra&zit výběr záložky v dialogu kopírovat/přesunout"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "P&řeskočit chyby a zapsat je do okna protokolu"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Provádění operací"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Uživatelské rozhraní"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "&Velikost vyrovnávací paměti pro operace se soubory (v KB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr "Velikost vyrovnávací paměti pro výpočet &hash (v KB):"
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Zobrazit pokrok v operacích &zpočátku v"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgid "Duplicated name auto-rename style:"
msgstr "Styl stejného názvu souboru u automatického přejmenování:"
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "&Počet nevratně mazacích průchodů:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Obnovit DC na výchozí"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION"
msgid "Allow Overcolor"
msgstr "Povolit barvu přes"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Použít oh&raničení kurzoru"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Použít ukazatel &barevného přechodu"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Barva pro výběr neaktivního"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "P&oužít obrácený výběr"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION"
msgid "Cursor border"
msgstr "Ohraničení kurzoru"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr "Ukazatel volného místa na disku "
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "Poz&adí:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgid "Backg&round 2:"
msgstr "Poz&adí 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgid "C&ursor Color:"
msgstr "B&arva kurzoru:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgid "Cursor Te&xt:"
msgstr "Te&xt kurzoru:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION"
msgid "Inactive Cursor Color:"
msgstr "Barva neaktivního kurzoru:"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION"
msgid "Inactive Mark Color:"
msgstr "Barva neaktivního označení:"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "&Úroveň jasu neaktivního panelu"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Uka&zatel barvy pozadí:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "U&kazatel barvy popředí:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgid "&Mark Color:"
msgstr "&Barva označených:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "Níže je náhled. Můžeme pohybovat kurzorem a vybrat soubory, a okamžitě získáme aktuální vzhled podle různých nastavení."
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgid "T&ext Color:"
msgstr "B&arva písma:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr "Při spuštění hledání souboru, vymazat filtr souborové masky"
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "&Hledat část jména souboru"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr "Zobrazit hlavní nabídku v \"Hledat soubory\""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr "Hledání textu v souborech"
#: tfrmoptionsfilesearch.gbfilesearch.caption
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Hledání souborů"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr "Aktuální filtry s tlačítkem \"Nové hledání\":"
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr "Výchozí šablona vyhledávání:"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Použít mapování paměti pro hledání te&xtu v souborech"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "&Použit proud pro hledání textu v souborech"
#: tfrmoptionsfilesviews.btnaddattribute.caption
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "Přid&at"
#: tfrmoptionsfilesviews.btnattrshelp.caption
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "&Nápověda"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr "Umožnit &přechod do nadřazené složky, poklikáním na prázdnou část prohlížení souboru"
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "Nevklá&dat seznam souborů, dokud se karta neaktivuje"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "N&ázvy adresářů v hranatých závorkách"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Zvý&raznit nové a aktualizované soubory"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Povoli&t při dvojkliknutí na název přejmenování"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgid "Load &file list in separate thread"
msgstr "Načíst &seznam souborů v odděleném vlákně"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgid "Load icons af&ter file list"
msgstr "Načíst ikony p&o seznam souborů"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgid "Show s&ystem and hidden files"
msgstr "Zobrazit s&ystémové a skryté soubory"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "&Při výběru souboru <mezerníkem> posunout kurzor dolů na další soubor, jako při výběru klávesou <Insert>"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr "Styl filtrování Windows při označení souborů (\"*.*\" také vybírá soubory bez přípony, atd.)"
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr "Vždy použít samostatný atributový filtr v dialogovém okně masky"
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formátování"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr "Označení/odznačení položek"
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Řazení"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr "Výchozí hodnota atributové masky:"
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "R&ozlišovat velikost:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Nesprávný formát"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "&Formát data a času:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Formát veli&kosti souboru:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "&Vložit nové soubory:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Řazení a&dresářů:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "&Metoda řazení:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "&Přesun aktualizovaných souborů:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "P&řidat"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "P&oužít"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "V&ymazat"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Šablony..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Barvy typů souborů (lze seřadit přetáhnutím)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "A&tributy kategorií:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Ba&rva kategorie:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
msgid "Category &mask:"
msgstr "&Maska kategorie:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
msgid "Category &name:"
msgstr "&Název kategorie:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "Pí&smo konzoly"
#: tfrmoptionsfonts.lbleditorfont.caption
msgid "&Editor font"
msgstr "Písmo &editoru"
#: tfrmoptionsfonts.lbllogfont.caption
msgid "&Log font"
msgstr "&Písmo protokolu"
#: tfrmoptionsfonts.lblmainfont.caption
msgid "Main &font"
msgstr "Hlavní &písmo"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Písmo cesty"
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Písmo výsledku hledání"
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgid "Viewer&Book Font"
msgstr "&Knižní písmo prohlížeče"
#: tfrmoptionsfonts.lblviewerfont.caption
msgid "&Viewer font"
msgstr "&Písmo prohlížeče"
#: tfrmoptionshotkeys.actaddhotkey.caption
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Přidat z&kratku"
#: tfrmoptionshotkeys.actcopy.caption
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmoptionshotkeys.actdelete.caption
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Odstranit"
#: tfrmoptionshotkeys.actdeletehotkey.caption
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "&Odstranit zkratku"
#: tfrmoptionshotkeys.actedithotkey.caption
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "&Upravit zkratku"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr "Další kategorie"
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr "Předchozí kategorie"
#: tfrmoptionshotkeys.actrename.caption
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Přejmenovat"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr "Obnovit výchozí DC"
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr "Uložit nyní"
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr "Seřadit podle názvu příkazu"
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr "Seřadit podle zkratky (seskupeno)"
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr "Seřadit podle zkratky (jedna na řádek)"
#: tfrmoptionshotkeys.lbfilter.caption
msgid "&Filter"
msgstr "&Filtr"
#: tfrmoptionshotkeys.lblcategories.caption
msgid "C&ategories:"
msgstr "K&ategorie:"
#: tfrmoptionshotkeys.lblcommands.caption
msgid "Co&mmands:"
msgstr "Př&íkazy:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgid "&Shortcut files:"
msgstr "&Soubory zástupců:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr "Seřadi&t:"
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr "Kategorie"
#: tfrmoptionshotkeys.micommands.caption
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Příkaz"
#: tfrmoptionshotkeys.miseparator1.caption
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr "Seřadit"
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Pro následující &cesty a jejich podadresáře:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Zobrazit ikony pro akce v &nabídkách"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr "Zobrazit ikony na tlačítkách"
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgid "Show o&verlay icons, e.g. for links"
msgstr "Zobrazit p&řekryvné i&kony, např. pro odkazy"
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Zakázat speciální ikony"
#: tfrmoptionsicons.gbiconssize.caption
msgid " Icon size "
msgstr " Velikost ikon "
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgid " Show icons to the left of the filename "
msgstr " Zobrazit ikony nalevo od názvu souboru "
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
msgid "A&ll"
msgstr "V&še"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgid "All associated + &EXE/LNK (slow)"
msgstr "Všechny přidružení + &EXE/LNK (pomalé)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgid "&No icons"
msgstr "Bez &ikon"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgid "Only &standard icons"
msgstr "Pouze &standardní ikony"
#: tfrmoptionsignorelist.btnaddsel.caption
msgid "A&dd selected names"
msgstr "P&řidat vybrané názvy"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgid "Add selected names with &full path"
msgstr "Přidat označené názvy s ú&plnou cestou"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignorovat (nezobrazovat) následující soubory a složky:"
#: tfrmoptionsignorelist.lblsavein.caption
msgid "&Save in:"
msgstr "&Uložit v:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Šip&ky vlevo a vpravo mění adresář (jako pohyb v Lynxu)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Psaní"
#: tfrmoptionskeyboard.lblalt.caption
msgid "Alt+L&etters:"
msgstr "Alt+P&ísmena:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+Pís&mena:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "&Písmena:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
msgid "&Flat buttons"
msgstr "&Plochá tlačítka"
#: tfrmoptionslayout.cbflatinterface.caption
msgid "Flat i&nterface"
msgstr "Ploché &rozhraní"
#: tfrmoptionslayout.cbflattoolbar.caption
msgid "Flat b&uttons"
msgstr "Plochá t&lačítka"
#: tfrmoptionslayout.cbfreespaceind.caption
msgid "Show fr&ee space indicator on drive label"
msgstr "Zobrazovat ukazatel vol&ného místa v označení disku"
#: tfrmoptionslayout.cblogwindow.caption
msgid "Show lo&g window"
msgstr "Zobrazit okno protokol&u"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgid "Show panel of operation in background"
msgstr "Zobrazovat panel operací na pozadí"
#: tfrmoptionslayout.cbproginmenubar.caption
msgid "Show common progress in menu bar"
msgstr "Zobrazovat běžný průběh v liště nabídky"
#: tfrmoptionslayout.cbshowcmdline.caption
msgid "Show command l&ine"
msgstr "Zobrazit příkazový řá&dek"
#: tfrmoptionslayout.cbshowcurdir.caption
msgid "Show current director&y"
msgstr "Zobrazit aktuální adresá&ř"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgid "Show &drive buttons"
msgstr "Zobrazit &tlačítka disků"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgid "Show free s&pace label"
msgstr "Zobrazit štítek vol&ného místa"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Zobrazit tlačí&tko seznamu disků"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgid "Show function &key buttons"
msgstr "Zobrazit funkční &tlačítka"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgid "Show &main menu"
msgstr "Zobrazit &hlavní nabídku"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgid "Show tool&bar"
msgstr "Zobrazit &tlačítkovou lištu"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Krátce vypsat &štítek volného místa "
#: tfrmoptionslayout.cbshowstatusbar.caption
msgid "Show &status bar"
msgstr "Zobrazit &stavový řádek"
#: tfrmoptionslayout.cbshowtabheader.caption
msgid "S&how tabstop header"
msgstr "Z&obrazit záhlaví tabulátoru"
#: tfrmoptionslayout.cbshowtabs.caption
msgid "Sho&w folder tabs"
msgstr "Zobrazit &záložky adresářů"
#: tfrmoptionslayout.cbtermwindow.caption
msgid "Show te&rminal window"
msgstr "Zobrazit okno te&rminálu"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Zobrazit 2 seznamy disků (pe&vná šířka, nad souborovými okny)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgid " Screen layout "
msgstr "Vzhled obrazovky"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Zobrazí obsah souboru s protokolem"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Název souboru bude obsahovat datum"
#: tfrmoptionslog.cblogarcop.caption
msgid "&Pack/Unpack"
msgstr "&Komprese/Dekomprese"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Spuštění externího příkazového řádku"
#: tfrmoptionslog.cblogcpmvln.caption
msgid "Cop&y/Move/Create link/symlink"
msgstr "Kopírování/přesun/vytvoření odkazu/s&ymbolický odkaz"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "&Vymazat"
#: tfrmoptionslog.cblogdirop.caption
msgid "Crea&te/Delete directories"
msgstr "Tvor&ba/Mazání adresářů"
#: tfrmoptionslog.cblogerrors.caption
msgid "Log &errors"
msgstr "Zaznamenávat &chyby"
#: tfrmoptionslog.cblogfile.caption
msgid "C&reate a log file:"
msgstr "V&ytvořit soubor protokolu:"
#: tfrmoptionslog.cbloginfo.caption
msgid "Log &information messages"
msgstr "Protokol &informačních zpráv"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Spuštění/vypnutí"
#: tfrmoptionslog.cblogsuccess.caption
msgid "Log &successful operations"
msgstr "Protokol &dokončených operací"
#: tfrmoptionslog.cblogvfs.caption
msgid "&File system plugins"
msgstr "&Doplňky souborového systému"
#: tfrmoptionslog.gblogfile.caption
msgid "File operation log file"
msgstr "Protokol souborových operací"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Protokol operací"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Stav operace"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Odstranit miniatury už existujících souborů"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
msgid "View log file content"
msgstr "Zobrazí obsah souboru s protokolem"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
msgid "Create new with the encoding:"
msgstr "Vytvořit nový s kódováním:"
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Vždy &jít do kořenového adresáře při výměně disků"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Zobrazit &varovné zprávy (pouze tlačítko \"OK\")"
#: tfrmoptionsmisc.chkthumbsave.caption
msgid "&Save thumbnails in cache"
msgstr "&Uložit miniatury ve vyrovnávací paměti"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Miniatury"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr "Komentáře souboru"
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "Exportování/importování TC:"
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
msgid "Default encoding:"
msgstr "Výchozí kódování:"
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Konfigurační soubor:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "Spouštění TC:"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Výstupní cesta nástrojové lišty:"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "pixelů"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Velikost náhledů"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Výběr myší"
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Rolování"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Výběr"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Režim:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "&Řádek po řádku"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Řádek po řádku &s posunem kurzoru"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Stránka po stránce"
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "P&řidat"
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "Kon&figurovat"
#: tfrmoptionsplugins.btnenableplugin.caption
msgid "E&nable"
msgstr "P&ovolit"
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "&Smazat"
#: tfrmoptionsplugins.btntweakplugin.caption
msgid "&Tweak"
msgstr "&Vylepšení"
#: tfrmoptionsplugins.lbldsxdescription.caption
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Vyhle&dávací doplňky umožňují použití při hledání alternativních vyhledávacích algoritmů nebo externích nástrojů (např. \"najít \", atd.)"
#: tfrmoptionsplugins.lblwcxdescription.caption
msgid "Pack&er plugins are used to work with archives"
msgstr "Komp&rimační doplňky pro práci s archívy."
#: tfrmoptionsplugins.lblwdxdescription.caption
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Obsahové dop&lňky umožňují zobrazit rozšířené informace jako jsou MP3 značky nebo atributy obrázků v seznamu souborů, nebo je používat při vyhledávání a s nástrojem hromadného přejmenování"
#: tfrmoptionsplugins.lblwfxdescription.caption
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Doplňky sou&borových systémů umožní přístup na běžně nedostupná média jako jsou například externí zařízení Palm/PocketPC."
#: tfrmoptionsplugins.lblwlxdescription.caption
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Zobra&zovací doplňky umožňují prohlížení souborů jako jsou například obrázky, databáze a podobně v prohlížeči (F3, nebo Ctrl+Q)"
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
msgid "Active"
msgstr "Aktivní"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr "Doplněk"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
msgid "Registered for"
msgstr "Registrováno pro"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr "Název souboru"
#: tfrmoptionsplugins.tsdsx.caption
msgid "&Search plugins (.DSX)"
msgstr "&Vyhledávací doplňky (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
msgid "Pac&ker plugins (.WCX)"
msgstr "Kom&primační doplňky (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
msgid "Content pl&ugins (.WDX)"
msgstr "Obsahové do&plňky (.WDX)"
#: tfrmoptionsplugins.tswfx.caption
msgid "F&ile system plugins (.WFX)"
msgstr "D&oplňky souborových systémů (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
msgid "&Viewer plugins (.WLX)"
msgstr "&Zobrazovací doplňky (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgid "&Beginning (name must start with first typed character)"
msgstr "&Začátek (název musí začínat zadaným znakem)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgid "En&ding (last character before a typed dot . must match)"
msgstr "&Konec (poslední znak před . musí odpovídat zadanému)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Možnosti"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Odpovídá přesně jménu"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Hledat znaky"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Hledání těchto položek"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Neměnit přejmenovaný název pokud odemkneme záložku"
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Aktivovat cílový &panel při kliknutí na jeho libovolnou záložku"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgid "&Show tab header also when there is only one tab"
msgstr "&Zobrazit záložku, i když bude pouze 1"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Zavřít stejné záložky při ukončování aplikace"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgid "Con&firm close all tabs"
msgstr "Potv&rdit uzavření všech záložek"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Potvrdit zavření uzamčené záložky"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr "&Omezit šířku záložky na"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgid "Show locked tabs &with an asterisk *"
msgstr "Zobrazit u uzamčené záložky znak *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgid "&Tabs on multiple lines"
msgstr "&Záložky na více řádků"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&Nahoru otevře novou záložku na pozadí"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgid "Open &new tabs near current tab"
msgstr "Otevřít &novou záložku vedle aktuální"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Znovu použít existující záložku, pokud je to možné"
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgid "Show ta&b close button"
msgstr "Na zálož&kách i tlačítko zavřít"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Vždy ukazovat písmeno jednotky v titulku záložky"
#: tfrmoptionstabs.gbtabs.caption
msgid "Folder tabs headers"
msgstr "Záhlaví záložek"
#: tfrmoptionstabs.lblchar.caption
msgid "characters"
msgstr "znaky"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Akce k provedení když poklikáme na záložku:"
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr "Pozice zá&ložek"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr "Žádná"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Ne"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr "Levý"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr "Pravý"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr "Jít na konfiguraci oblíbených záložek po znovuuložení"
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr "Jít na konfiguraci oblíbených záložek po uložení nové"
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr "Povolit další možnosti oblíbených záložek (volba cílové strany při obnově, atd.)"
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr "Další možnosti pro ukládání nových oblíbených záložek:"
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr "Záhlaví záložek adresářů"
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr "Při obnově záložek, zachovat stávající záložky:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr "Záložky uložené vlevo budou obnoveny:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr "Záložky uložené vpravo budou obnoveny:"
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Ukládat historii adresářů u Oblíbených záložek:"
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr "Výchozí umístění v menu při ukládání nové oblíbené záložky:"
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} zde za normálních okolností znovu předloží příkaz, který chcete spustit v terminálu"
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} zde za normálních okolností znovu předloží příkaz, který chcete spustit v terminálu"
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{command} zde za normálních okolností znovu předloží příkaz, který chcete spustit v terminálu"
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Příkaz pouze pro spuštění terminálu:"
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Příkaz pro spuštění v terminálu a terminál se zavře:"
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Příkaz pro spuštění v terminálu a terminál zůstane otevřený:"
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Příkaz:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Parametry:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Příkaz:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Parametry:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Příkaz:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Parametry:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "K&lonovat tlačítko"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "&Vymazat"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgid "Edit hot&key"
msgstr "Upravit kláveso&vou zkratku"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgid "&Insert new button"
msgstr "&Vložit nové tlačítko"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Vybrat"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOTHER.CAPTION"
msgid "Other..."
msgstr "Ostatní..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr "Odstranit kláveso&vou zkratku"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Navrhnout"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr "DC navrhne popisek založený na typu tlačítka, příkazu a parametru"
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "&Plochá tlačítka"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Oznámit chyby a příkazy"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Zadejte parametry příkazů, každý na samostatném řádku. Stisknutím klávesy F1 zobrazíte nápovědu k parametrům."
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Vzhled"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "&Velikost lišty:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgid "Comman&d:"
msgstr "Příka&z"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parametr&y:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION"
msgid "Help"
msgstr "Nápověda"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Klávesová zkratka:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Ik&ona:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Ve&likost ikony:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgid "Co&mmand:"
msgstr "Pří&kaz:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgid "&Parameters:"
msgstr "&Parametry"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Výchozí cest&a:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "Nástro&jový tip:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "přidat nástrojovou lištu s VŠEMI příkazy DC"
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "pro externí příkaz"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "pro vnitřní příkaz"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "pro oddělovač"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "pro podnabídku nástrojové lišty"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION"
msgid "Backup..."
msgstr "Zálohovat..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION"
msgid "Export..."
msgstr "Exportovat..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Aktuální nástrojovou lištu..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
msgid "to a Toolbar File (.toolbar)"
msgstr "do souboru nástrojové lišty (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
msgid "to a TC .BAR file (keep existing)"
msgstr "do souboru .BAR z TC (neměnit existující)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
msgid "to a TC .BAR file (erase existing)"
msgstr "do souboru .BAR z TC (smazat existující)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "do \"wincmd.ini\" z TC (neměnit existující)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "do \"wincmd.ini\" z TC (smazat existující)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Horní nástrojovou lištu..."
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Uložit zálohu nástrojové lišty"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "do souboru nástrojové lišty (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "do souboru .BAR z TC (neměnit existující)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "do souboru .BAR z TC (smazat existující)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "do \"wincmd.ini\" z TC (neměnit existující)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "do \"wincmd.ini\" z TC (smazat existující)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "hned za aktuální výběr"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "jako první prvek"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "jako poslední prvek"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "hned před aktuální výběr"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION"
msgid "Import..."
msgstr "Importovat..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Obnovit zálohu nástrojové lišty"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "přidat do aktuální nástrojové lišty"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "přidat novou lištu do aktuální nástrojové lišty"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "přidat novou lištu do horní nástrojové lišty"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "přidat do horní nástrojové lišty"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "nahradit horní nástrojovou lištu"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "z souboru nástrojové lišty (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "přidat do aktuální nástrojové lišty"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "přidat novou lištu do aktuální nástrojové lišty"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "přidat novou lištu do horní nástrojové lišty"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "přidat do horní nástrojové lišty"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "nahradit horní nástrojovou lištu"
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "z jednoho .BAR souboru od TC..."
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "přidat do aktuální nástrojové lišty"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "přidat novou lištu do aktuální nástrojové lišty"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "přidat novou lištu do horní nástrojové lišty"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "přidat do horní nástrojové lišty"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "nahradit horní nástrojovou lištu"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "z \"wincmd.ini\" od TC..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "přidat do aktuální nástrojové lišty"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "přidat novou lištu do aktuální nástrojové lišty"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "přidat novou lištu do horní nástrojové lišty"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "přidat do horní nástrojové lišty"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "nahradit horní nástrojovou lištu"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "hned za aktuální výběr"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "jako první prvek"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "jako poslední prvek"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "hned před aktuální výběr"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION"
msgid "Search and replace..."
msgstr "Vyhledat a nahradit..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "hned za aktuální výběr"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "jako první prvek"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "jako poslední prvek"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "hned před aktuální výběr"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "ve všech výše uvedených ..."
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "ve všech příkazech..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "ve všech názvech ikon..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "ve všech parametrech..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "ve všech spouštěcích cestách..."
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "hned za aktuální výběr"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "jako první prvek"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "jako poslední prvek"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "hned před aktuální výběr"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Typ tlačítka"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "&Po vykonání programu ponechat okno terminálu otevřené"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "&Vykonat v terminálu"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "&Použít externí program"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "D&oplňující parametry"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "&Cesta programu k vykonání"
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "P&řidat"
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "P&oužít"
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "V&ymazat"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Šablona..."
#: tfrmoptionstooltips.chkshowtooltip.caption
msgid "&Show tooltip for files in the file panel"
msgstr "Zobrazit nástrojový tip pro soubory v souborovém panelu"
#: tfrmoptionstooltips.gbcustomfields.caption
msgid "Custom fields by file type"
msgstr "Vlastní pole podle typu souboru"
#: tfrmoptionstooltips.lblfieldslist.caption
msgid "Category &hint:"
msgstr "Pokyn &kategorie:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Maska &kategorie:"
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "&Název kategorie:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr "S dvojklikem na pruh na vrchu panelu souboru"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "S nabídkou a vnitřním příkazem"
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr "Dvojklik ve stromu vybere a ukončí"
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "S nabídkou a vnitřním příkazem"
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr "S dvojklikem na záložku (pokud je pro ni nastaveno)"
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr "Když je použita klávesová zkratka, ukončí okno a vrátí aktuální volbu"
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr "Jeden klik myší ve stromu vybere a ukončí"
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr "Použít pro historii příkazového řádku"
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr "Použít pro historii adresáře"
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr "Použít pro historii prohlížení (Navštívené cesty pro aktivní prohlížení)"
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr "Chování vůči výběru:"
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr "Volby pro stromové nabídky:"
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr "Kde použít stromové nabídky:"
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr "*POZNÁMKA: Ohledně voleb jako velikost písmen, ignorování nebo neignorování přízvuku, tyto jsou uloženy a obnoveny samostatně pro každý kontext použití a sezení do jiného."
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr "Se žhavými adresáři:"
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr "S oblíbenými záložkami:"
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr "S Historií:"
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr "Použít a zobrazit klávesové zkratky pro výběr položek"
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr "Volby rozvržení a barev:"
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Barva pozadí:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Barva kurzoru:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Barva nalezeného textu:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Barva nalezeného textu pod kurzorem:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Barva normálního textu:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Barva normálního textu pod kurzorem:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Náhled stromové nabídky:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr "Barva vedlejšího textu:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr "Barva vedlejšího textu pod kurzorem:"
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Barva zkratky:"
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr "Barva zkratky pod kurzorem:"
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr "Barva nevybraného textu:"
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr "Barva nevybraného textu pod kurzorem:"
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr "Změňte barvu vlevo a uvidíte zde náhled toho jak budou vypadat stromové nabídky se vzorem."
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Režim knihy prohlížeče"
#: tfrmoptionsviewer.gbviewerexample.caption
msgid "Example"
msgstr "Ukázka"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "&Barva pozadí v prohlížeči knih"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "&Barva písma v prohlížeči knih"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "&Počet sloupců v prohlížeči knih"
#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "Konfi&gurovat"
#: tfrmpackdlg.caption
msgid "Pack files"
msgstr "Komprimovat soubory"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "V&ytvořit oddělené archívy, jeden na vybraný soubor/adresář"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Sa&morozbalovací archív"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "Zaši&frovat"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Pře&sunout do archívu"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Vícesvazkový archív"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "N&ejdříve vložit do TAR archívu"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Také kom&primovat se jmény cest (pouze rekurzivně)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Komprimovat soubor(y) do souboru:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Komprimátor"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zavřít"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Rozbalit &vše a spustit"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "&Rozbalit a spustit"
#: tfrmpackinfodlg.caption
msgid "Properties of packed file"
msgstr "Vlastnosti komprimovaného souboru"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Atributy:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Komprimační poměr:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Datum:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Metoda:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Původní velikost:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Soubor:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Zkomprimovaná velikost:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Komprimátor:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Čas:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Zavřít panel filtru"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Zadejte text, který chcete vyhledat nebo filtrovat podle"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Rozlišovat velikost znaků"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "D"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Adresáře"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Soubory"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Srovnání začíná"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Srovnání končí"
#: tfrmquicksearch.tglfilter.caption
msgid "Filter"
msgstr "Filtr"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Přepnout mezi hledaním nebo filtrováním"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "Více pra&videl"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "Méně pravid&el"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Použít obsahové doplňky, v kombina&ci s:"
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
msgid "Plugin"
msgstr "Doplněk"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Pole"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Operátor"
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[3].TEXT"
msgid "Value"
msgstr "Hodnota"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&AND (všechny shody)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&OR (některé shody)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Zrušit"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "&Zavřít"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "&Nápověda"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "&Vyberte znaky k vložení:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsetfileproperties.caption
msgid "Change attributes"
msgstr "Změnit atributy"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Sticky"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgid "Archive"
msgstr "Archív"
#: tfrmsetfileproperties.chkcreationtime.caption
msgid "Created:"
msgstr "Vytvořeno:"
#: tfrmsetfileproperties.chkhidden.caption
msgid "Hidden"
msgstr "Skryté"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Zpřístupněno:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Změněno:"
#: tfrmsetfileproperties.chkreadonly.caption
msgid "Read only"
msgstr "Pouze pro čtení"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Včetně podsložek"
#: tfrmsetfileproperties.chksystem.caption
msgid "System"
msgstr "Systém"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Vlastnosti časové známky"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributy"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributy"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bitů:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Skupina"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(šedá pole znamenají nezměněné hodnoty)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ostatní"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlastník"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Text:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Spustit"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION"
msgid "(gray field means unchanged value)"
msgstr "(šedá pole znamenají nezměněné hodnoty)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Osmičkově:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čtení"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Zápis"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Některé funkce pro výběr příslušné cesty"
#: tfrmsplitter.caption
msgid "Splitter"
msgstr "Dělení souborů"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Vyžadovat kontrolní soubor CRC32"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Název souboru"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Velikost a počet částí"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "&Cílový adresář"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Zdrojový &soubor"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "&Počet částí"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Bajtů"
#: tfrmsplitter.rbtngigab.caption
msgid "&Gigabytes"
msgstr "&Gigabajtů"
#: tfrmsplitter.rbtnkilob.caption
msgid "&Kilobytes"
msgstr "&Kilobajtů"
#: tfrmsplitter.rbtnmegab.caption
msgid "&Megabytes"
msgstr "&Megabajtů"
#: tfrmstartingsplash.caption
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
msgid "Build"
msgstr "Sestavení"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Operační systém"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Platforma"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revize"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr "Verze"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr "WidgetsetVer"
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Vytvořit symbolický odkaz"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Cíl, na který bude odkaz ukazovat"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "&Název odkazu"
#: tfrmsyncdirsdlg.actselectclear.caption
msgid "Remove selection"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopydefault.caption
msgid "Select for copying (default direction)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
msgid "Select for copying -> (left to right)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
msgid "Reverse copy direction"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
msgid "Select for copying <- (right to left)"
msgstr ""
#: tfrmsyncdirsdlg.actselectdeleteright.caption
msgid "Select for deleting -> (right)"
msgstr ""
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr "Zavřít"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr "Porovnat"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Synchronizovat"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Synchronizovat adresáře"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "asymetricky"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "podle obsahu"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "ignorovat datum"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "pouze vybrané"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "podadresáře"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Zobrazit:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Název"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Velikost"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Datum"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Datum"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Velikost"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Název"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(v hlavním okně)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
msgid "Compare"
msgstr "Porovnat"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Zobrazit levý"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Zobrazit pravý"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "stejné"
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "samostatné"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Klikněte prosím pro spuštění na \"Porovnat\""
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr "Synchronizovat"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Ověření přepsání"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Stromová nabídky"
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr "Vyberte váš žhavý adresář:"
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr "Hledat s velikostí písmen"
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr "Plně sbalit"
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr "Plně rozbalit"
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr "Hledání s ignorováním přízvuku a zpřežek"
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr "Hledání je bez rozlišení velikosti písmen"
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr "Hledání je přísné ohledně přízvuků a zpřežek"
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr "Neukazuj obsah větve \"jen\" protože je hledaný řetězec nalezen ve jméně větve"
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr "Pokud je hledaný řetězec nalezen ve jméně větve, ukaž celou větev dokonce pokud prvky neodpovídají"
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr "Zavřít stromovou nabídku"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr "Nastavení stromové nabídky"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr "Nastavení barev stromové nabídky"
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "P&řidat nový"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Zrušit"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "Z&měnit"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Vý&chozí"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "&Odstranit"
#: tfrmtweakplugin.caption
msgid "Tweak plugin"
msgstr "Vylepšovací doplněk"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Zj&istí typ archívu podle obsahu"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Může ma&zat soubory"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Po&dporuje šifrování"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Zobra&zen jako normální soubory (skrýt ikonu komprimátoru)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Podporuje kom&primaci v paměti"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Může &měnit stávající archívy"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "&Archiv může obsahovat více souborů"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Může vytvářet nové arch&ívy"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "P&odporuje okno s možnostmi"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Umožňuje vyhledáván&í textu v archívu"
#: tfrmtweakplugin.lbldescription.caption
msgid "&Description:"
msgstr "&Popis:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "D&etekovaný text:"
#: tfrmtweakplugin.lblextension.caption
msgid "&Extension:"
msgstr "&Přípona:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Příznaky:"
#: tfrmtweakplugin.lblname.caption
msgctxt "tfrmtweakplugin.lblname.caption"
msgid "&Name:"
msgstr "&Název:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "&Doplněk:"
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "&Doplněk:"
#: tfrmviewer.actabout.caption
msgid "About Viewer..."
msgstr "O prohlížeči..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Zobrazit zprávu o programu"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
msgid "Copy File"
msgstr "Kopírovat soubor"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Kopírovat soubor"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Kopírovat do schránky"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr "Kopírovat formátovaně do schránky"
#: tfrmviewer.actdeletefile.caption
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
msgid "Delete File"
msgstr "Vymazat soubor"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Vymazat soubor"
#: tfrmviewer.actexitviewer.caption
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "&Konec"
#: tfrmviewer.actfind.caption
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Hledat"
#: tfrmviewer.actfindnext.caption
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Hledat další"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr "Najít předchozí"
#: tfrmviewer.actfullscreen.caption
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Celá obrazovka"
#: tfrmviewer.actimagecenter.caption
msgid "Center"
msgstr "Střed"
#: tfrmviewer.actloadnextfile.caption
msgid "&Next"
msgstr "&Další"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Načíst další soubor"
#: tfrmviewer.actloadprevfile.caption
msgid "&Previous"
msgstr "&Předešlý"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Načíst předchozí soubor"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr "Zrcadlit vodorovně"
#: tfrmviewer.actmirrorhorz.hint
msgid "Mirror"
msgstr "Zrcadlit"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr "Zrcadlit svisle"
#: tfrmviewer.actmovefile.caption
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
msgid "Move File"
msgstr "Přesunout soubor"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Přesunout soubor"
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Náhled"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Obnovit"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Znovu načíst aktuální soubor"
#: tfrmviewer.actrotate180.caption
msgid "+ 180"
msgstr "+ 180"
#: tfrmviewer.actrotate180.hint
msgid "Rotate 180 degrees"
msgstr "Otočit o 180 stupňů"
#: tfrmviewer.actrotate270.caption
msgid "- 90"
msgstr "- 90"
#: tfrmviewer.actrotate270.hint
msgid "Rotate -90 degrees"
msgstr "Otočit o -90 stupňů"
#: tfrmviewer.actrotate90.caption
msgid "+ 90"
msgstr "+ 90"
#: tfrmviewer.actrotate90.hint
msgid "Rotate +90 degrees"
msgstr "Otočit o +90 stupňů"
#: tfrmviewer.actsave.caption
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Uložit"
#: tfrmviewer.actsaveas.caption
msgid "Save As..."
msgstr "Uložit jako..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Uložit soubor jako..."
#: tfrmviewer.actscreenshot.caption
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Snímek obrazovky"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "Prodleva 3 sek."
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "Prodleva 5 sek."
#: tfrmviewer.actselectall.caption
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Vybrat vše"
#: tfrmviewer.actshowasbin.caption
msgid "Show as &Bin"
msgstr "Zobrazit &binárně"
#: tfrmviewer.actshowasbook.caption
msgid "Show as B&ook"
msgstr "Zobrazit jako &knížku"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr "Ukázat jako &Dek"
#: tfrmviewer.actshowashex.caption
msgid "Show as &Hex"
msgstr "Zobrazit &hexadecimálně"
#: tfrmviewer.actshowastext.caption
msgid "Show as &Text"
msgstr "Zobrazit jako &text"
#: tfrmviewer.actshowaswraptext.caption
msgid "Show as &Wrap text"
msgstr "Zobrazit &jako zalamovaný text"
#: tfrmviewer.actshowgraphics.caption
msgid "Graphics"
msgstr "Grafika"
#: tfrmviewer.actshowplugins.caption
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Doplňky"
#: tfrmviewer.actstretchimage.caption
msgid "Stretch"
msgstr "Přizpůsobit"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Roztáhnout obrázek"
#: tfrmviewer.actstretchonlylarge.caption
msgid "Stretch only large"
msgstr "Roztáhnout pouze rozlehlé"
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Zvětšení"
#: tfrmviewer.actzoomin.caption
msgid "Zoom In"
msgstr "Přiblížit"
#: tfrmviewer.actzoomout.caption
msgid "Zoom Out"
msgstr "Oddálit"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Kopírovat"
#: tfrmviewer.btncuttuimage.hint
msgid "Crop"
msgstr "Oříznout"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Vymazat"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Vymazat"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Celá obrazovka"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Zvýraznění"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Přesunout"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Přesunout"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Kreslit"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Červené oči"
#: tfrmviewer.btnresize.hint
msgid "Resize"
msgstr "Změnit velikost"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Zpět"
#: tfrmviewer.caption
msgctxt "TFRMVIEWER.CAPTION"
msgid "Viewer"
msgstr "Prohlížeč"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Prohlídka"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Pero"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Zvýraznění"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Kreslit"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Prohlídka"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Zobrazit"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Upravit"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Kó&dování"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Soubor"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Obrázek"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Tisk..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Otočit"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Snímek obrazovky"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Zobrazit"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Vybrat vše"
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Pokud soubor existuje"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Pokud soubor existuje"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopírovat d&atum/čas"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Práce v pozadí (samostatné přípojení)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Pokud soubor existuje"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Výška"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Šířka"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
"Tento soubor nelze nalézt, a mohl by pomoci ověřit konečné kombinace souborů:\n"
"%s\n"
"\n"
"Mohl byste ho dát jen k dispozici, a kliknout tlačítko \"OK\", pokud jste připraveni,\n"
"nebo pokračovat bez něj kliknutím na \"ZRUŠIT\"?\n"
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Zrušit rychlý filtr"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Zrušit aktuální operaci"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Zadejte název souboru s příponou, pro upuštění textu"
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Formát textu pro import"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Rozbitý:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Obecné:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Chybějící:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Chyba čtení:"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Úspěšný:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Zadejte kontrolní součet a vyberte algoritmus:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Ověřit kontrolní součet"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Celkem:"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr "Chcete smazat filtry z tohoto hledání?"
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Schránka neobsahuje žádné platné údaje z nástrojové lišty."
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr "Vše;Aktivní záložka;Levá záložka;Pravá záložka;Činnosti souboru;Konfigurace;Síť;Různé;Paralelní port;Tisk;Výběr;Bezpečnost;Schránka;FTP;Navigace;Nápověda;Okno;Příkazový řádek;Nástroje;Zobrazit;Uživatel;Záložky;Řazení;Protokol"
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr "Starší řazení;Řazení A-Z"
#: ulng.rscolattr
msgid "Attr"
msgstr "Atr."
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Datum"
#: ulng.rscolext
msgid "Ext"
msgstr "Přípona"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Název"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Velikost"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Zarovnat"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Nadpis"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Vymazat"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Detaily položky"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Přesunout"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Šířka"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Nastavení sloupců"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Nastavení přidružení souborů"
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "Potvrzování příkazového řádku a parametrů"
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Kopírovat (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Importovaná nástrojová lišta DC"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Importovaná nástrojová lišta TC"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr ""
#: ulng.rsdiffadds
msgid " Adds: "
msgstr " Přidáno: "
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr " Smazáno: "
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "Tyto dva soubory jsou stejné!"
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr " Shodných: "
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr " Upravených: "
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Př&erušit"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "Vše"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Připojit"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "A&utomatické přejmenování zdrojových souborů"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Zrušit"
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Pokračovat"
#: ulng.rsdlgbuttoncopyinto
msgid "&Merge"
msgstr "&Přepsat"
#: ulng.rsdlgbuttoncopyintoall
msgid "Mer&ge All"
msgstr "Přepsat &vše"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "U&končit program"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr "Ig&norovat"
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "I&gnorovat vše"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Ne"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "Žád&ný"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&OK"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "Os&tatní"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Přepsat"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Přepsat &Vše"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Přepsat všechno &větší"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Přepsat Vše s&tarší"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Přepsat všechno &menší"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "S&mazat"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Znovu začít"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "O&pakovat"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "Pře&skočit"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Přes&kočit vše"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Ano"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Kopírovat soubor(y)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Přesunout soubor(y)"
#: ulng.rsdlgoppause
msgid "Pau&se"
msgstr "Poza&stavit"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&Spustit"
#: ulng.rsdlgqueue
msgid "Queue"
msgstr "Fronta"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Rychlost %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Rychlost %s/s, zbývající čas %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr "Formát Rich Text;Formát HTML;Formát Unicode;Formát jednoduchého textu"
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<bez štítku>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<žádné médium>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Vnitřní editor Double Commanderu."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Jít na řádek:"
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr "Jít na řádek"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "nový.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Název souboru:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Otevřít soubor"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Vzad"
#: ulng.rseditsearchcaption
msgid "Search"
msgstr "Hledat"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "V&před"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Nahradit"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "s externím prohlížečem"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "s vnitřním prohlížečem"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Spustit přes shell"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Spustit přes terminál a zavřít"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Spustit přes terminál a ponechat otevřené"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Vlevo;Vpravo;V aktivním;V neaktivním;V obojím;V žádným"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Ne;Ano"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Exportováno_z_DC"
#: ulng.rsfileopdirectoryexistsoptions
msgid "Ask;Merge;Skip"
msgstr "Zeptat se;Přepsat;Přeskočit"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Zeptat se;Přepsat;Přepsat starší;Přeskočit"
#: ulng.rsfileopsetpropertyerroroptions
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Zeptat se;Už nenastavovat;Ignorovat chyby"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "FILTR"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Určit šablonu"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s úrovní"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "vše (neomezená hloubka)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "pouze aktuální adresář"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Adresář %s neexistuje!"
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Nalezeno: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Uložit vyhledávací šablonu"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Název šablony:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Prohledáno: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Prohledávám"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Hledat soubory"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Čas skenu:"
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Začít v"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Volno %s z %s bytů"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s bajtů volných"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Datum/čas přístupu"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Atributy"
#: ulng.rsfunccomment
msgid "Comment"
msgstr "Komentář"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Komprimovaná velikost"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Datum/čas vytvoření"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Rozšíření"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Skupina"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Datum/čas změny"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Napojit na"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Datum/čas úpravy"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Název"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Název bez přípony"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Vlastník"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Cesta"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Velikost"
#: ulng.rsfunctype
msgid "Type"
msgstr "Typ"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Chyba při vytváření hardlinku."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "Žádná;Název, a-z;Název, z-a;Přípona, a-z;Přípona, z-a;Velikost 9-0;Velikost 0-9;Datum 9-0;Datum 0-9"
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"Varování! Při obnově záložního souboru .hotlist, tento bude smazán a nahrazen jiným.\n"
"\n"
"Jste si skutečně jisti, že chcete pokračovat?\n"
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Kopírovat/Přesunout dialog"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Rozdílné"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Dialogové okno upravit komentář"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Hledat soubory"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Hlavní"
#: ulng.rshotkeycategorysyncdirs
msgid "Synchronize Directories"
msgstr ""
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Prohlížeč"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
"Nastavení s tímto názvem již existuje.\n"
"Chcete ho skutečně přepsat?\n"
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr "Jste si jisti, že chcete obnovit na výchozí hodnoty?"
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr "Opravdu chcete vymazat \"%s\"?"
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr "Kopie %s"
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr "Zadejte nový název"
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr "Je nutné zachovat alespoň jeden soubor klávesových zkratek."
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr "Nový název"
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
"Nastavení \"%s\" bylo upraveno.\n"
"Chcete ho nyní uložit?\n"
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr "Bez zkratky s \"ENTER\""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr "podle názvu příkazu;podle zkratky (seskupeno);podle zkratky (jedna na řádek)"
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "Nemohu najít odkaz na výchozí BAR soubor"
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Maska zrušení výběru"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Maska výběru"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Vstupní maska:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Zobrazené sloupce s tímto názvem již existují."
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr "Chceme-li změnit aktuální úpravy sloupců, použijeme buďto ULOŽIT, KOPÍROVAT nebo SMAZAT"
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Nastavit uživatelské sloupce"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Zadejte nový název vlastních sloupců"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Akce"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr "Kopírovat název s UNC cestou"
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Odpojit síťový disk..."
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Upravit"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Vysunout"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Rozbalit zde..."
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Mapovat síťový disk..."
#: ulng.rsmnumount
msgid "Mount"
msgstr "Připojit"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Nový"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Žádné dostupné médium"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Otevřít"
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Otevřít s"
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Ostatní..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Zabalit zde..."
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Řadit podle"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Odpojit"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Zobrazit"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Účet:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Doplňující parametry pro archivátor příkazové řádky:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr "Chcete uzavřít mezi uvozovky?"
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"Špatný výsledek CRC32 pro soubor:\n"
"\"%s\"\n"
"\n"
"Přejete si ponechat výsledný poškozený soubor?\n"
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Nemůžete kopírovat/přesunout soubor \"%s\" do sebe!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Nelze odstranit adresář %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr "Nelze přepsat adresář \"%s\" neadresářem \"%s\""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Změna adresáře na [%s] selhala!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Odstranit všechny neaktivní záložky?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Záložka (%s) je uzamčena! Přesto zavřít?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Opravdu chcete skončit?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "Soubor %s se změnil. Chcete jej zkopírovat zpět?"
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "Nelze zkopírovat zpět - chcete ponechat změněný soubor?"
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Kopírovat %d vybraných souborů/adresářů?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Kopírovat vybrané \"%s\"?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Vytvořit nový typ souboru pro \"soubory %s\" >"
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Zadejte umístění a název souboru pro uložení souboru nástrojové lišty DC"
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Vlastní akce"
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Odstranit částečně zkopírovaný soubor ?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Vymazat %d vybrané soubory / adresáře?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Vymazat %d vybraných souborů/adresářů do koše?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Vymazat vybrané \"%s\"?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Přesunout vybrané \"%s\" do koše?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Nelze odstranit \"%s\" do koše! Odstranit přímo?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Disk není dostupný"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr "Vlastní název akce:"
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Zadejte příponu souboru:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Zadejte název:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Vložte název pro vytvoření nového typu souboru pro příponu \"%s\""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "CRC chyba v datech archívu"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Špatná data"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Nelze se připojit k serveru: \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Nelze zkopírovat soubor %s do %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Již existuje adresář jménem \"%s\"."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Datum %s není podporován"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Adresář %s existuje!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Operace přerušena uživatelem"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Chyba při uzavírání souboru"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Nelze vytvořit soubor"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "V archívu nejsou žádné další soubory"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Nelze otevřít existující soubor"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Chyba při čtení ze souboru"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Chyba při zápisu do souboru"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Nelze vytvořit adresář %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Nesprávný odkaz"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Soubory neexistují"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Nedostatek paměti"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Funkce není podporována!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Chyba v příkazu místní nabídky"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Chyba při načítání nastavení"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Chyba syntaxe v regulárním výrazu!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Nelze přejmenovat soubor %s na %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Nelze uložit přidružení!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Nelze uložit soubor"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Nelze nastavit atributy pro \"%s\""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Nelze nastavit datum/čas pro \"%s\""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Nelze nastavit vlastníka/skupinu pro \"%s \""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "Oprávnění pro \"%s\" nelze nastavit"
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Vyrovnávací paměť je příliš malá"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Příliš mnoho souborů pro kompresi"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Neznámý formát archívu"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "Jste si jisti že chcete vymazat všechny položky oblíbených záložek? (Neexistuje krok \"zpět\" pro tuto akci!)"
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Přetáhněte sem další položky"
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr "Zadání názvu záložky mezi oblíbené"
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "Uloží novou záložku mezi oblíbené"
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Počet úspěšně exportovaných oblíbených záložek: %d z %d"
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr "Další nastavení u uložení historii složek pro nové oblíbené záložky:"
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Počet úspěšně importovaných souborů: %d z %d"
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Importovaný dřívější záložky"
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr "Vybrat .tab soubor(y) k importu (může být více než jeden najednou!)"
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr "Poslední změny oblíbených záložek dosud nebyly uloženy. Chcete je před pokračováním uložit?"
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Ukládat historii adresářů v Oblíbených záložkách:"
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Název podnabídky"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "Toto načte Oblíbené záložky: \"%s\""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr "Uložit aktuální záložku do existující oblíbené záložky"
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Soubor %s byl změněn, uložit?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s bajtů, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Přepsat:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Soubor %s existuje, přepsat?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Souborem:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Soubor \"%s\" nebyl nalezen."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Aktivní souborové operace)"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Některé souborové operace nejsou dokončeny. Uzavření Double Commanderu může vést ke ztrátě dat."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
"Délka cílového názvu (%d) je větší než %d znaků!\n"
"%s\n"
"Některé programy nebudou schopné přístupu k souboru/složce s tak dlouhým názvem!\n"
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Soubor %s je označen jako pouze ke čtení/skrytý/systémový! Odstranit jej?"
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "Velikost souboru \"%s\" je příliš velká pro cílový souborový systém!"
#: ulng.rsmsgfolderexistsrwrt
msgid "Folder %s exists, merge?"
msgstr "Složka %s existuje, přepsat?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Následovat symbolický odkaz \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Vyberte formát textu pro import"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Přidat %d vybraných adresářů"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Přidat vybraný adresář: "
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Přidat aktuální adresář: "
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Provést příkaz"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_jakýkoliv"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Nastavit rychlé adresáře"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Jste si jisti že chcete vymazat všechny položky Rychlého adresáře? (U této akce neexistuje krok \"zpět\"!)"
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Spustí následující příkaz:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "Toto je rychlý adresář pojmenovaný "
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Změní aktivní rám do následující cesty:"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "A neaktivní rám může zmenit do následující cesty:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Chyba položky zálohování..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Chyba položky exportu..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Exportovat vše!!"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Export rychlého adresáře - Vyberte položku pro export"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Export vybraného"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Importovat vše!!"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Import rychlého adresáře - vyberte položky pro import"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Importovat vybrané"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Cesta"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Nalezení souboru \".hotlist\" pro import"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Název rychlého adresáře"
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Počet nových položek: %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "Pro import není nic vybráno!"
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Cesta rychlého adresáře"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Znovu přidat vybraný adresář: "
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Znovu přidat aktuální adresář: "
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Zadejte umístění a název souboru pro obnovu hotlist"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Příkaz:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(konec v podnabídce)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Název nabídky:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Název:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(oddělovač)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Název podnabídky"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Cíl rychlého adresáře"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Určete, zda má být aktivní rám seřazen v specifikovaném pořadí po změně adresáře"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Určete, zda má být neaktivní rám seřazen v specifikovaném pořadí po změně adresáře"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Některé funkce pro výběr příslušné relativní nebo absolutní cesty, speciální složky Windows, atd."
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Celkem uložených položek: %d\n"
"\n"
"Název souboru se zálohou: %s\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Celkem exportovaných položek: "
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"Chcete smazat všechny prvky uvnitř podnabídky [%s]?\n"
"Odpověď NE smaže pouze oddělovače nabídky, ale nezmění prvek uvnitř podnabídky.\n"
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Zadání umístění a názvu souboru pro uložení souboru hotlist"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Neplatný výsledek délky souboru pro soubor: \"%s\""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Vložte prosím další disk nebo něco podobného.\n"
"\n"
"To umožní zapsání tohoto souboru:\n"
"\"%s\"\n"
"\n"
"Počet bytů stále potřebných zapsat: %d\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Chyba v příkazovém řádku"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Nesprávný název souboru"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Neplatný formát konfiguračního souboru"
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Neplatná cesta"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Cesta %s obsahuje nepovolené znaky."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Toto není platný doplněk!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Tento plugin je vyvinut pro Double Commander pro %s.%s Nemůže pracovat s Double Commander pro %s!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Neplatná citace"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Nesprávný výběr."
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Načítání seznamu souborů..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr "Nalezení konfiguračního souboru TC (wincmd.ini)"
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "Nalezení spustitelného souboru TC (totalcmd.exe nebo totalcmd64.exe)"
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Kopírovat soubor %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Smazán soubor %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Chyba: "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr "Externě spuštěno"
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr "Výsledek externího"
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Rozbalit soubor %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Info: "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Vytvořit odkaz %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Vytvořit adresář %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Přesunout soubor %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Komprimovat do souboru %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Odstranit adresář %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Hotovo: "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Vytvořit symbolický odkaz %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Testovat integritu souboru %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Nevratně smaže soubor %s"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Nevratně smaže adresář %s"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Hlavní heslo"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Prosíme zadejte hlavní heslo:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Nový soubor"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Další část bude rozbalena"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Žádné soubory"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Nejsou vybrány žádné soubory."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Není dostatek volného místa na cílovém disku! Pokračovat?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Není dostatek volného místa na cílovém disku! Opakovat?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Nelze vymazat soubor %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Není implementováno."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Níže je náhled. Můžeme pohybovat kurzorem a vybrat soubory, a okamžitě získáme aktuální vzhled podle různých nastavení."
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Heslo:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Hesla jsou rozdílná!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Prosíme zadejte heslo"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Heslo (Firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Prosíme zopakujte heslo pro ověření:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Vymazat %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Předvolba \"%s\" již existuje. Nahradit?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Problém při vykonávání příkazu (%s)"
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Název souboru pro upuštěný text:"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Prosím, vytvořte tento soubor dostupný. Zopakovat?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Vložte nový název pro tuto oblíbenou záložku"
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Vložte nový název pro tuto nabídku"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Přejmenovat/přesunout %d vybraných souborů/adresářů?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Přejmenovat/přesunout vybrané \"%s\"?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Pro provedení změn prosím restartujte Double Commander"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Zvolte ke kterému typu souboru přiřadit příponu \"%s\""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Vybráno: %s z %s, souborů: %d z %d, složek: %d z %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Výběr spustitelného souboru pro"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Prosím vyberte pouze soubory s kontrolním součtem!"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Prosím vyberte umístění další části"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Nastavit název disku"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Speciální adresář"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Přidat cestu z aktivního rámu"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Přidat cestu z neaktivního rámu"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Procházet a použít vybranou cestu"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Použít proměnnou prostředí..."
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Jít do speciální cesty Double Commander..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Jít do prostředí proměnných..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Jít do jiné speciální složky Windows..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Jít do speciální složky Windows (TC)..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Udělat relativní k cestě žhavých adresářů"
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Vytvořit absolutní cestu"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Vytvořit relativní speciální cestu Double Commander..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Vytvořit relativní proměnné prostředí..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Vytvořit relativní speciální složku Windows (TC)... "
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Vytvořit jinou relativní speciální složku Windows..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Použít speciální cestu Double Commanderu..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr "Použít cestu žhavých adresářů"
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Použít jinou speciální složku Windows..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Použít speciální složku Windows (TC)..."
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr "Záložka (%s) je uzamčena! Otevřít adresář v jiné záložce?"
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Přejmenovat záložku"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Název nové záložky:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Cílová cesta:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Chyba! Nelze najít konfigurační soubor TC:\n"
"%s\n"
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Chyba! Nelze najít spustitelnou konfiguraci TC:\n"
"%s\n"
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Chyba! TC je stále spuštěn, ale může být pro tuto činnost uzavřen.\n"
"Ukončete ho a klikněte na OK nebo kliknutím na ZRUŠIT akci přerušte.\n"
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Chyba! Nelze najít požadovanou výstupní složku nástrojové lišty TC:\n"
"%s\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Zadání umístění a názvu souboru pro uložení souboru nástrojové lišty TC"
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr "\"%s\" je nyní ve schránce"
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr "Přípona souboru není v žádném z rozpoznaných typů"
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Nalezení souboru \".toolbar\" pro import"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Nalezení souboru \".BAR\" pro import"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Zadání umístění a názvu souboru pro obnovení nástrojové lišty"
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Uloženo!\n"
"Název souboru nástrojové lišty: %s\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Vybráno příliš mnoho souborů."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Neurčeno"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr "CHYBA: Neočekávané použití stromové nabídky!"
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "<BEZ PŘÍPONY>"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr "<BEZ NÁZVU>"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Jméno uživatele:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Uživatelské jméno (firewall):"
#: ulng.rsmsgverify
msgid "VERIFICATION:"
msgstr ""
#: ulng.rsmsgverifywrong
msgid "The target file is corrupted, checksum mismatch!"
msgstr ""
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Název disku:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Prosím zadejte velikost disku:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Nevratně smazat %d vybraných souborů/adresářů?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Nevratně smazat \"%s\"?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "s"
#: ulng.rsmsgwrongpasswordtryagain
msgid ""
"Wrong password!\n"
"Please try again!\n"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Neměnit;VELKÁ;malá;1. znak velkým;1. znak každého slova velkým;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr "Soubor obsahuje špatný počet řádků: %d, mělo by být %d!"
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr "zachovat;vymazat;zeptat se"
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr "Žádný vnitřní rovnocenný příkaz"
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr "Omlouváme se, ale okno \"Hledat soubory\" ještě neexistuje..."
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr "Omlouváme se, další okno \"Hledat soubory\" k zavření neexistuje, zavřít a uvolnit paměť..."
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Přerušeno"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Přepočítávám kontrolní součet"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Přepočítávám kontrolní součet v \"%s\""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "Přepočítávám kontrolní součet z \"%s\""
#: ulng.rsopercalculatingstatictics
msgid "Calculating"
msgstr "Počítání"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Probíhá výpočet \"%s\""
#: ulng.rsopercombining
msgid "Joining"
msgstr "Spojování"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Spojení obrázků v \"%s \" do \"%s \""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Kopírování"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Kopírování z \"%s\" do \"%s\""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Kopírování \"%s\" do \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Vytváření adresáře"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Vytváření adresáře \"%s\""
#: ulng.rsoperdeleting
msgid "Deleting"
msgstr "Mazání"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Mazání v \"%s\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Mazání \"%s\""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Provádění"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Provádění \"%s\""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Rozbalování"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Rozbaluji z \"%s\" do \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Hotovo"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Vypisování"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Vypisování \"%s\""
#: ulng.rsopermoving
msgid "Moving"
msgstr "Přesunování"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Přesunování z \"%s\" do \"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Přesunování \"%s\" do \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Nespuštěno"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Zabalení"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Zabalení z \"%s\" do \"%s\""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Zabalení \"%s\" do \"%s\""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Pozastaveno"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Pozastavuji"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Běží"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Nastavení vlastnosti"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Nastavení vlastnosti v \"%s\""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Nastavení vlastnosti z \"%s\""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Rozdělení"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Rozdělení \"%s\" do \"%s\""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Spouštím"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Zastaveno"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Zastavuji"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Testování"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Testování v \"%s\""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Testování \"%s\""
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Ověřuji kontrolní součet"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Ověřuji kontrolní součet v \"%s\""
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "Ověřuji kontrolní součet z \"%s\""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Čekání pro přístup k zdroji souboru"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Čekám na reakci uživatele"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Otírání "
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Otírání v \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Otírání \"%s\""
#: ulng.rsoperworking
msgid "Working"
msgstr "Práce"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Na začátek;Na konec;Chytře"
#: ulng.rsoptarchivedelete
msgid "Delete:"
msgstr "Smazat:"
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Rozbalit bez cesty:"
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr "Režim rozboru formátu:"
#: ulng.rsoptarchiveid
msgid "ID:"
msgstr "ID:"
#: ulng.rsoptarchiveidpos
msgid "ID Position:"
msgstr "Pozice ID:"
#: ulng.rsoptarchiveidseekrange
msgid "ID Seek Range:"
msgstr "Rozsah hledání ID:"
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr "Parametr"
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr "Dotazovací řetězec hesla:"
#: ulng.rsoptarchiveselfextract
msgid "Create self extracting archive:"
msgstr "Vytvořit samorozbalovací archív:"
#: ulng.rsoptarchivetest
msgid "Test:"
msgstr "Test:"
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Název typu archívu:"
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Hodnota"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Asociovat doplněk \"%s\" s:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "První;Poslední;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Klasicky, starší pořadí;Abecední pořadí (jazyk ale stále jako první)"
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Záložka aktivního rámu na levé straně, neaktivní na pravé (starší);Levá záložka rámu na levé straně, pravá na pravé"
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Zakázat"
#: ulng.rsoptenable
msgid "Enable"
msgstr "Povolit"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Zadejte příponu"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "Přidat na začátek;Přidat na konec;Abecedně seřadit"
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "samostatné okno;minimalizované samostatné okno;záložka operace"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "plovoucí;B;K;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Zkratka %s pro cm_Delete budou registrovány, takže jej lze použít ke obrácení tohoto nastavení."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Přidat klávesovou zkratku pro %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Přidat zástupce"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Nelze nastavit zástupce"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Změnit zástupce"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Příkaz"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Zástupce %s pro cm_Delete má parametr, který přepíše toto nastavení. Chcete změnit tento parametr a použít globální nastavení?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Zástupce %s pro cm_Delete potřebuje mít parametr změněný, aby odpovídal zástupci %s. Chcete ho změnit?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Popis"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Změnit klávesovou zkratku pro %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Opravit parametr"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Klávesová zkratka"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Klávesové zkratky"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<žádná>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parametry"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Nastavit zástupce ke smazání souboru"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Pro toto nastavení, aby pracoval zástupce %s, musí zástupce %s být přiřazen cm_Delete, ale už byl přiřazen k %s. Chcete to změnit?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Zástupce %s pro cm_Delete je sekvence zkratek pro které nesmí být přidělena obrácená klávesová zkratka Shift. Toto nastavení nemusí fungovat."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Zástupci v použití"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "Zástupce %s je již použit."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Změnit toto na %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "použito pro %s v %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "použito pro tento příkaz, ale s různými parametry"
#: ulng.rsoptionseditorarchivers
msgid "Archivers"
msgstr "Archivátory"
#: ulng.rsoptionseditorautorefresh
msgid "Auto refresh"
msgstr "Automatická obnova"
#: ulng.rsoptionseditorbehavior
msgid "Behaviors"
msgstr "Chování"
#: ulng.rsoptionseditorbriefview
msgid "Brief"
msgstr "Stručný"
#: ulng.rsoptionseditorcolors
msgid "Colors"
msgstr "Barvy"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Sloupce"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Nastavení"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Vlastní sloupce"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Rychlé adresáře"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Přetáhnutí"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Tlačítko seznamu disků"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Oblíbené záložky"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Další přidružení souborů"
#: ulng.rsoptionseditorfileassoc
msgid "File associations"
msgstr "Přidružení souborů"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Nový"
#: ulng.rsoptionseditorfileoperations
msgid "File operations"
msgstr "Souborové operace"
#: ulng.rsoptionseditorfilepanels
msgid "File panels"
msgstr "Panely souborů"
#: ulng.rsoptionseditorfilesearch
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Hledání souborů"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Zobrazení souborů"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Typy souborů"
#: ulng.rsoptionseditorfoldertabs
msgid "Folder tabs"
msgstr "Záložky adresářů"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Další záložky adresářů"
#: ulng.rsoptionseditorfonts
msgid "Fonts"
msgstr "Písma"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Zvýrazňovače"
#: ulng.rsoptionseditorhotkeys
msgid "Hot keys"
msgstr "Klávesové zkratky"
#: ulng.rsoptionseditoricons
msgid "Icons"
msgstr "Ikony"
#: ulng.rsoptionseditorignorelist
msgid "Ignore list"
msgstr "Seznam ignorování"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Klávesy"
#: ulng.rsoptionseditorlanguage
msgid "Language"
msgstr "Jazyk"
#: ulng.rsoptionseditorlayout
msgid "Layout"
msgstr "Rozvržení"
#: ulng.rsoptionseditorlog
msgid "Log"
msgstr "Protokol"
#: ulng.rsoptionseditormiscellaneous
msgid "Miscellaneous"
msgstr "Různé"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Myš"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
"Volby se změnily v \"%s\"\n"
"\n"
"Chcete uložit změny?\n"
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Doplňky"
#: ulng.rsoptionseditorquicksearch
msgid "Quick search/filter"
msgstr "Rychlé hledání/filtr"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminál"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Nástrojová lišta"
#: ulng.rsoptionseditortools
msgid "Tools"
msgstr "Nástroje"
#: ulng.rsoptionseditortooltips
msgid "Tooltips"
msgstr "Nástrojové tipy"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Stromová nabídka"
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr "Barvy stromové nabídky"
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Žádný;Příkazová řádka;Rychlé hledání;Rychlý filtr"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Levé tlačítko;Pravé tlačítko;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "nahoře v seznamu souborů;po adresářích (pokud jsou adresáře řazeny před soubory);na řazené pozici;v dolní části seznamu souborů"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Doplněk %s již je přiřazen pro následující rozšíření:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Aktivní"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Název souboru"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Název"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Registrováno pro"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Citlivý;&Necitlivý"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Soubory;Ad&resáře;Soubory a& adresáře"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "&Skrýt panel filtru pokud není označen;Pozdržet ukládání úprav nastavení pro příští sezení"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "nezáleží na velikosti znaků;podle místního nastavení (aAbBcC);první velká, poté malá písmena (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "seřadit podle názvu a zobrazit první;seřadit jako soubory a zobrazit první;seřadit jako soubory"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "abecedně, s ohledem na diakritiku;přirozené řazení: abecedně a čísla"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Nahoře;Dole;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "O&ddělovač;Vni&třní příkaz;V&nější příkaz;Nabíd&ka"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "Starší DC - kopie (x) názevsouboru.ext;Windows - názevsouboru (x).ext;Ostatní - názevsouboru(x).ext"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "neměnit pozici;použít stejné nastavení pro nové soubory;do řazené pozice"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Soubory: %d, složky: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Nelze změnit přístupová práva pro \"%s\""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Nelze změnit vlastníka pro \"%s\""
#: ulng.rspropsfile
msgid "File"
msgstr "Soubor"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Adresář"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Pojmenované roury"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Zásuvka"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Zvláštní blokové zařízení"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Zvláštní znakové zařízení"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Symbolický odkaz"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Neznámý typ"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Výsledky hledání"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "VYHLEDAT"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<nepojmenovaná šablona>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Hledání souborů pomocí zásuvného modulu DSX již probíhá.\n"
"To se musí nejdříve dokončit, než se zahájí nové.\n"
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Hledání souborů pomocí zásuvného modulu WDX již probíhá.\n"
"To se musí nejdříve dokončit, než se zahájí nové.\n"
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Vybrat adresář"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr "Vyberte okno"
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "&Zobrazit nápovědu pro %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Vše"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Kategorie"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Sloupec"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Příkaz"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Název souboru"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "soubory"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Parametr"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Výsledek"
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "PracovníAdresář"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bajtů"
#: ulng.rssizeunitgbytes
msgid "Gigabytes"
msgstr "Gigabajtů"
#: ulng.rssizeunitkbytes
msgid "Kilobytes"
msgstr "Kilobajtů"
#: ulng.rssizeunitmbytes
msgid "Megabytes"
msgstr "Megabajtů"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabajtů"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Souborů: %d, Adresářů: %d, Velikost: %s (%s bytů)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Nelze vytvořit cílový adresář!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Neplatný formát velikosti souboru!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Nelze rozdělit soubor!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Počet částí je větší než 100! Pokračovat?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr "Automaticky;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Výběr adresáře:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr "Pouze náhled"
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr "Ostatní"
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr "OU"
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr "Vedlejší poznámka"
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr "Plochý"
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr "Omezený"
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr "Jednoduchý"
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr "Skvělý"
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr "Úžasný"
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr "Fantastický"
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr "Vyberte váš adresář z historie adresářů"
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr "Vyberte vaši Oblíbené záložky:"
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr "Vyberte váš příkaz z historie příkazové řádky"
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr "Vyberte vaši akci z hlavní nabídky"
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr "Vyberte vaši akci z hlavního panelu nástrojů"
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr "Vyberte váš adresář ze Žhavých adresářů"
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr "Vyberte váš adresář z historie prohlížených souborů"
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr "Vyberte váš soubor nebo adresář"
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Chyba při vytváření zástupce."
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr "Původní text"
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr "Prostý text"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "Žádná;Zavřít záložku;Přístup k oblíbeným záložkám;Roletovou nabídku záložek"
#: ulng.rstimeunitday
msgid "Day(s)"
msgstr "Dnů(í)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Hodin(y)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minut(y)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Měsíc(e)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Sekund(y)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Týden(y)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Rok(y)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Přejmenování oblíbených záložek"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Přejmenování podnabídky oblíbených záložek"
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Rozdílné"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Chyba otevření rozdílných"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Chyba otevření editoru"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Chyba otevření terminálu"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Chyba otevření prohlížeče"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminál"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Prohlížeč"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Prosíme nahlašte tuto chybu do sledovače chyb a popište, co jste dělali a následující soubor:%sStiskněte %s pro pokračování nebo %s pro přerušení programu."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "obě záložky, z aktivní do neaktivní"
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "obě záložky, z levé do pravé"
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "cesta k záložce"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "uzavřít každý název v závorkách, nebo v čem zrovna potřebujete"
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "pouze název souboru, ne jeho přípona"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "kompletní název souboru (cesta + název souboru)"
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr "Nápověda k proměnným s \"%\""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr "bude požadovat od uživatele zadání parametru s výchozí navrhovanou hodnotou"
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "levá záložka"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "dočasný seznam názvů souborů"
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "dočasný seznam úplných názvů souborů (cesta+název souboru)"
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr "Názvy souborů v seznamu v UTF-16 s BOM"
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr "Názvy souborů v seznamu v UTF-16 s BOM, uvnitř dvojitých uvozovek"
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr "Názvy souborů v seznamu v UTF-8"
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr "Názvy souborů v seznamu v UTF-8, uvnitř dvojitých uvozovek"
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "dočasný seznam názvů souborů s relativní cestou"
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "pouze přípona souboru"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "pouze název souboru"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Další příklady toho, co je možné"
#: ulng.rsvarpath
#, fuzzy
#| msgid "Path, with ending delimiter"
msgid "Path, without ending delimiter"
msgstr "cesta, s oddělovačem na konci"
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr "odtud až do konce řádku, bude proměnná ukazatele procent \"#\""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr "vrátit procenta"
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr "odtud až do konce řádku, bude zpátky proměnná ukazatele procent \"%\""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "přidat před každý název \"-a \" nebo co zrovna potřebujete"
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "%[Vyzvat uživatele k zadání parametru;Výchozí navrhovaná hodnota]"
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "název souboru s relativní cestou"
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "pravá záložka"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "úplnou cestu druhého vybraného souboru v pravém panelu"
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "ukázat příkaz před spuštěním"
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "%[Jednoduchá zpráva]"
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "zobrazí jednoduchou zprávu"
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "aktivní záložka (zdroj)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "neaktivní záložka (cíl)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr "názvy souborů budou odtud citovány (výchozí)"
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "příkaz bude běžet v terminálu, potom zůstane otevřen"
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr "cesty budou mít koncový oddělovač"
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "názvy souborů nebudou odtud citovány"
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "příkaz bude běžet v terminálu, potom se zavře"
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr "cesty nebudou mít koncový oddělovač (výchozí)"
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Síť"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Vnitřní prohlížeč Double Commanderu."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Špatná kvalita"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Kódování"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Typ obrázku"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Nová velikost"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s nenalezeno!"
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "s externím prohlížečem"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "s vnitřním prohlížečem"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Počet nahrazených: %d"
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "Žádné nahrazení se nekonalo."