doublecmd/language/doublecmd.it.po
Denis Bisson fd46cfbdf0 FIX: Was crashing 9 times on 10 in Linux/Ubuntu, in "Toolbar" configuration, when doing the "Other... -> Add toolbar with all DC commands".
ADD: "DCGetNewGUID" function in "uDCUtils" to get a unique ID number (used in "fOptionsToolbar" and "ufavoritetabs").
CHG: Languages files changed because of the addition of a forgotten message
2017-06-01 00:10:50 +00:00

12515 lines
320 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2012-02-07 21:08+0300\n"
"PO-Revision-Date: 2013-11-03 13:34+0100\n"
"Last-Translator: Krypton <krypton873@gmail.com>\n"
"Language-Team: Krypton <krypton873@gmail.com>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Italiano\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr ""
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr ""
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr ""
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr ""
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Scegli modello..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Contro&lla spazio libero"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Cop&ia attributi"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Copia p&roprietà"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Copia d&ata/ora"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Lin&k valido"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
msgid "Drop readonly fla&g"
msgstr "Elimina attri&buto di sola lettura"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "E&scludi cartelle vuote"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Se&gui i link"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "&Riserva spazio"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Cosa fare quando non è possibile impostare data, attributi, etc. del file?"
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Usa il modello del file"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Quando le cartelle esistono"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When &file exists"
msgstr "Quando i file esistono"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Quando &non è possibile impostare proprietà"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<nessun modello>"
#: tfrmabout.btnclose.caption
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Chiudi"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Copia negli appunti"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "Info"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Build"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Home Page:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revisione"
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Versione"
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Reset"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Seleziona gli attributi"
#: tfrmattributesedit.cbarchive.caption
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
msgid "&Archive"
msgstr "&Archivio"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Co&mpresso"
#: tfrmattributesedit.cbdirectory.caption
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
msgid "&Directory"
msgstr "&Cartella"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "&Codificato"
#: tfrmattributesedit.cbhidden.caption
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
msgid "&Hidden"
msgstr "&Nascosto"
#: tfrmattributesedit.cbreadonly.caption
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
msgid "Read o&nly"
msgstr "Sola le&ttura"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "S&parse"
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Adesivo"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Link simbolico"
#: tfrmattributesedit.cbsystem.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "S&istema"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Temporaneo"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Attributi NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Attributi generali"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bit:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppo"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Altro"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Proprietario"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Esegui"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Leggi"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Come te&sto:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Scrivi"
#: tfrmchecksumcalc.caption
#, fuzzy
#| msgid "Calculate check sum..."
msgctxt "TFRMCHECKSUMCALC.CAPTION"
msgid "Calculate checksum..."
msgstr "Calcola Checksum..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr ""
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "C&rea un file di Checksum separato per ogni file"
#: tfrmchecksumcalc.lblsaveto.caption
#, fuzzy
#| msgid "&Save check sum file(s) to:"
msgid "&Save checksum file(s) to:"
msgstr "&Salva file di Checksum in:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Chiudi"
#: tfrmchecksumverify.caption
#, fuzzy
#| msgid "Verify check sum..."
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Verifica Checksum..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "Ag&giungi"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "C&onnetti"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "&Elimina"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Modifica"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Gestore connessioni"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Connetti a:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "A&ggiungi alla coda"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "O&pzioni"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "Sa&lva opzioni come predefinite"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Copia il(i) file"
#: tfrmcopydlg.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Nuova coda"
#: tfrmcopydlg.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Coda 1"
#: tfrmcopydlg.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Coda 2"
#: tfrmcopydlg.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Coda 3"
#: tfrmcopydlg.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Coda 4"
#: tfrmcopydlg.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Coda 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr ""
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Commenta file/cartella"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "M&odifica commento per:"
#: tfrmdescredit.lblencoding.caption
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "&Codifica:"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "Info"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Confronto Automatico"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Modalità binaria"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Annulla"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Annulla"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Copia blocco a destra"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Copia blocco a destra"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Copia blocco a sinistra"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Copia blocco a sinistra"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Copia"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Taglia"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Elimina"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Incolla"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Ripristina"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Selezion&a Tutto"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Annulla"
#: tfrmdiffer.actexit.caption
msgctxt "TFRMDIFFER.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "Es&ci"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION"
msgid "First Difference"
msgstr "Prima differenza"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Prima differenza"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Ignora maiusc./minusc."
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Ignora Spazi"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Mantenere scorrimento"
#: tfrmdiffer.actlastdifference.caption
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION"
msgid "Last Difference"
msgstr "Ultima differenza"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Ultima differenza"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Differenze della linea"
#: tfrmdiffer.actnextdifference.caption
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION"
msgid "Next Difference"
msgstr "Prossima differenza"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Prossima differenza"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Apri sinistra..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Apri destra..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Colora sfondo"
#: tfrmdiffer.actprevdifference.caption
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION"
msgid "Previous Difference"
msgstr "Differenza precedente"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Differenza precedente"
#: tfrmdiffer.actreload.caption
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
msgid "&Reload"
msgstr "&Ricarica"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Ricarica"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Salva"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Salva"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Salva come..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Salva come..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Salva a sinistra"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Salva a sinistra"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Salva a sinistra come..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Salva a sinistra come..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Salva a destra"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Salva a destra"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Salva a destra come..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Salva a destra come..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Confronta"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Confronta"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Codifica"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Codifica"
#: tfrmdiffer.caption
msgctxt "TFRMDIFFER.CAPTION"
msgid "Compare files"
msgstr "Confronta file"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Sinistra"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "&Destra"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Azioni"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Modifica"
#: tfrmdiffer.mnuencoding.caption
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "Co&difica"
#: tfrmdiffer.mnufile.caption
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "&File"
#: tfrmdiffer.mnuoptions.caption
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
msgid "&Options"
msgstr "&Opzioni"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Aggiungi nuovo collegamento alla sequenza"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Rimuovi l'ultimo collegamento dalla sequenza"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION"
msgid "Only for these controls"
msgstr "Solo per questi controlli"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parametri (ognuno in una linea separata):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Collegamenti:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "Info"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "Info"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Configurazione"
#: tfrmeditor.actconfhigh.hint
msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT"
msgid "Configuration"
msgstr "Configurazione"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Copia"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Copia"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Taglia"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Taglia"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Elimina"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Elimina"
#: tfrmeditor.acteditfind.caption
#, fuzzy
#| msgid "&Find "
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Trova"
#: tfrmeditor.acteditfind.hint
msgctxt "TFRMEDITOR.ACTEDITFIND.HINT"
msgid "Find"
msgstr "Cerca"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Trova prossimo"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Trova prossimo"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr ""
#: tfrmeditor.acteditgotoline.caption
msgctxt "tfrmeditor.acteditgotoline.caption"
msgid "Goto Line..."
msgstr ""
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Incolla"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Incolla"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Ripristina"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Ripristina"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Sostituisci"
#: tfrmeditor.acteditrplc.hint
msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT"
msgid "Replace"
msgstr "Sostituisci"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Selezion&a Tutto"
#: tfrmeditor.acteditselectall.hint
msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT"
msgid "Select All"
msgstr "Seleziona Tutto"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Annulla"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Annulla"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Chiudi"
#: tfrmeditor.actfileclose.hint
msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT"
msgid "Close"
msgstr "Chiudi"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Esci"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Exit"
#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "&Nuovo"
#: tfrmeditor.actfilenew.hint
msgctxt "TFRMEDITOR.ACTFILENEW.HINT"
msgid "New"
msgstr "Nuovo"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Apri"
#: tfrmeditor.actfileopen.hint
msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT"
msgid "Open"
msgstr "Apri"
#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Salva"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Salva"
#: tfrmeditor.actfilesaveas.caption
#, fuzzy
#| msgid "Save &As.."
msgid "Save &As..."
msgstr "Sal&va Come.."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Salva come"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Sal&va Tutto"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Salva tutto"
#: tfrmeditor.caption
msgctxt "TFRMEDITOR.CAPTION"
msgid "Editor"
msgstr "Modifica"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "Ai&uto"
#: tfrmeditor.menuitem1.caption
#, fuzzy
msgctxt "tfrmeditor.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Modifica"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codifica"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Apri come"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Salva come"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&File"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Evidenziazione sintassi"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Fine linea"
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditor.n5.caption
msgctxt "TFRMEDITOR.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
msgid "C&ase sensitivity"
msgstr "Distringui m&aiusc./minusc."
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
msgid "S&earch from caret"
msgstr "&Cerca da ^"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "Espressioni &Regolari"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
msgid "Selected &text only"
msgstr "Seleziona solo &testo"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
msgid "&Whole words only"
msgstr "Solo parole in&tere"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
msgid "Option"
msgstr "Opzione"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
msgid "&Replace with:"
msgstr "&Sostituisci con:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
msgid "&Search for:"
msgstr "Ri&cerca per:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
msgid "Direction"
msgstr "Direzione"
#: tfrmextractdlg.caption
msgctxt "TFRMEXTRACTDLG.CAPTION"
msgid "Unpack files"
msgstr "Decomprimi file"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Estrai i nomi di percorso se salvati con i file"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Estrai ogni archivio in una cartella &separata (nome dell'archivio)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "S&ovrascrivi file esistenti"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Alla &cartella:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "&Estrai file corrispondenti al filtro file:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "&Password per il file codificato:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Chiudi"
#: tfrmfileexecuteyourself.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
msgid "Wait..."
msgstr "Attendere..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Nome file:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "Da:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Clicca su chiudi quando il file temporaneo può essere cancellato!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&Al pannello"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Visualizza tutto"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Operazione corrente"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Da:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "A:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Chiudi"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "&Imposta proprietà"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Imposta su &tutti i file selezionati"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "&Salta questo file"
#: tfrmfileproperties.caption
msgctxt "TFRMFILEPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Proprietà"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Adesivo"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Proprietario"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bit:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppo"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Altro"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Proprietario"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Testo:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Contiene:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Esegui"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Nome file"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Nome file"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Percorso:"
#: tfrmfileproperties.lblgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
msgid "&Group"
msgstr "&Gruppo"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Ultimo accesso:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Ultima modifica:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Ultimo cambio di stato:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Ottale:"
#: tfrmfileproperties.lblownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
msgid "O&wner"
msgstr "&Proprietario"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Leggi"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Dimensione:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Link simbolico a:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Tipo:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Scrivi"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Nome"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Valore"
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attributi"
#: tfrmfileproperties.tsimage.caption
msgid "Image"
msgstr ""
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Proprietà"
#: tfrmfinddlg.actcancel.caption
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "A&nnulla"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "&Chiudi"
#: tfrmfinddlg.actclose.caption
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "Chiudi"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Modifica"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "Feed to &listbox"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Vai al file"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Cerca Data"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Ultima ricerca"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Nuova ricerca"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr ""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr ""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr ""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Avvia"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Mostra"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Aggiungi"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Aiuto"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Salva"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Elimina"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "C&arica"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "S&alva"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Sa&lva con \"Start in directory\""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Se salvato allora \"Start in directory\" sarà ripristinato al caricamento del modello. Usalo se vuoi effettuare una ricerca su una cartella specifica"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Usa modello"
#: tfrmfinddlg.caption
msgctxt "TFRMFINDDLG.CAPTION"
msgid "Find files"
msgstr "Trova file"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Dist&ingui maiusc./minusc."
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "&Data da:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Dat&a a:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "D&imensione da:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Di&mensione a:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr ""
#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "Cerca &testo in file"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION"
msgid "Follow s&ymlinks"
msgstr "Segui link s&imbolico"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "Trova file che N&ON contengono il testo"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Non &più vecchio di:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr ""
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "&Cerca usando parte del nome del file"
#: tfrmfinddlg.cbregexp.caption
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "Espressioni &Regolari"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "So&stituisci con"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Cartelle e &file selezionati"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr ""
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "Data/&Ora da:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "Data/O&ra a:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "&Utilizza plugin per le ricerche:"
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Inserisci i nomi delle cartelle che devono essere escluse dalla ricerca, separati con \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Inserisci i nomi di file che devono essere esclusi dalla ricerca, separati con \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Inserisci i nomi di file separati con \";\""
#: tfrmfinddlg.cmbfindfilemask.text
msgctxt "TFRMFINDDLG.CMBFINDFILEMASK.TEXT"
msgid "*"
msgstr "*"
#: tfrmfinddlg.gbdirectories.caption
msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION"
msgid "Directories"
msgstr "Cartelle"
#: tfrmfinddlg.gbfiles.caption
msgctxt "TFRMFINDDLG.GBFILES.CAPTION"
msgid "Files"
msgstr "File"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Cerca Data"
#: tfrmfinddlg.lblattributes.caption
msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION"
msgid "Attri&butes"
msgstr "Attri&buti"
#: tfrmfinddlg.lblencoding.caption
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
msgid "Encodin&g:"
msgstr "Codi&fica:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "E&scludi sottocartelle"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "&Escludi file"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "&Filtro file"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Avvio nella &cartella"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Trova so&ttocartelle:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "Ricerche &precedenti:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr ""
#: tfrmfinddlg.mioptions.caption
#, fuzzy
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Opzioni"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Rimuovi dalla lista"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.miseparator1.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.miseparator2.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Visualizza tutti gli elementi trovati"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr ""
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Mostra nel visualizzatore"
#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Visualizza"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Avanzate"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Carica/Salva"
#: tfrmfinddlg.tsplugins.caption
msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Plugin"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Risultati"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Standard"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Cerca"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Cerca"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "D&istingui maiusc./minusc."
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Crea un Hard Link"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Destinazione a cui punta il collegamento"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Nome del co&llegamento"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr ""
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr ""
#: tfrmhotdirexportimport.caption
msgctxt "tfrmhotdirexportimport.caption"
msgid "Select the entries your want to import"
msgstr ""
#: tfrmhotdirexportimport.lbhint.caption
msgctxt "tfrmhotdirexportimport.lbhint.caption"
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr ""
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr ""
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgctxt "TFRMLINKER.CAPTION"
msgid "Linker"
msgstr "Linker"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Salva in..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Elemento"
#: tfrmlinker.lblfilename.caption
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "&Nome file"
#: tfrmlinker.spbtndown.caption
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "&Giù"
#: tfrmlinker.spbtndown.hint
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
msgid "Down"
msgstr "Giù"
#: tfrmlinker.spbtnrem.caption
#, fuzzy
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "&Elimina"
#: tfrmlinker.spbtnrem.hint
#, fuzzy
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "Elimina"
#: tfrmlinker.spbtnup.caption
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "&Su"
#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Su"
#: tfrmmain.actabout.caption
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
msgid "&About"
msgstr "&Info"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Aggiungi nome file nella linea di comando"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Aggiungi percorso e nome file nella linea di comando"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Copia percorso completo nella linea di comando"
#: tfrmmain.actbriefview.caption
#, fuzzy
#| msgid "Brief"
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr "Breve"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Visualizzazione breve"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Calcola spazio &occupato"
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Cambia cartella"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr ""
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Vai alla cartella superiore"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Vai alla cartella radice"
#: tfrmmain.actchecksumcalc.caption
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "Calcola Check&sum..."
#: tfrmmain.actchecksumverify.caption
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "Verifica Chec&ksum..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Pulisci il file di registro operazioni"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Pulisci la finestra di registro operazioni"
#: tfrmmain.actclosealltabs.caption
msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION"
msgid "Close &All Tabs"
msgstr "Chiudi &tutte le schede"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr ""
#: tfrmmain.actclosetab.caption
msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION"
msgid "&Close Tab"
msgstr "&Chiudi la scheda"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Prossima riga di comando"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Scrivi nella riga di comando il prossimo comando della cronologia"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Riga di comando precedente"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Scrivi nella riga di comando il precedente comando della cronologia"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Completo"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "VIsta colonne"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Confronta per &contenuto"
#: tfrmmain.actcomparedirectories.caption
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
msgid "Compare Directories"
msgstr "Confronta cartelle"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Confronta cartelle"
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr ""
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr ""
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr ""
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr ""
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Mostra menu contestuale"
#: tfrmmain.actcopy.caption
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Copia"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr ""
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr ""
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Copia il nome del file con il &percorso completo"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Copia nome(i) di file negli appunti"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Copia file senza chiedere conferme"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr ""
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr ""
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Copia nello stesso pannello"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Copia"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Most&ra spazio occupato"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "&Taglia"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr ""
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Elimina"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "Cronologia cartelle"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Cartelle pre&ferite"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr ""
#: tfrmmain.actedit.caption
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Modifica"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Modifica co&mmento..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Modifica nuovo file"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Modifica campo percorso precedente nella lista file"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Scambia &pannelli"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "Es&ci"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "&Estrai file..."
#: tfrmmain.actfileassoc.caption
#, fuzzy
#| msgid "File &Associations..."
msgid "Configuration of File &Associations"
msgstr "&Associazioni file..."
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "&Unisci file..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Mostra proprietà &file"
#: tfrmmain.actfilespliter.caption
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
msgid "Spl&it File..."
msgstr "D&ividi file..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr ""
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Attiva linea di comando"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Posiziona cursore sul primo file in lista"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Posiziona cursore sull'ultimo file in lista"
#: tfrmmain.acthardlink.caption
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
msgid "Create &Hard Link..."
msgstr "Crea &Hard Link..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Contenuti"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "Modalità &pannelli &orizzontali"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Tastiera"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr ""
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr ""
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Sinistra &= Destra"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr ""
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Apri lista unità di sinistra"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr ""
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr ""
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr ""
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr ""
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr ""
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr ""
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr ""
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr ""
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Carica selezione dagli a&ppunti"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "Carica selezione da &file..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr ""
#: tfrmmain.actmakedir.caption
#, fuzzy
#| msgid "Create directory"
msgid "Create &Directory"
msgstr "Crea cartella"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Seleziona tutti i file con la stessa e&stensione"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "&Inverti selezione"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "&Seleziona tutto"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "Deseleziona un gr&uppo..."
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "Seleziona un &gruppo..."
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "&Deseleziona tutto"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimizza finestra"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Strumento Multi-&Rinomina"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "&Connetti alla Rete..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "&Disconnetti dalla Rete"
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Connessione &rapida alla rete..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Nuova scheda"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Vai alla scheda &successiva"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Apri"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Tenta di aprire l'archivio"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Apri barra file"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Apri car&tella in una nuova scheda"
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
msgid "Open &VFS List"
msgstr "Apri lista &VFS"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "&Visualizzatore operazioni"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Opzioni..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "&Comprimi file..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Imposta la posizione del divisore"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "Inc&olla"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Vai alla scheda &precedente"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Filtro rapido"
#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Ricerca rapida"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "Pannello di visualizzazione &rapida"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "&Aggiorna"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Sposta"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Sposta/rinomina i file senza chiedere conferma"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Rinomina"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "Ri&nomina scheda"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Ripristina selezione"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "In&verti ordine"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr ""
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr ""
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Destra &= Sinistra"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr ""
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Apri lista unità di destra"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr ""
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr ""
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr ""
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr ""
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr ""
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr ""
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr ""
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Avvia &terminale"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr ""
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Sal&va selezione"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Salva s&elezione su file..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr ""
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Ricerca..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr ""
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr ""
#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "Cambia &attributi..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Bloccato con cartelle aperte in &nuove schede"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normale"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Bloccato"
#: tfrmmain.actsettaboptionpathresets.caption
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
msgid "Locked with &Directory Changes Allowed"
msgstr "Bloccato con modifiche alla &cartella consentite"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Apri"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Apri usando le associazioni di file di sistema"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Visualizza pulsante menu"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Visualizza cronologia della linea di comando"
#: tfrmmain.actshowmainmenu.caption
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Menu"
#: tfrmmain.actshowsysfiles.caption
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "Mostra file &nascosti/di sistema"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Ordina per &attributi"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Ordina per da&ta"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Ordina per &estensione"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Ordina per &nome"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Ordina per &dimensione"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr ""
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Attiva/disattiva la lista dei file da ignorare"
#: tfrmmain.actsymlink.caption
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "Crea &Link Simbolico..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr ""
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Destinazione &= Sorgente"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "&Verifica archivio(i)"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Anteprime"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Visualizza anteprime"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr ""
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Trasferisci cartella evidenziata dal cursore nella finestra di sinistra"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Trasferisci cartella evidenziata dal cursore nella finestra di destra"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr ""
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr ""
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Deseleziona i file con la stessa estensione"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Visualizza"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Mostra cronologia dei percorsi visitati per la vista attiva"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Vai alla prossima voce nella cronologia"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Vai alla voce precedente nella cronologia"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr ""
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Visita il sito di Double Commander"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Cancellazione sicura"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr ""
#: tfrmmain.btnf10.caption
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Esci"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Cartella"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Elimina"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminale"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
#, fuzzy
#| msgid "Directory hotlist"
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Cartelle preferite"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Mostra la cartella corrente del pannello di destra in quello di sinistra"
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
msgid "Go to home directory"
msgstr "Vai alla cartella home"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
msgid "Go to root directory"
msgstr "Vai alla cartella radice"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
msgid "Go to parent directory"
msgstr "Vai alla cartella superiore"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
#, fuzzy
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Cartelle Preferite"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Mostra la cartella corrente del pannello di sinistra nel pannello di destra"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Percorso"
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Annulla"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Copia..."
#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Crea collegamento..."
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline10.caption
#, fuzzy
msgctxt "tfrmmain.miline10.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline11.caption
#, fuzzy
msgctxt "tfrmmain.miline11.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline21.caption
#, fuzzy
msgctxt "tfrmmain.miline21.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline23.caption
#, fuzzy
msgctxt "tfrmmain.miline23.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline26.caption
#, fuzzy
msgctxt "tfrmmain.miline26.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline33.caption
msgctxt "TFRMMAIN.MILINE33.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline37.caption
msgctxt "TFRMMAIN.MILINE37.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline38.caption
msgctxt "tfrmmain.miline38.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline39.caption
#, fuzzy
msgctxt "tfrmmain.miline39.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline40.caption
#, fuzzy
msgctxt "tfrmmain.miline40.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline50.caption
msgctxt "tfrmmain.miline50.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline55.caption
#, fuzzy
msgctxt "tfrmmain.miline55.caption"
msgid "-"
msgstr "-"
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Pulisci"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Copia"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Nascondi"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Seleziona tutto"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Sposta..."
#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Crea un collegamento simbolico (simlink)"
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Pannello Opzioni"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Esci"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Ripristina"
#: tfrmmain.mnualloperpause.caption
msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Avvio"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Annulla"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Comandi"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "C&onfigurazione"
#: tfrmmain.mnucontextline1.caption
msgctxt "tfrmmain.mnucontextline1.caption"
msgid "-"
msgstr "-"
#: tfrmmain.mnucontextline2.caption
msgctxt "tfrmmain.mnucontextline2.caption"
msgid "-"
msgstr "-"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr ""
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&File"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "&Aiuto"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Selezione"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Rete"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Visualizza"
#: tfrmmain.mnutaboptions.caption
#, fuzzy
#| msgid "&Options"
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "&Opzioni"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Pannelli"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Copia"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Taglia"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Elimina"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Modifica"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Incolla"
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmaincommandsdlg.btncancel.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmmaincommandsdlg.btnok.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&OK"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr ""
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr ""
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr ""
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr ""
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr ""
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr ""
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr ""
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Scorciatoia"
#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Aggiungi"
#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "&Aiuto"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Definire..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Distingui maiusc./minusc."
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Filtro di input:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "&O seleziona il tipo predefinito:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Crea nuova cartella"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "&Inserisci un nuovo nome di cartella:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "TFRMMODVIEW.CAPTION"
msgid "New Size"
msgstr "Nuova Dimensione"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Altezza :"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgctxt "tfrmmodview.lblpath2.caption"
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgctxt "tfrmmodview.lblpath3.caption"
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Qualità compressione Jpg"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Larghezza :"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Altezza"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Larghezza"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Chiudi"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Elimina"
#: tfrmmultirename.btnedit.caption
#, fuzzy
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "&Modifica"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "&Carica"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Rinomina"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Reimposta &tutto"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Salva"
#: tfrmmultirename.caption
msgctxt "TFRMMULTIRENAME.CAPTION"
msgid "MultiRename"
msgstr "Strumento Multi-Rinomina"
#: tfrmmultirename.cblog.caption
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "A&bilita"
#: tfrmmultirename.cbregexp.caption
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "E&spressioni Regolari"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "&Usa la sostituzione"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Estensione"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Contatore"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Trova && Sostituisci"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Registra risultati"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Filtro"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Preset"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "&Estensione"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "&Trova..."
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "&Intervallo"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "&Nome file"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "&Sostituisci"
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "Numero di p&artenza"
#: tfrmmultirename.lbwidth.caption
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "&Larghezza"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Contatore"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Giorno"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Giorno (2 cifre)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Giorno della settimana(corto, es: \"lun\")"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Giorno della settimana(lungo, es: \"lunedì\")"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Carattere alla posizione x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Caratteri dalla posizione x a y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Ora"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Ora (2 cifre)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minuto"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minuto (2 cifre)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Mese"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Mese (2 cifre)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Nome mese(corto, es : \"gen\")"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Nome del mese(lungo, es : \"gennaio\")"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Nome"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Carattere alla posizione x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Carattere dalla posizione x a y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Ora..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Estensione..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Nome..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Plugin"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Secondi"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Secondi (2 cifre)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Anni (2 cifre)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Anni (4 cifre)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr ""
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr ""
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION"
msgid "Old File Name"
msgstr "Vecchio nome del file"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION"
msgid "New File Name"
msgstr "Nuovo nome del file"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION"
msgid "File Path"
msgstr "Percorso del file"
#: tfrmmultirenamewait.caption
#, fuzzy
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Scegli un'applicazione"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Comando personalizzato"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Salva associazione"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Setta l'applicazione selezionata come azione predefinita"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Tipo di file da aprire: %s"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Nomi di file multipli"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "URI multipli"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Nome di file singolo"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "URI singolo"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
msgid "&Apply"
msgstr "&Applica"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmoptions.caption
msgctxt "TFRMOPTIONS.CAPTION"
msgid "Options"
msgstr "Opzioni"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Si prega si selezionare una delle sotto pagine, questa pagina non contiene alcuna impostazione"
#: tfrmoptionsarchivers.btnautoconfig.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNAUTOCONFIG.CAPTION"
msgid "A&uto Configure"
msgstr "Config.a&utomatica"
#: tfrmoptionsarchivers.btnmultiarcadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
msgid "A&dd"
msgstr "A&ggiungi"
#: tfrmoptionsarchivers.btnmultiarcapply.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCAPPLY.CAPTION"
msgid "A&pply"
msgstr "A&pplica"
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCDELETE.CAPTION"
msgid "D&elete"
msgstr "E&limina"
#: tfrmoptionsarchivers.btnmultiarcrename.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
msgid "&Rename"
msgstr "&Rinomina"
#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCDEBUG.CAPTION"
msgid "De&bug mode"
msgstr "De&bug mode"
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCENABLED.CAPTION"
msgid "E&nabled"
msgstr "A&bilita"
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCOUTPUT.CAPTION"
msgid "S&how console output"
msgstr "M&ostra output della console"
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
msgid "Options"
msgstr "Opzioni"
#: tfrmoptionsarchivers.lblarchiveadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEADD.CAPTION"
msgid "Add&ing:"
msgstr "Agg&iungi:"
#: tfrmoptionsarchivers.lblarchiveextension.caption
msgctxt "tfrmoptionsarchivers.lblarchiveextension.caption"
msgid "E&xtension:"
msgstr "E&stensione:"
#: tfrmoptionsarchivers.lblarchiveextract.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTRACT.CAPTION"
msgid "Ex&tract:"
msgstr "Es&trai:"
#: tfrmoptionsarchivers.lblarchivelist.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELIST.CAPTION"
msgid "&List:"
msgstr "&Lista"
#: tfrmoptionsarchivers.lblarchivelistend.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTEND.CAPTION"
msgid "Listing &finish (optional):"
msgstr "Elencazione &finita (opzionale):"
#: tfrmoptionsarchivers.lblarchivelistformat.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTFORMAT.CAPTION"
msgid "Listing for&mat:"
msgstr "For&mato lista:"
#: tfrmoptionsarchivers.lblarchiveliststart.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTSTART.CAPTION"
msgid "Listin&g start (optional):"
msgstr "Avvio elencazione (opzionale):"
#: tfrmoptionsarchivers.lblarchiver.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVER.CAPTION"
msgid "Arc&hiver:"
msgstr "Arc&hiviatore:"
#: tfrmoptionsarchivers.lbldescription.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLDESCRIPTION.CAPTION"
msgid "De&scription:"
msgstr "De&scrizione:"
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
msgid "Additional"
msgstr "Addizionale"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
msgid "General"
msgstr "Generale"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
msgid "When &size, date or attributes change"
msgstr "Quando dimen&sione, data o attributi cambiano"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Per i seguenti &percorsi e relative sottocartelle:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
msgid "When &files are created, deleted or renamed"
msgstr "Quando i file sono &creati, eliminati o rinominati"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
msgid "When application is in the &background"
msgstr "Quando l'applicazione è in secondo &piano"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
msgid "Disable auto-refresh"
msgstr "Disabilita auto-aggiornamento"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
msgid "Refresh file list"
msgstr "Aggiorna lista file"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
msgid "Al&ways show tray icon"
msgstr "Tray icon sempre &visibile "
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "&Nascondi automaticamente i dispositivi smontati"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
msgid "Mo&ve icon to system tray when minimized"
msgstr "Sposta icone nella s&ystem tray quando minimizzato"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
msgid "A&llow only one copy of DC at a time"
msgstr "C&onsenti solo una copia di DC in esecuzione"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Qui puoi inserire una o più unità o punti di mount, separati da \";\""
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Lista &nera delle unità"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr ""
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr ""
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr ""
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr ""
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr ""
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "Taglia &testo alla larghezza colonna"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "Linee &orizzontali"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "Linee &verticali"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "A&uto-riempimento colonna"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Mostra griglia"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Auto-ridimensionamento colonne"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Dimen&sione automatica colonna"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "A&pplica"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "&Modifica"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "Cronologia linea di co&mando"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
msgid "&Directory history"
msgstr "Cronologia &cartelle"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "&Cronologia filtri file"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "Sal&va configurazione"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "Cronologia Trov&a/Sostituisci"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Cartelle"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Posizione file di configurazione"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Salva all'uscita"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Imposta sulla linea di comando"
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "Cartella p&rogramma (versione portabile)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "Cartella home dell'&utente"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Tutto"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "&Elimina"
#: tfrmoptionscustomcolumns.btnfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr ""
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Nuovo"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr ""
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr ""
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Rinomina"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Salva come"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "Salva"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Consentire sovrapposizione colori"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr ""
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "Generale"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Bordo cursore"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr ""
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr ""
#: tfrmoptionscustomcolumns.lblbackcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "Sfondo:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Sfondo 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
#, fuzzy
#| msgid "Con&figure columns for file system:"
msgid "Con&figure columns view:"
msgstr "Con&figura colone per file system:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr ""
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "Colore cursore:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Colore testo:"
#: tfrmoptionscustomcolumns.lblfontname.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Font:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Dimensione:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "Colore testo:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "Colore selezione:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr ""
#: tfrmoptionscustomcolumns.miaddcolumn.caption
#, fuzzy
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Aggiungi colonna"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "Add..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Backup..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "Delete..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "Export..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "Help"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Import..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "Insert..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "Miscellaneous..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
msgid "Some functions to select appropriate target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "Sort..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "When adding directory, add also target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only valid environment variables"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In popup, show [path also]"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
msgid "Name, a-z"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr ""
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
msgid "Name:"
msgstr "Nome:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
msgid "Path:"
msgstr "Percorso:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
msgid "Target:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miactiveframedirectory.caption
msgctxt "tfrmoptionsdirectoryhotlist.miactiveframedirectory.caption"
msgid "directory of the active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miactiveinactiveframedirectory.caption
msgctxt "tfrmoptionsdirectoryhotlist.miactiveinactiveframedirectory.caption"
msgid "directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddcommand.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddcommand.caption"
msgid "a command"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddcommand2.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddcommand2.caption"
msgid "Add a command"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddcopyofselected.caption"
msgid "a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected2.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddcopyofselected2.caption"
msgid "Add a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddseparator.caption"
msgid "a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddseparator2.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddseparator2.caption"
msgid "Add a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddsubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu.caption"
msgid "sub-menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mibrowsetodirectory.caption
msgctxt "tfrmoptionsdirectoryhotlist.mibrowsetodirectory.caption"
msgid "directory I will browse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.micollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micurrentselectedoractivedirectories.caption
msgid "current selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micutselection.caption
msgctxt "tfrmoptionsdirectoryhotlist.micutselection.caption"
msgid "Cut"
msgstr "Taglia"
#: tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption"
msgid "delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption"
msgid "selected item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
msgid "Scan all hotdir's path to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
msgid "Scan all hotdir's path && target to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"wincmd.ini\" of TC"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.miopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mipasteselection.caption
msgctxt "tfrmoptionsdirectoryhotlist.mipasteselection.caption"
msgid "Paste"
msgstr "Incolla"
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "Restore a backup of Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "Save a backup of current Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and replace..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplaceinpath.caption
msgid "in path..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplaceintargetpath.caption
msgid "in target path..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchinreplaceinbothpaths.caption
msgid "in path and target path..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator1.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator10.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator11.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator12.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator12.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator13.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator2.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator3.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator4.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator5.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator5.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator6.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator7.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator8.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.miseparator9.caption
msgctxt "tfrmoptionsdirectoryhotlist.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resulting menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitypethedirectory.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitypethedirectory.caption"
msgid "directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitypethedirectory2.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitypethedirectory2.caption"
msgid "Add directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitypethedirectory3.caption
msgid "Insert directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel:"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr ""
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "&Mostra finestra di conferma dopo il rilascio dell'oggetto"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr ""
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr ""
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Mostra &file system"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Mostra spazio lib&ero"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Mostra &etichetta"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Lista unità"
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "S&fondo"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "S&fondo"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr ""
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
msgid "Save"
msgstr "Salva"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Attributi degli elementi"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "P&rimo piano"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "P&rimo piano"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "&Selezione-testo"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Usa (e modifica) schemi di impostazione &globale"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Usa schemi di impostazione &locale"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Grassetto"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&verti"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&ff"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "O&n"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Corsivo"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&verti"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&ff"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "O&n"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "&Cancellare"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&verti"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&ff"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "O&n"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "&Sottolinea"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "In&verti"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "O&ff"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "O&n"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr ""
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr ""
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr ""
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr ""
#: tfrmoptionsfavoritetabs.btnrename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Rinomina"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr ""
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr ""
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "No"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr ""
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr ""
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem1.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsfavoritetabs.micutselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Taglia"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr ""
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsfavoritetabs.mipasteselection.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Incolla"
#: tfrmoptionsfavoritetabs.mirename.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Rinomina"
#: tfrmoptionsfavoritetabs.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
#, fuzzy
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr ""
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Aggiungi"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "&Add"
msgstr "&Aggiungi"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "A&ggiungi"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr ""
#: tfrmoptionsfileassoc.btndownact.caption
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "&Down"
msgstr "&Giù"
#: tfrmoptionsfileassoc.btneditext.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edit"
msgstr "Modifica"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btnremoveact.caption
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
msgid "Remo&ve"
msgstr "&Elimina"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
msgid "Re&move"
msgstr "&Elimina"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "&Elimina"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "&Rinomina"
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "&Su"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr ""
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr ""
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Azioni"
#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
msgid "Extensions"
msgstr "Estensioni"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Tipi di file"
#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
msgid "Icon"
msgstr "Icona"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lblaction.caption
#, fuzzy
#| msgid "Action:"
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
msgid "Action name:"
msgstr "Azione:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "&Command:"
msgstr "&Comando:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parametr&i:"
#: tfrmoptionsfileassoc.lblstartpath.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Percor&so di avvio"
#: tfrmoptionsfileassoc.menuitem1.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr ""
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr ""
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Modifica"
#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
msgid "Open in Editor"
msgstr "Apri nell'Editor"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr ""
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
msgid "Get output from command"
msgstr "Prendi l'output dal comando"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr ""
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr ""
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Apri"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr ""
#: tfrmoptionsfileassoc.miseparator.caption
#, fuzzy
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgctxt "tfrmoptionsfileassoc.mishell.caption"
msgid "Run in terminal"
msgstr "Esegui in nel terminale"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Visualizza"
#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
msgid "Open in Viewer"
msgstr "Apri nel visualizzatore"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr ""
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr ""
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr ""
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr ""
#: tfrmoptionsfileoperations.bvlconfirmations.caption
#, fuzzy
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr "Mostra finestra di conferma per:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Operazione di cop&ia"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Operazione di &eliminazione"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Elimina dal cestino (il tasto shift inverte questa impostazione)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Operazione di e&liminazione dal cestino"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
msgid "D&rop readonly flag"
msgstr "&Rimuovi proprietà sola lettura"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "Operazione di s&postamento"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "&Processa commenti con file/cartelle"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Seleziona solo il nome del &file quando si rinomina (non l'estensione)"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Mostr&a pannello di selezione nella finestra di dialogo copia/sposta"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "S&alta operazioni sui file con errori e riportali nella finestra di registro operazioni"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Esecuzione di operazioni"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Interfaccia utente"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "Dimensione del &Buffer per operazioni sui file (in kB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Mostra &inizialmente il progresso delle operazioni in:"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr ""
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "&Numero passaggi di cancellazione sicura"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr ""
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Consentire sovrapposizione colori"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Usa il cursore &Frame"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Usa &indicatore gradiente"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "U&sa selezione invertita"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
#, fuzzy
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Bordo cursore"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
msgid "Drive Free Space Indicator"
msgstr "Indicatore di spazio libero sull'unità"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "Sfo&ndo:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
msgid "Backg&round 2:"
msgstr "Sfon&do 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
msgid "C&ursor Color:"
msgstr "C&olore Cursore:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
msgid "Cursor Te&xt:"
msgstr "Te&sto Cursore:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "Livello di &luminosità del pannello inattivo"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Indicat.color.s&fondo:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Indicat.color.Primo&Piano:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
msgid "&Mark Color:"
msgstr "&Selezione colore:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
msgid "T&ext Color:"
msgstr "Colore t&esto:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "&Cerca parte del nome del file"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr ""
#: tfrmoptionsfilesearch.gbfilesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Cerca file"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr ""
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Usa mappatura della memoria per la ricerca di te&sto nei file"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "&Usa stream per la ricerca di testo nei file"
#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "&Aggiungi"
#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "&Aiuto"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "No&n caricare la lista di file finché una scheda viene attivata"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "&Mostra parentesi quadre attorno alle cartelle"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Evi&denzia i file nuovi/aggiornati"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr ""
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
msgid "Load &file list in separate thread"
msgstr "Carica lista &file in un processo separato"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
msgid "Load icons af&ter file list"
msgstr "Carica le icone &dopo la lista file"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
msgid "Show s&ystem and hidden files"
msgstr "Mostra file nascosti/di s&istema"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "&Quando si selezionano file con <SPAZIO>, il cursore viene spostato sul file successivo (come <INS>)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independant attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formattazione"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Ordinamento"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Di&stingui maiusc./minusc.:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Formato non corretto"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "Formato &data e ora:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Formato della dimen&sione file"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "&Inserisci nuovi file:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "O&rdinamento cartelle:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "&Metodo di ordinamento:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "&Sposta file aggiornati:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "A&ggiungi"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "A&pplica"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "&Elimina"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Modello..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Colore dei tipi di file (ordina con drag&&drop)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "&Attributi categoria:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Co&lore categoria:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
msgid "Category &mask:"
msgstr "&Filtro categoria:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
msgid "Category &name:"
msgstr "&Nome categoria:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr ""
#: tfrmoptionsfonts.lbleditorfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
msgid "&Editor font"
msgstr "Font &editor"
#: tfrmoptionsfonts.lbllogfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
msgid "&Log font"
msgstr "&Registra font"
#: tfrmoptionsfonts.lblmainfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
msgid "Main &font"
msgstr "&Font principale"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr ""
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr ""
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
msgid "Viewer&Book Font"
msgstr "Visualizzatore &Book Font"
#: tfrmoptionsfonts.lblviewerfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
msgid "&Viewer font"
msgstr "&Visualizzatore font"
#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "&Aggiungi scorciatoia"
#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Copia"
#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Elimina"
#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "&Elimina scorciatoia"
#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "&Modifica scorciatoia"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Rinomina"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
msgid "&Filter"
msgstr "&Filtro"
#: tfrmoptionshotkeys.lblcategories.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION"
msgid "C&ategories:"
msgstr "C&ategorie:"
#: tfrmoptionshotkeys.lblcommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION"
msgid "Co&mmands:"
msgstr "Co&mandi:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
msgid "&Shortcut files:"
msgstr "&Scorciatoia file:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Comando"
#: tfrmoptionshotkeys.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Per i seguenti &percorsi e le relative sottocartelle:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Mostra icone per le azioni nei &menu"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
msgid "Show o&verlay icons, e.g. for links"
msgstr "Mostra i&cone sostitutive, ad es. per i collegamenti"
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Disabilita icone speciali"
#: tfrmoptionsicons.gbiconssize.caption
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
msgid " Icon size "
msgstr " Dimen&sione Icona "
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
msgid " Show icons to the left of the filename "
msgstr " Mostra icone alla sinistra del nome file "
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
msgid "A&ll"
msgstr "&Tutto"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
msgid "All associated + &EXE/LNK (slow)"
msgstr "Tutti gli associati + &EXE/LNK (lento)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
msgid "&No icons"
msgstr "&No icone"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
msgid "Only &standard icons"
msgstr "S&olo icone predefinite"
#: tfrmoptionsignorelist.btnaddsel.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
msgid "A&dd selected names"
msgstr "&Aggiungi nomi selezionati"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
msgid "Add selected names with &full path"
msgstr "Aggiungi nomi selezionati con percorso co&mpleto"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignora (non mostrare) i seguenti file e cartelle:"
#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
msgid "&Save in:"
msgstr "&Salva in:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Le frecce sinistra e destra cambiano cartella (movimenti stile Lynx)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Digitazione"
#: tfrmoptionskeyboard.lblalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
msgid "Alt+L&etters:"
msgstr "Alt+L&ettere:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+Le&ttere:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
msgid "&Letters:"
msgstr "&Lettere:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
msgid "&Flat buttons"
msgstr "Pulsanti &piatti"
#: tfrmoptionslayout.cbflatinterface.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
msgid "Flat i&nterface"
msgstr "I&nterfaccia piatta"
#: tfrmoptionslayout.cbflattoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
msgid "Flat b&uttons"
msgstr "P&ulsanti piatti"
#: tfrmoptionslayout.cbfreespaceind.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
msgid "Show fr&ee space indicator on drive label"
msgstr "Mostra indicatore spazio lib&ero sull'etichetta unità"
#: tfrmoptionslayout.cblogwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
msgid "Show lo&g window"
msgstr "Mostra finestra di registro operazioni"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
msgid "Show panel of operation in background"
msgstr "Mostra pannello di registro operazioni in secondo piano"
#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
msgid "Show common progress in menu bar"
msgstr "Mostra progressi comuni nella barra menu"
#: tfrmoptionslayout.cbshowcmdline.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
msgid "Show command l&ine"
msgstr "Mostra &linea di comando"
#: tfrmoptionslayout.cbshowcurdir.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
msgid "Show current director&y"
msgstr "Mostra &cartella corrente"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
msgid "Show &drive buttons"
msgstr "Mostra pulsanti uni&tà"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
msgid "Show free s&pace label"
msgstr "Mostra etichetta s&pazio libero"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Mostra pulsan&te lista unità"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
msgid "Show function &key buttons"
msgstr "Mostra i tasti &funzione"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
msgid "Show &main menu"
msgstr "Mostra &menu principale"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
#, fuzzy
#| msgid "Show &button bar"
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
msgid "Show tool&bar"
msgstr "Mostra barra &pulsanti"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Mostra &etichetta breve di spazio libero"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
msgid "Show &status bar"
msgstr "Mostra barra di &stato"
#: tfrmoptionslayout.cbshowtabheader.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
msgid "S&how tabstop header"
msgstr "Mostra le intestazioni delle schede"
#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
msgid "Sho&w folder tabs"
msgstr "Mostra le schede"
#: tfrmoptionslayout.cbtermwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
msgid "Show te&rminal window"
msgstr "Mostra finestra te&rminale"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Mostra due barre pulsanti di unità (larghezza fi&ssa, sopra le finestre file)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
msgid " Screen layout "
msgstr "Disposizione schermo"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr ""
#: tfrmoptionslog.cblogarcop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
msgid "&Pack/Unpack"
msgstr "&Comprimi/decomprimi"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr ""
#: tfrmoptionslog.cblogcpmvln.caption
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
msgid "Cop&y/Move/Create link/symlink"
msgstr "Cop&ia/Sposta/Crea collegamento/simlink"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "&Elimina"
#: tfrmoptionslog.cblogdirop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
msgid "Crea&te/Delete directories"
msgstr "Cre&a/Elimina cartelle"
#: tfrmoptionslog.cblogerrors.caption
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
msgid "Log &errors"
msgstr "Registra &errori"
#: tfrmoptionslog.cblogfile.caption
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
msgid "C&reate a log file:"
msgstr "&Crea file di registro:"
#: tfrmoptionslog.cbloginfo.caption
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
msgid "Log &information messages"
msgstr "Registra messaggi di &informazione"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr ""
#: tfrmoptionslog.cblogsuccess.caption
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
msgid "Log &successful operations"
msgstr "Registra &operazioni eseguite con successo"
#: tfrmoptionslog.cblogvfs.caption
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
msgid "&File system plugins"
msgstr "Plugin del &File system"
#: tfrmoptionslog.gblogfile.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
msgid "File operation log file"
msgstr "File di registro operazioni"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Registro operazioni"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Stato operazioni"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Rimuovi anteprime per file non più esistenti"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "tfrmoptionsmisc.chkdesccreateunicode.caption"
msgid "Create new with the encoding:"
msgstr ""
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "&Vai sempre alla radice quando si cambia unità"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION"
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Mostra messaggi di avvertimento (solo pulsante \"OK\")"
#: tfrmoptionsmisc.chkthumbsave.caption
msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION"
msgid "&Save thumbnails in cache"
msgstr "&Salva anteprime in cache"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Anteprime"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr ""
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr ""
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "tfrmoptionsmisc.lbldescrdefaultencoding.caption"
msgid "Default encoding:"
msgstr ""
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr ""
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr ""
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr ""
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "pixel"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Dimensione anteprime:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Selezione da mouse"
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Scorrimento"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Selezione"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Modo:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "&Linea per linea"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Linea per linea &con movimento del cursore"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Pagina per pagina"
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "A&ggiungi"
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "Con&figura"
#: tfrmoptionsplugins.btnenableplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
msgid "E&nable"
msgstr "A&bilita"
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "&Elimina"
#: tfrmoptionsplugins.btntweakplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
msgid "&Tweak"
msgstr "Tweak"
#: tfrmoptionsplugins.lbldsxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "I plugin di ricer&ca consentono di usare algoritmi di ricerca alternativi o strumenti esterni (come \"locate\", ecc.)"
#: tfrmoptionsplugins.lblwcxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
msgid "Pack&er plugins are used to work with archives"
msgstr "I plugin dei compr&essori sono usati per aprire archivi non supportati internamente da Double Commander."
#: tfrmoptionsplugins.lblwdxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "I plu&gin di contenuto permettono di visualizzare dettagli estesi sui file come tag mp3 o attributi di immagine nella lista file, o di usarli negli strumenti di ricerca e nello strumento Multi-Rinomina."
#: tfrmoptionsplugins.lblwfxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "I plugin del Fi&le system permettono l'accesso a dischi altrimenti inaccessibili dal sistema operativo o a dispositivi esterni come Palm/PockePC."
#: tfrmoptionsplugins.lblwlxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "I plugin del visualizzatore consentono di aprire formati di file come immagini, fogli elettronici, database ecc. in Visualizza/Mostra (F3, Ctrl+Q)"
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
msgid "Active"
msgstr "Attiva"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr "Plugin"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
msgid "Registered for"
msgstr "Registrato per"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr "Nome file"
#: tfrmoptionsplugins.tsdsx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
msgid "&Search plugins (.DSX)"
msgstr "&Plugin ricerca (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
msgid "Pac&ker plugins (.WCX)"
msgstr "Plugin &compressori (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
msgid "Content pl&ugins (.WDX)"
msgstr "Pl&ugin contenuto (.WDX)"
#: tfrmoptionsplugins.tswfx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
msgid "F&ile system plugins (.WFX)"
msgstr "Plugin F&ile system (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
msgid "&Viewer plugins (.WLX)"
msgstr "Plugin &visualizzatore (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
msgid "&Beginning (name must start with first typed character)"
msgstr "&Iniziale (il nome deve iniziare con il primo carattere digitato)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "Fi&nale (l'ultimo carattere digitato prima del punto . deve corrispondere)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Opzioni"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Corrispondenza esatta del nome"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Ricerca maiusc./minusc."
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Cerca questi elementi"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr ""
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Attiva &pannello destinazione quando clicchi su una delle sue schede"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
msgid "&Show tab header also when there is only one tab"
msgstr "&Mostra l'intestazione della scheda anche quando ce n'è una sola"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr ""
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
msgid "Con&firm close all tabs"
msgstr "&Conferma chiusura di tutte le schede"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr ""
#: tfrmoptionstabs.cbtabslimitoption.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
msgid "&Limit tab title length to"
msgstr "&Limita lunghezza titolo della scheda a"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
msgid "Show locked tabs &with an asterisk *"
msgstr "Mostra schede bloccate con asterisco *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
msgid "&Tabs on multiple lines"
msgstr "&Schede su più linee"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&Su apre nuova scheda in secondo piano"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
msgid "Open &new tabs near current tab"
msgstr "Apri &nuove schede accanto alla corrente"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr ""
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
msgid "Show ta&b close button"
msgstr "Mostra tasto di chiusura sulle s&chede"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr ""
#: tfrmoptionstabs.gbtabs.caption
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
msgid "Folder tabs headers"
msgstr "Intestazioni delle schede"
#: tfrmoptionstabs.lblchar.caption
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
msgid "characters"
msgstr "caratteri "
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr ""
#: tfrmoptionstabs.lbltabsposition.caption
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
msgid "Ta&bs position"
msgstr "Posizione sche&de"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
#, fuzzy
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "No"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr ""
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr ""
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr ""
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr ""
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr ""
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Parametri:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Parametri:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Parametri:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "Clo&na pulsante"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "&Elimina"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION"
msgid "Edit hot&key"
msgstr "Modifica scorciato&ia"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION"
msgid "&Insert new button"
msgstr "&Inserisci nuovo tasto"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr ""
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Altro"
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION"
msgid "Remove hotke&y"
msgstr "Rimuovi scorciato&ia"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr ""
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "Pulsanti &piatti"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr ""
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Inserisci parametri di comando, ognuno in una linea separata. Premi F1 per visualizzare l'aiuto sui parametri"
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Aspetto"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "Dimensione ba&rra"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION"
msgid "Comman&d:"
msgstr "Coman&do"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parametr&i:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr ""
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Scorciatoia:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Ico&na:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Dimensione ic&ona:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "Co&mando"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "&Parametri:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Percor&so di avvio"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "&Tooltip:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr ""
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr ""
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr ""
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr ""
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr ""
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr ""
#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr ""
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr ""
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr ""
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr ""
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr ""
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Tipo di pulsante"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "&Lascia la finestra del terminale aperta dopo l'esecuzione di un programma"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "&Esegui nel terminale"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "&Usa programma esterno"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "Parametri &addizionali"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "&Percorso del programma da eseguire"
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "&Aggiungi"
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "A&pplica"
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "&Elimina"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Modello..."
#: tfrmoptionstooltips.chkshowtooltip.caption
#, fuzzy
#| msgid "Show tool tip"
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
msgid "&Show tooltip for files in the file panel"
msgstr "Mostra Tooltip"
#: tfrmoptionstooltips.gbcustomfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
msgid "Custom fields by file type"
msgstr "Campi personalizzati per tipo di file"
#: tfrmoptionstooltips.lblfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Suggerimento categoria:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "&Filtro categoria:"
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "&Nome categoria:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Colore cursore:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Visualizzatore modo book"
#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
msgid "Example"
msgstr "Esempio"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "Colore di &sfondo del visualizzatore book"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "Colore del &font del visualizzatore book"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "&Numero di colonne del visualizzatore book"
#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "&Configura"
#: tfrmpackdlg.caption
msgctxt "TFRMPACKDLG.CAPTION"
msgid "Pack files"
msgstr "Comprimi file"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "&Crea archivi separati, uno per ogni file/cartella"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Crea archivio &autoestraente"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "C&ripta"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Sp&osta nell'archivio"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Multiple disk archive"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "In&serisci prima in archivio TAR"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "&Comprimi anche i nomi di percorso (solo ricorsivamente)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Comprimi i file nell'archivio:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Compressore"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Chiudi"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "&Decomprimi tutto ed esegui"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "&Estrai ed esegui"
#: tfrmpackinfodlg.caption
msgctxt "TFRMPACKINFODLG.CAPTION"
msgid "Properties of packed file"
msgstr "Proprietà dell'archivio"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Attributi:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Tasso di compressione:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Data:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Metodo:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Dimensione originale:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "File:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Dimensione dell'archivio:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Compressore:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Data/ora:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Chiudi il pannello filtro"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Inserisci il testo da cercare o filtra per"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Distingui maiusc./minusc."
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "D"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Cartelle"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "File"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Corrispondenza all'inizio"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Corrispondenza alla fine"
#: tfrmquicksearch.tglfilter.caption
msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION"
msgid "Filter"
msgstr "Filtro"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Passare alla ricerca o al filtro"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr ""
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr ""
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Plugin"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Valore"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr ""
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr ""
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Annulla"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "&Chiudi"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "&Aiuto"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "&Seleziona caratteri da inserire:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsetfileproperties.caption
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
msgid "Change attributes"
msgstr "Cambia attributi"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Adesivo"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "Archivio"
#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Creato:"
#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "Nascosto"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Accesso:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Modificato:"
#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "Sola lettura"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Inclusione sottocartelle"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "Sistema"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Proprietà timestamp"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attributi"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attributi"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bit:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppo"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(un campo grigio significa valore immutato)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Altro"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Proprietario"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Testo:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Esegui"
#: tfrmsetfileproperties.lblmodeinfo.caption
#, fuzzy
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(un campo grigio significa valore immutato)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Ottale:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Leggi"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Scrivi"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmsplitter.caption
msgctxt "TFRMSPLITTER.CAPTION"
msgid "Splitter"
msgstr "Divisore"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr ""
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Nome file"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Dimensione e numero parti"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "Cartella &destinazione"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "File &sorgente"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "&Numero parti"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr ""
#: tfrmsplitter.rbtngigab.caption
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr "&Gigabyte"
#: tfrmsplitter.rbtnkilob.caption
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr "&Kilobyte"
#: tfrmsplitter.rbtnmegab.caption
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr "&Megabyte"
#: tfrmstartingsplash.caption
msgctxt "tfrmstartingsplash.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "tfrmstartingsplash.lblbuild.caption"
msgid "Build"
msgstr "Build"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr ""
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr ""
#: tfrmstartingsplash.lblrevision.caption
msgctxt "tfrmstartingsplash.lblrevision.caption"
msgid "Revision"
msgstr "Revisione"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "tfrmstartingsplash.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "tfrmstartingsplash.lblversion.caption"
msgid "Version"
msgstr "Versione"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Crea link simbolico"
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Destinazione alla quale punterà il collegamento"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Nome co&llegamento"
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
msgid "Close"
msgstr "Chiudi"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
msgid "Compare"
msgstr "Confronta"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr ""
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr ""
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr ""
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr ""
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr ""
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr ""
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Nome"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Dimensione"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Data"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Data"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Dimensione"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
#, fuzzy
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Nome"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr ""
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Confronta"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr ""
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr ""
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr ""
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr ""
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr ""
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr ""
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr ""
#: tfrmsyncdirsperformdlg.caption
msgctxt "tfrmsyncdirsperformdlg.caption"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr ""
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr ""
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr ""
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "A&ggiungi nuovo"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Annulla"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "C&ambia"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Prede&finito"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "&Elimina"
#: tfrmtweakplugin.caption
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
msgid "Tweak plugin"
msgstr "&Tweak plugin"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Indivi&dua il tipo di archivio dal contenuto"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Possibilità di e&liminare i file"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Supporta la c&odifica"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Mostr&a come file normali (nascondi icona archivi)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Supporta la gestione di arc&hivi in memoria"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Puoi &modificare l'archivio esistente"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "L'&archivio può contenere file multipli"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Puoi creare nuovi archi&vi"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "S&upporta finestre di dialogo con opzioni"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Consenti ricer&ca testi negli archivi"
#: tfrmtweakplugin.lbldescription.caption
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "&Descrizione:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "Ril&eva stringa:"
#: tfrmtweakplugin.lblextension.caption
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "&Estensione:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Flag:"
#: tfrmtweakplugin.lblname.caption
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "&Nome:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "&Plugin:"
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "&Plugin:"
#: tfrmviewer.actabout.caption
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
msgid "About Viewer..."
msgstr "Info visualizzatore..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Mostra il messagio Info"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
msgid "Copy File"
msgstr "Copia File"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Copia File"
#: tfrmviewer.actcopytoclipboard.caption
#, fuzzy
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Copia negli appunti"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr ""
#: tfrmviewer.actdeletefile.caption
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
msgid "Delete File"
msgstr "Elimina File"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Elimina File"
#: tfrmviewer.actexitviewer.caption
#, fuzzy
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "&Esci"
#: tfrmviewer.actfind.caption
#, fuzzy
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Cerca"
#: tfrmviewer.actfindnext.caption
#, fuzzy
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Trova prossimo"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr ""
#: tfrmviewer.actfullscreen.caption
#, fuzzy
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Schermo intero"
#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr ""
#: tfrmviewer.actloadnextfile.caption
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
msgid "&Next"
msgstr "&Successivo"
#: tfrmviewer.actloadnextfile.hint
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT"
msgid "Load Next File"
msgstr "Carica File Successivo"
#: tfrmviewer.actloadprevfile.caption
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
msgid "&Previous"
msgstr "&Precedente"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Carica file Precedente"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr ""
#: tfrmviewer.actmirrorhorz.hint
#, fuzzy
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr "Specchia"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr ""
#: tfrmviewer.actmovefile.caption
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
msgid "Move File"
msgstr "Sposta File"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Sposta File"
#: tfrmviewer.actpreview.caption
#, fuzzy
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Anteprima"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Ricarica"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Ricarica file corrente"
#: tfrmviewer.actrotate180.caption
#, fuzzy
#| msgid "Rotate 180"
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
msgid "+ 180"
msgstr "Ruota 180°"
#: tfrmviewer.actrotate180.hint
#, fuzzy
#| msgid "Rotate 180"
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
msgid "Rotate 180 degrees"
msgstr "Ruota 180°"
#: tfrmviewer.actrotate270.caption
#, fuzzy
#| msgid "Rotate 270"
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
msgid "- 90"
msgstr "Ruota 270°"
#: tfrmviewer.actrotate270.hint
#, fuzzy
#| msgid "Rotate 270"
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
msgid "Rotate -90 degrees"
msgstr "Ruota 270°"
#: tfrmviewer.actrotate90.caption
#, fuzzy
#| msgid "Rotate 90"
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
msgid "+ 90"
msgstr "Ruota 90°"
#: tfrmviewer.actrotate90.hint
#, fuzzy
#| msgid "Rotate 90"
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
msgid "Rotate +90 degrees"
msgstr "Ruota 90°"
#: tfrmviewer.actsave.caption
#, fuzzy
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Salva"
#: tfrmviewer.actsaveas.caption
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
msgid "Save As..."
msgstr "Salva come..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Salva file come..."
#: tfrmviewer.actscreenshot.caption
#, fuzzy
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Cattura schermata"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr ""
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr ""
#: tfrmviewer.actselectall.caption
#, fuzzy
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Seleziona tutto"
#: tfrmviewer.actshowasbin.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "Mostra come file &binario"
#: tfrmviewer.actshowasbook.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "Mostra come \"&Book\""
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr ""
#: tfrmviewer.actshowashex.caption
#, fuzzy
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "Mostra in &esadecimale"
#: tfrmviewer.actshowastext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "Mostra come &testo"
#: tfrmviewer.actshowaswraptext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "Mostra con &ritorno a capo"
#: tfrmviewer.actshowgraphics.caption
#, fuzzy
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Grafica"
#: tfrmviewer.actshowplugins.caption
#, fuzzy
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Plugin"
#: tfrmviewer.actstretchimage.caption
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
msgid "Stretch"
msgstr "Stira"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Stira immagine"
#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr ""
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr ""
#: tfrmviewer.actzoomin.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Zoom +"
#: tfrmviewer.actzoomout.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Zoom -"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Copia"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Copia"
#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Ritaglia"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Elimina"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Elimina"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Schermo intero"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Evidenzia"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Sposta"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Sposta"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Colora"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Occhi Rossi"
#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Ridimensiona"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Annulla"
#: tfrmviewer.caption
msgctxt "TFRMVIEWER.CAPTION"
msgid "Viewer"
msgstr "Visualizzatore"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Diapositive"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Penna"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Evidenzia"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Colora"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Diapositive"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Mostra"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "Info"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Modifica"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codifica"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&File"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Immagine"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Stampa..."
#: tfrmviewer.mirotate.caption
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
msgid "Rotate"
msgstr "Ruota"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Cattura schermata"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Visualizza"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Seleziona Tutto"
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Quando i file esistono"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Quando il file esiste"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
#, fuzzy
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Copia d&ata/ora"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Lavora in secondo piano (connesione separata)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Quando il file esiste"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Altezza"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Larghezza"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Annulla filtro rapido"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Cannulla operazione corrente"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr ""
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr ""
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr ""
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr ""
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr ""
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr ""
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr ""
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Inserisci il CheckSum e seleziona l'algoritmo"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Verifica CheckSum"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr ""
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Gli appunti non contengono nessuna barra strumenti valida"
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr ""
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr ""
#: ulng.rscolattr
msgid "Attr"
msgstr "Attr"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Data"
#: ulng.rscolext
msgid "Ext"
msgstr "Estensione"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Nome"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Dimensione"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Allinea"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Etichetta"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Elimina"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Contenuto campi"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Sposta"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Larghezza"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Personalizza colonna"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr ""
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr ""
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Copia (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr ""
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr ""
#: ulng.rsdiffadds
msgid " Adds: "
msgstr ""
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr ""
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr ""
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr ""
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr ""
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "Abband&ona"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "&Tutto"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "A&ggiungi"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr ""
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Annulla"
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Continua"
#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "Copia &in"
#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "Copia in &tutto"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "E&sci dal programma"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr ""
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "I&gnora tutti"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&No"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "N&essuno"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&OK"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "Alt&ro"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Sovrascrivi"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Sovrascrivi &tutti"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Sovrascrivi tutti i più &grandi"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Sovrascrivi tutti i &vecchi"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Sovrascrivi tutti i più &piccoli"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "&Rinomina"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Riprendi"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Ri&tenta"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "Sa&lta"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Salta t&utti"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Si"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Copia file"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Sposta file"
#: ulng.rsdlgoppause
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "Pau&sa"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&Avvio"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Coda"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Velocità %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Velocità %s/s, tempo rimanente %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<nessuna etichetta>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<nessun media>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Editor interno di Double Commander."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr ""
#: ulng.rseditgotolinetitle
msgctxt "ulng.rseditgotolinetitle"
msgid "Goto Line"
msgstr ""
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "nuovo.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Nome file:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Apri file"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Indietro"
#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Ricerca"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "&Avanti"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Sostituisci"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr ""
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr ""
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr ""
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr ""
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr ""
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr ""
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr ""
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
#, fuzzy
#| msgid "Ask;Overwrite;Copy into;Skip"
msgid "Ask;Merge;Skip"
msgstr "Chiedi;Sovrascrivi;Copia su;Salta"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Chiedi;Sovrascrivi vecchi;Copia su;Salta"
#: ulng.rsfileopsetpropertyerroroptions
msgctxt "ulng.rsfileopsetpropertyerroroptions"
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Chiedi;Non impostare più;Ignora errori"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "FILTRO"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Definisci modello"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s livello(i)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "tutto (profondità illimitata)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "solo cartella corrente"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "La cartella %s non esiste!"
#: ulng.rsfindfound
msgctxt "ulng.rsfindfound"
msgid "Found: %d"
msgstr "Trovato: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Salva modello di ricerca"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Nome modello:"
#: ulng.rsfindscanned
msgctxt "ulng.rsfindscanned"
msgid "Scanned: %d"
msgstr "Analizzato: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Analisi in corso"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Trova file"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr ""
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Inizio a"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "%s liberi su %s byte"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s byte liberi"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Data/ora accesso"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Attributi"
#: ulng.rsfunccomment
msgctxt "ulng.rsfunccomment"
msgid "Comment"
msgstr "Commento"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Dimensione compressa"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Data/ora creazione"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Estensione"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Gruppo"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr ""
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Collegamento a"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Data/ora modifica"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Nome"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Nome senza estensione"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Proprietario"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Percorso"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Dimensione"
#: ulng.rsfunctype
msgid "Type"
msgstr "Tipo"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Errore nella creazione dell'hardlink."
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr ""
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Dialogo copia/sposta"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Differenze"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr ""
#: ulng.rshotkeycategoryeditor
#, fuzzy
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Modifica"
#: ulng.rshotkeycategoryfindfiles
#, fuzzy
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Trova file"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Principale"
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Visualizzatore"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr ""
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Filtro di deselezione"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Filtro di selezione"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Filtro di input:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr ""
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr ""
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Configura colonne personalizzate"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr ""
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Azioni"
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr ""
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Modifica"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Espelli"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr ""
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr ""
#: ulng.rsmnumount
msgid "Mount"
msgstr "Monta"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Nuovo"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Nessuna unità disponibile"
#: ulng.rsmnuopen
#, fuzzy
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Apri"
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Apri con..."
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Altro"
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr ""
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Ordina per"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Smonta"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Vista"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Account:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Parametri addizionali per compressore da linea di comando:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Non è possibile copiare/spostare il file \"%s\" su sé stesso!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Impossibile eliminare cartella %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "ChDir a [%s] fallito!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Rimuovere tutte le schede inattive?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Questa scheda (%s) è bloccata! Chiudere ugualmente?"
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Sei sicuro di voler uscire?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr ""
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr ""
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Copia %d file/cartelle selezionati?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Copia \"%s\"?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr ""
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr ""
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr ""
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Eliminanare il file parzialmente copiato ?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Elimina %d file/cartelle selezionati?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Spostare %d file/cartelle selezionati nel cestino?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Eliminare \"%s\"?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Spostare \"%s\" nel cestino?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Impossibile spostare \"%s\" nel cestino! Eliminare definitivamente?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Disco non disponibile"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr ""
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Inserire estensione file:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Inserire nome:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr ""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Errore CRC nell'archivio"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Dati corrotti"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Impossibile connettersi al server: \"%s\""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Impossibile copiare il file %s verso %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "La cartella col nome \"%s\" è già presente."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "La data %s non è supportata"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "La cartella %s esiste già!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Funzione annullata dall'utente"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Errore nella chiusura del file"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Impossibile creare file"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Non ci sono più file nell'archivio"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Impossibile aprire il file esistente"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Errore nella lettura file"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Errore di scrittura su file"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Impossibile creare cartella %s!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Collegamento non valido"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "File non trovato"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Memoria insufficiente"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Funzione non supportata!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Errore nel comando del menu contestuale"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Errore durante il caricamento della configurazione"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Errore sintattico nell'espressione regolare!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Impossibile rinominare il file %s in %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Non posso salvare l'associazione!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Impossibile salvare il file"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Impossibile impostare gli attributi per \"%s\""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Impossibile impostare data/ora per \"%s\""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Impossibile impostare proprietario/gruppo per \"%s\""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr ""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Buffer troppo piccolo"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Troppi file da comprimere"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Formato dell'archivio sconosciuto"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr ""
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr ""
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr ""
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr ""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Il file %s è stato modificato, salvarlo?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s byte, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Sovrascrivi:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Il file %s esiste, sovrascriverlo?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Con il file:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "File \"%s\" non trovato."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Operazioni sul file in corso"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Alcune operazioni sui file non sono terminate. Chiudendo Double Commander alcuni dati potrebbero andare perduti."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
#, fuzzy
#| msgid "File %s is marked as read-only. Delete it?"
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Il file %s è in sola lettura. Eliminarlo ugualmente?"
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "La dimensione del file \"%s\" è eccessiva per il file system di destinazione!"
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "La cartella %s esiste, sovrascriverla?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Segui collegamento simbolico \"%s\"?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr ""
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr ""
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr ""
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr ""
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr ""
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr ""
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr ""
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr ""
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr ""
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr ""
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr ""
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr ""
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr ""
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr ""
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr ""
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr ""
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr ""
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "Path"
msgstr "Percorso"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr ""
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr ""
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr ""
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr ""
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr ""
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr ""
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr ""
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr ""
#: ulng.rsmsghotdirsimplecommand
#, fuzzy
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Comando:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr ""
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu name:"
msgstr ""
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "Name:"
msgstr "Nome:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr ""
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr ""
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr ""
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr ""
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr ""
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr ""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Errore nella linea di comando"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Nome file non valido"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Formato non valido del file di configurazione"
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Percorso non valido"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Il percorso %s contiene caratteri non consentiti."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Non c'è un plugin valido!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Questo plugin è stato fatto per Double Commander: %s.%s. Non può funzionare con Double Commander per %s!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Quoting non valido"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Selezione non valida."
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Carica lista..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr ""
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr ""
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Copia file %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Elimina file %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Errore:"
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr ""
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Estrai file %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Info:"
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Crea collegamento %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Crea cartella %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Sposta file %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Comprimi file %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Rimuovere cartella %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Fatto:"
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Crea link simbolico %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Test integrità file %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr ""
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr ""
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Password principale"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Prego inserire password principale:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Nuovo file"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Il prossimo volume verrà decompresso"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Nessun file"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Nessun file selezionato."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Non c'è abbastanza spazio sull'unità di destinazione. Continuare?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Non c'è abbastanza spazio sull'unità di destinazione. Riprovare?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Non è possibile eliminare il file %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Non implementato."
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Password:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Le password sono differenti!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Si prega di inserire la password:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Password (Firewall) :"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Prego reinserire la password per verifica:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Elimina %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Preset \"%s\" già presente. Sovrascrivere?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr ""
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr ""
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr ""
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr ""
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Rinominare/spostare %d file/cartelle selezionati?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Rinomina/sposta selezione \"%s\"?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Prego, riavviare Double Commander per applicare le modifiche"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr ""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Selezione: %s di %s, file: %d di %d, cartelle: %d di %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr ""
#: ulng.rsmsgselectonlychecksumfiles
#, fuzzy
#| msgid "Please select only check sum files!"
msgid "Please select only checksum files!"
msgstr "Prego, selezionare solo i file per il Checksum!"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Prego selezionare la posizione del prossimo volume"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Imposta etichetta volume"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr ""
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr ""
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr ""
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr ""
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr ""
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr ""
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr ""
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr ""
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Rinomina scheda"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Nuovo nome di scheda:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Percorso destinazione:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr ""
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr ""
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr ""
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Troppi file selezionati."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr ""
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr ""
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr ""
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Nome utente:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Nome utente (Firewall):"
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Etichetta volume:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Prego inserire la dimensione del volume:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Avviare la cancellazione sicura per i file/cartelle %d selezionati?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Eseguire la cancellazione sicura per la selezione \"%s\"?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Nessuna modifica;MAIUSCOLE;minuscole;Primo carattere maiusc.;Primo caratt. di ogni parola maiusc.;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Annullato"
#: ulng.rsopercalculatingchecksum
#, fuzzy
#| msgid "Calculating check sum"
msgid "Calculating checksum"
msgstr "Calcolo del Checksum"
#: ulng.rsopercalculatingchecksumin
#, fuzzy
#| msgid "Calculating check sum in \"%s\""
msgid "Calculating checksum in \"%s\""
msgstr "Calcolo del Checksum in \"%s\""
#: ulng.rsopercalculatingchecksumof
#, fuzzy
#| msgid "Calculating check sum of \"%s\""
msgid "Calculating checksum of \"%s\""
msgstr "Calcolo del Checksum di \"%s\""
#: ulng.rsopercalculatingstatictics
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "Calcolo in corso..."
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Calcolo di \"%s\" in corso "
#: ulng.rsopercombining
msgid "Joining"
msgstr "Unione"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Unisci file in \"%s\" su \"%s\""
#: ulng.rsopercopying
msgid "Copying"
msgstr "Copia"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Copia da \"%s\" to \"%s\""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Copia da \"%s\" to \"%s\""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Creazione cartella"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Creazione cartella \"%s\""
#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "Eliminazione"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Eliminazione in \"%s\""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Eliminazione di \"%s\""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Esecuzione"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Esecuzione di \"%s\""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Estrazione"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Estrazione da \"%s\" a \"%s\""
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Terminato"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Elencazione"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Elencazione di \"%s\" in corso"
#: ulng.rsopermoving
msgid "Moving"
msgstr "Spostamento"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Spostamento da \"%s\" a \"%s\""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Spostamento di \"%s\" a \"%s\""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Non avviato"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Compressione"
#: ulng.rsoperpackingfromto
#, fuzzy
#| msgid "Compressione da \"%s\" a \"%s\""
msgid "Packing from \"%s\" to \"%s\""
msgstr "Compressione da \"%s\" a \"%s\""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Compressione da \"%s\" a \"%s\""
#: ulng.rsoperpaused
msgid "Paused"
msgstr "In attesa"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Metti in attesa"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Caricamento in corso"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Imposta proprietà"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Imposta proprietà in \"%s\""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Imposta proprietà di \"%s\""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Divisione"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Divisione da \"%s\" a \"%s\""
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Avviamento"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Fermato"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Annulla"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Test"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Test in \"%s\""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Test in \"%s\""
#: ulng.rsoperverifyingchecksum
#, fuzzy
#| msgid "Verifying check sum"
msgid "Verifying checksum"
msgstr "Verifica del Checksum"
#: ulng.rsoperverifyingchecksumin
#, fuzzy
#| msgid "Verifying check sum in \"%s\""
msgid "Verifying checksum in \"%s\""
msgstr "Verifica del Checksum in \"%s\""
#: ulng.rsoperverifyingchecksumof
#, fuzzy
#| msgid "Verifying check sum of \"%s\""
msgid "Verifying checksum of \"%s\""
msgstr "Verifica del Checksum di \"%s\""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Attendere per accesso al file sorgente"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Attendi per risposta utente"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Cancellazione sicura"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Cancellazione sicura in \"%s\""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Cancellazione sicura \"%s\""
#: ulng.rsoperworking
msgid "Working"
msgstr "Funzionamento"
#: ulng.rsoptaddfrommainpanel
msgid "Add at beginning;Add at the end;Smart add"
msgstr ""
#: ulng.rsoptarchivedelete
msgctxt "ulng.rsoptarchivedelete"
msgid "Delete:"
msgstr "Elimina:"
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Estrai senza percorso:"
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr "Modalità di Format parsing:"
#: ulng.rsoptarchiveid
msgctxt "ulng.rsoptarchiveid"
msgid "ID:"
msgstr "ID:"
#: ulng.rsoptarchiveidpos
msgctxt "ulng.rsoptarchiveidpos"
msgid "ID Position:"
msgstr "Posizione ID:"
#: ulng.rsoptarchiveidseekrange
msgctxt "ulng.rsoptarchiveidseekrange"
msgid "ID Seek Range:"
msgstr "ID Seek Range:"
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr "Parametro"
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr "Password query string"
#: ulng.rsoptarchiveselfextract
msgctxt "ulng.rsoptarchiveselfextract"
msgid "Create self extracting archive:"
msgstr "Crea archivio autoestraente:"
#: ulng.rsoptarchivetest
msgctxt "ulng.rsoptarchivetest"
msgid "Test:"
msgstr "Test:"
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Tipo archivio:"
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Valore"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Associa plugin \"%s\" con:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Primo;Ultimo;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr ""
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Disabilita"
#: ulng.rsoptenable
msgctxt "ulng.rsoptenable"
msgid "Enable"
msgstr "Abilita"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Inserire estensione"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr ""
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "finestra separata;minimizza finestra separata;pannello operazioni"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "Dinamico (decimale);B;K;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "La scorciatoia %s per cm_Delete verrà registrata, può essere usata per invertire questo settaggio."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Aggiungi scorciatoia per %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Aggiungi scorciatoia"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Impossibile impostare scorciatoia"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Cambia scorciatoia"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Comando"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides"
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "La scorciatoia %s per cm_Delete ha un parametro che scavalca questa impostazione. Vuoi cambiare questo parametro per usare l'impostazione globale?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists"
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "La scorciatoia %s per cm_Delete necessita di avere un parametro modificato che corrisponda alla scorciatoia %s. Vuoi modificarlo?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Descrizione"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Modifica la scorciatoia per %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Fissa parametro"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Scorciatoia"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Scorciatoie"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<nessuno>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parametri"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Setta scorciatoie per cancellare file"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Perché questo settaggio funzioni con la scorciatoia %s, la scorciatoia %s deve essere assegnata a cm_Delete ma è già assegnata a %s. Vuoi modificare ciò?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "La scorciatoia %s per cm_Delete è una scorciatoia sequenziale per cui una scorciatoia con lo Shift premuto non può essere assegnata. Questa impostazione potrebbe non funzionare."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Scorciatoia in uso"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "La scorciatoia %s è già usata."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Modificare esso in %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "usato per %s in %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "Usato per questo comando ma con differenti parametri"
#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Archiviatori"
#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Auto-aggiornamento"
#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Comportamenti"
#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr "Breve"
#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Colori"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Colonne"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Configurazione"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Colonne personalizzate"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Cartelle Preferite"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Drag && drop"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Pulsante lista unità"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr ""
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr ""
#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Associazioni file"
#: ulng.rsoptionseditorfilenewfiletypes
#, fuzzy
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Nuovo"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Operazioni sui file"
#: ulng.rsoptionseditorfilepanels
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Pannello file"
#: ulng.rsoptionseditorfilesearch
#, fuzzy
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Cerca file"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Visualizzazioni file"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Tipi di file"
#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Schede"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr ""
#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Font"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Evidenziazioni"
#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Scorciatoie"
#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Icone"
#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Ignora lista"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Tasti"
#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Lingua"
#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr "Disposizione"
#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Registro operazioni"
#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Altro"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Mouse"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Plugin"
#: ulng.rsoptionseditorquicksearch
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Ricerca Rapida/Filtro"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminale"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Barra strumenti"
#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Strumenti"
#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Tooltip"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr ""
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr ""
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Nessuno;Linea di comando;Ricerca veloce;Filtro veloce"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Tasto sinistro;Tasto destro;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "In alto alla lista file;dopo le cartelle (se le cartelle sono ordinate prima dei file);in posizione ordinata;In fondo alla lista file"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Il plugin %s è già assegnato alle seguenti estensioni:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Attiva"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Nome file"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Nome"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Registrato per"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Distingui maiusc./minusc.;&Nessuna distinzione maiusc./minusc."
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&File;Cartelle;File &e cartelle"
#: ulng.rsoptsearchopt
#, fuzzy
#| msgid "&Hide filter panel when not focused"
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "&Nascondi pannello filtro quando selezionato"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "nessuna distinzione maiusc./minusc.;in accordo alle impostazioni locali (aAbBcC);prima maiuscole poi minuscole (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "ordina per nome e mostra prima;ordina come i file e mostra prima;ordina come file"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Alfabetico, considera accenti;Ordinamento naturale: alfabetico e numeri"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Inizio;Fine;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "S&eparatore;comando inte&rno;comando e&sterno;Men&u"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr ""
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "non cambiare posizione;usa le stesse impostazioni per i nuovi file; alla posizione ordinata"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "File: %d, cartelle %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Impossibile modificare i permessi per \"%s\""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Impossibile modificare il proprietario per \"%s\""
#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "File"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Cartella"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Nome pipe"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Socket"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Dispositivo speciale a blocchi"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Dispositivo speciale a caratteri"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Collegamento simbolico"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Tipo sconosciuto"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Risultati di ricerca"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "Ricerca"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<modello senza nome>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Seleziona cartella"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "&Mostra aiuto per %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Tutto"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr ""
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr ""
#: ulng.rssimplewordcommand
#, fuzzy
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Comando"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr ""
#: ulng.rssimplewordfiles
msgid "files"
msgstr "File"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr ""
#: ulng.rssimplewordresult
msgid "Result"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr ""
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Byte"
#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr "Gigabyte"
#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr "Kilobyte"
#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr "Megabyte"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabyte"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "File: %d, Cartella: %d, Dimensione: %s (%s byte)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Impossibile creare la cartella destinazione!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Errore nel formato della dimensione!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Impossibile dividere il file!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Il numero di parti è superiore a 100! Continuare?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Seleziona cartella:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr ""
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr ""
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Errore nella creazione del collegamento simbolico."
#: ulng.rssyndefaulttext
msgctxt "ulng.rssyndefaulttext"
msgid "Default text"
msgstr "Testo predefinito"
#: ulng.rssynlangplaintext
msgctxt "ulng.rssynlangplaintext"
msgid "Plain text"
msgstr "Testo non formattato"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr ""
#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Giorno(i)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Ora(e)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minuto(i)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Mese(i)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Secondo(i)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Settimana(e)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Anno(i)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr ""
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr ""
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Differenze"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Modifica"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Errore nell'apertura"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Errore apertura editor"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Errore apertura terminale"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Errore apertura visualizzatore"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminale"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Visualizza"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Si prega di riportare questo errore sul bug tracker con una descrizione di cosa è stato fatto e allegando il seguente file:%sPremere %s per continuare ad usare il programma oppure %s per chiuderlo."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr ""
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr ""
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr ""
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr ""
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr ""
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr ""
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr ""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr ""
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr ""
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr ""
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr ""
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr ""
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr ""
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr ""
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr ""
#: ulng.rsvarpath
msgid "Path, with ending delimiter"
msgstr ""
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr ""
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr ""
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr ""
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr ""
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr ""
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr ""
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr ""
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr ""
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr ""
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr ""
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr ""
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr ""
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr ""
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr ""
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr ""
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr ""
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr ""
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Rete"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Visualizzatore interno di Double Commander."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr ""
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Codifica"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr ""
#: ulng.rsviewnewsize
#, fuzzy
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Nuova Dimensione"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s non trovato!"
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr ""
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr ""
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr ""
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr ""