doublecmd/language/doublecmd.es.po
2018-07-22 15:07:42 +00:00

12311 lines
332 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.8.1 beta\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2018-02-04 12:00+0100\n"
"Last-Translator: Pepe López <kuidao@yahoo.es>\n"
"Language-Team: Español; Castellano <>\n"
"Language: es\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Español\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Comparando... %d%% (ESC para cancelar)"
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Derecha: Borrar %d archivo(s)"
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Archivos encontrados: %d (Idénticos: %d, Diferentes: %d, Únicos izquierda: %d, Únicos derecha: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Izquierda a Derecha: Copiar %d archivos, tamaño total: %d bytes"
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Derecha a Izquierda: Copiar %d archivos, tamaño total: %d bytes"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Seleccionar plantilla..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Co&mprobar espacio libre"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Copiar a&tributos"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Copiar p&ropietario"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Copiar per&misos"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Copiar fech&a/hora"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "Corre&gir enlaces"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgid "Drop readonly fla&g"
msgstr "&Quitar marca de solo lectura"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "E&xcluir carpetas vacías"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Seguir en&laces"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "&Reservar espacio"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr "Ver&ificar la copia"
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Qué hacer cuando no se pueden configurar hora, atributos, etc."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Usar plantilla de archivo"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "Si la carp&eta ya existe"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgid "When &file exists"
msgstr "Si el archi&vo ya existe"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "Si &no puede asignar propiedades"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<sin plantilla>"
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr "&Cerrar"
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "Copiar al portapapeles"
#: tfrmabout.caption
msgctxt "tfrmabout.caption"
msgid "About"
msgstr "Acerca de..."
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Hecho"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Página web:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "tfrmabout.lblrevision.caption"
msgid "Revision"
msgstr "Revisión"
#: tfrmabout.lbltitle.caption
msgctxt "tfrmabout.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Versión"
#: tfrmattributesedit.btncancel.caption
msgctxt "tfrmattributesedit.btncancel.caption"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmattributesedit.btnok.caption
msgctxt "tfrmattributesedit.btnok.caption"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Restablecer"
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Seleccionar atributos"
#: tfrmattributesedit.cbarchive.caption
msgid "&Archive"
msgstr "&Fichero"
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Co&mprimido"
#: tfrmattributesedit.cbdirectory.caption
msgid "&Directory"
msgstr "Ca&rpeta"
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "Ci&frado"
#: tfrmattributesedit.cbhidden.caption
msgid "&Hidden"
msgstr "&Oculto"
#: tfrmattributesedit.cbreadonly.caption
msgid "Read o&nly"
msgstr "Solo &lectura"
#: tfrmattributesedit.cbsgid.caption
msgctxt "tfrmattributesedit.cbsgid.caption"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "Disper&so"
#: tfrmattributesedit.cbsticky.caption
msgctxt "tfrmattributesedit.cbsticky.caption"
msgid "Sticky"
msgstr "Sticky"
#: tfrmattributesedit.cbsuid.caption
msgctxt "tfrmattributesedit.cbsuid.caption"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "Enlace &simbólico"
#: tfrmattributesedit.cbsystem.caption
msgid "S&ystem"
msgstr "Sis&tema"
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Temporal"
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "Atributos NTFS"
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Atributos generales"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "tfrmattributesedit.lblattrbitsstr.caption"
msgid "Bits:"
msgstr "Bits"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "tfrmattributesedit.lblattrgroupstr.caption"
msgid "Group"
msgstr "Grupo"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "tfrmattributesedit.lblattrotherstr.caption"
msgid "Other"
msgstr "Otros"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "tfrmattributesedit.lblattrownerstr.caption"
msgid "Owner"
msgstr "Propietario"
#: tfrmattributesedit.lblexec.caption
msgctxt "tfrmattributesedit.lblexec.caption"
msgid "Execute"
msgstr " Ejecución"
#: tfrmattributesedit.lblread.caption
msgctxt "tfrmattributesedit.lblread.caption"
msgid "Read"
msgstr "Lectura"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Como te&xto:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "tfrmattributesedit.lblwrite.caption"
msgid "Write"
msgstr "Escritura"
#: tfrmbenchmark.caption
msgid "Benchmark"
msgstr ""
#: tfrmbenchmark.lblbenchmarksize.caption
msgid "Benchmark data size: %d MB"
msgstr ""
#: tfrmbenchmark.stgresult.columns[0].title.caption
msgid "Hash"
msgstr ""
#: tfrmbenchmark.stgresult.columns[1].title.caption
msgid "Time (ms)"
msgstr ""
#: tfrmbenchmark.stgresult.columns[2].title.caption
msgid "Speed (MB/s)"
msgstr ""
#: tfrmchecksumcalc.caption
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Calcular suma de verificación..."
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Abrir la suma de verificación tras completar el trabajo"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "C&rear suma de verificación por cada archivo"
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "Guardar archivo(s) de suma de verificación en:"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Cerrar"
#: tfrmchecksumverify.caption
msgctxt "tfrmchecksumverify.caption"
msgid "Verify checksum..."
msgstr "Comprobar suma de verificación..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "tfrmconnectionmanager.btnadd.caption"
msgid "A&dd"
msgstr "Aña&dir"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "C&onectar"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "tfrmconnectionmanager.btndelete.caption"
msgid "&Delete"
msgstr "&Borrar"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "tfrmconnectionmanager.btnedit.caption"
msgid "&Edit"
msgstr "&Editar"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Gestor de conexión"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Conectar a:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "Aña&dir a cola"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "&Opciones"
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "Guardar como predeterminado"
#: tfrmcopydlg.caption
msgctxt "tfrmcopydlg.caption"
msgid "Copy file(s)"
msgstr "Copiar archivo(s)"
#: tfrmcopydlg.mnunewqueue.caption
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Cola nueva"
#: tfrmcopydlg.mnuqueue1.caption
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Cola 1"
#: tfrmcopydlg.mnuqueue2.caption
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Cola 2"
#: tfrmcopydlg.mnuqueue3.caption
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Cola 3"
#: tfrmcopydlg.mnuqueue4.caption
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Cola 4"
#: tfrmcopydlg.mnuqueue5.caption
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Cola 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Guardar descripción"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Comentario de archivo/carpeta"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "E&ditar comentario para:"
#: tfrmdescredit.lblencoding.caption
msgid "&Encoding:"
msgstr "Codi&ficación:"
#: tfrmdescredit.lblfilename.caption
msgctxt "tfrmdescredit.lblfilename.caption"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "Acerca de..."
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Autocomparación"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Modo Binario"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "tfrmdiffer.actcancelcompare.caption"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "tfrmdiffer.actcopylefttoright.caption"
msgid "Copy Block Right"
msgstr "Copiar al bloque derecho"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Copiar al bloque derecho"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "tfrmdiffer.actcopyrighttoleft.caption"
msgid "Copy Block Left"
msgstr "Copiar al bloque izquierdo"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Copiar al bloque izquierdo"
#: tfrmdiffer.acteditcopy.caption
msgctxt "tfrmdiffer.acteditcopy.caption"
msgid "Copy"
msgstr "Copiar"
#: tfrmdiffer.acteditcut.caption
msgctxt "tfrmdiffer.acteditcut.caption"
msgid "Cut"
msgstr "Cortar"
#: tfrmdiffer.acteditdelete.caption
msgctxt "tfrmdiffer.acteditdelete.caption"
msgid "Delete"
msgstr "Borrar"
#: tfrmdiffer.acteditpaste.caption
msgctxt "tfrmdiffer.acteditpaste.caption"
msgid "Paste"
msgstr "Pegar"
#: tfrmdiffer.acteditredo.caption
msgctxt "tfrmdiffer.acteditredo.caption"
msgid "Redo"
msgstr "Rehacer"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Seleccion&ar todo"
#: tfrmdiffer.acteditundo.caption
msgctxt "tfrmdiffer.acteditundo.caption"
msgid "Undo"
msgstr "Deshacer"
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "&Salir"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Primera diferencia"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Primera diferencia"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Ignorar capitalización"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Ignorar espacios en blanco"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Mantener desplazamiento"
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Última diferencia"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Última diferencia"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Diferencias de línea"
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Diferencia siguiente"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Diferencia siguiente"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Abrir izquierda..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Abrir derecha..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Dibujar fondo"
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Diferencia anterior"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Diferencia anterior"
#: tfrmdiffer.actreload.caption
msgid "&Reload"
msgstr "&Recargar"
#: tfrmdiffer.actreload.hint
msgctxt "tfrmdiffer.actreload.hint"
msgid "Reload"
msgstr "Recargar"
#: tfrmdiffer.actsave.caption
msgctxt "tfrmdiffer.actsave.caption"
msgid "Save"
msgstr "Guardar"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Guardar"
#: tfrmdiffer.actsaveas.caption
msgctxt "tfrmdiffer.actsaveas.caption"
msgid "Save as..."
msgstr "Guardar como..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Guardar como..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "tfrmdiffer.actsaveleft.caption"
msgid "Save Left"
msgstr "Guardar izquierda"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Guardar izquierda"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "tfrmdiffer.actsaveleftas.caption"
msgid "Save Left As..."
msgstr "Guardar izquierda como..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Guardar izquierda como..."
#: tfrmdiffer.actsaveright.caption
msgctxt "tfrmdiffer.actsaveright.caption"
msgid "Save Right"
msgstr "Guardar derecha"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Guardar derecha"
#: tfrmdiffer.actsaverightas.caption
msgctxt "tfrmdiffer.actsaverightas.caption"
msgid "Save Right As..."
msgstr "Guardar derecha como..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Guardar derecha como..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "tfrmdiffer.actstartcompare.caption"
msgid "Compare"
msgstr "Comparar"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Comparar"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "tfrmdiffer.btnleftencoding.hint"
msgid "Encoding"
msgstr "Codificación"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Codificación"
#: tfrmdiffer.caption
msgid "Compare files"
msgstr "Comparar archivos"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "tfrmdiffer.midivider7.caption"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Izquierda"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "De&recha"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Acciones"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmdiffer.mnuencoding.caption
msgctxt "tfrmdiffer.mnuencoding.caption"
msgid "En&coding"
msgstr "&Codificación"
#: tfrmdiffer.mnufile.caption
msgctxt "tfrmdiffer.mnufile.caption"
msgid "&File"
msgstr "&Archivo"
#: tfrmdiffer.mnuoptions.caption
msgid "&Options"
msgstr "&Opciones"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Añadir un atajo nuevo a la secuencia"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Quitar el último atajo de la secuencia"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr "Seleccionar atajo de la lista de teclas que quedan libres"
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr "Solo para estos controles"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parámetros (cada uno en línea separada):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Atajos:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "Acerca de..."
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "Acerca de..."
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Configuración"
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Configuración"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Copiar"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Copiar"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Cortar"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Cortar"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Borrar"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Borrar"
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Buscar"
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Buscar"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Buscar siguiente"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Buscar siguiente"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Buscar anterior"
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr "Ir a Línea..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mac (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Unix (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Pegar"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Pegar"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Rehacer"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Rehacer"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Reemplazar"
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Reemplazar"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Seleccion&ar todo"
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Seleccionar todo"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Deshacer"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Deshacer"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Cerrar"
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Cerrar"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Salir"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Salir"
#: tfrmeditor.actfilenew.caption
msgid "&New"
msgstr "&Nuevo"
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Nuevo"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Abrir"
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Abrir"
#: tfrmeditor.actfilereload.caption
#, fuzzy
msgctxt "tfrmeditor.actfilereload.caption"
msgid "Reload"
msgstr "Recargar"
#: tfrmeditor.actfilesave.caption
msgctxt "tfrmeditor.actfilesave.caption"
msgid "&Save"
msgstr "&Guardar"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Guardar"
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Guardar &como..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Guardar como"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "G&uardar todo"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Guardar todo"
#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr "Editor"
#: tfrmeditor.help1.caption
msgctxt "tfrmeditor.help1.caption"
msgid "&Help"
msgstr "A&yuda"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codificación"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Abrir como"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Guardar como"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Archivo"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Resaltado de sintaxis"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Fin de línea"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgid "C&ase sensitivity"
msgstr "Sensible a capitalización"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgid "S&earch from caret"
msgstr "Buscar d&esde la posición actual"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgid "&Regular expressions"
msgstr "Expresiones &regulares"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgid "Selected &text only"
msgstr "Solo &texto seleccionado"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgid "&Whole words only"
msgstr "Solo palabras completas"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgid "Option"
msgstr "Opción"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgid "&Replace with:"
msgstr "&Reemplazar con:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgid "&Search for:"
msgstr "&Buscar por:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgid "Direction"
msgstr "Dirección"
#: tfrmextractdlg.caption
msgid "Unpack files"
msgstr "Descomprimir archivos"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "Desco&mprimir nombres de ruta si se almacenaron con archivos"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "De&scomprimir cada archivo en una carpeta separada (nombre del archivo)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "S&obrescribir archivos existentes"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "En la ca&rpeta:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "&Extraer los de la máscara:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "Co&ntraseña para archivos cifrados:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Cerrar"
#: tfrmfileexecuteyourself.caption
msgid "Wait..."
msgstr "Espere..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Nombre del archivo:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "tfrmfileexecuteyourself.lblfrompath.caption"
msgid "From:"
msgstr "Desde:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "¡Pulsa en «Cerrar» cuando el archivo temporal se pueda borrar!"
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&Al panel"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Ver todo"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Operación actual:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Desde: "
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Hacia: "
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Cerrar"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "A&plicar"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Aplicar a &selección"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "&Saltar este archivo"
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr "Propiedades"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Sticky"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr "Permitir ejecutar el archivo como un programa"
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Propietario"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grupo"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Otros"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Propietario"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "tfrmfileproperties.lblattrtext.caption"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
msgid "Text:"
msgstr "Texto:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Contiene:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Ejecución"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr "Ejecutar:"
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Nombre"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "tfrmfileproperties.lblfilestr.caption"
msgid "File name"
msgstr "Nombre"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Ruta:"
#: tfrmfileproperties.lblgroupstr.caption
msgid "&Group"
msgstr "&Grupo"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Último acceso:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Última modificación:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Último cambio de estado:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "tfrmfileproperties.lbloctal.caption"
msgid "Octal:"
msgstr "Octal"
#: tfrmfileproperties.lblownerstr.caption
msgid "O&wner"
msgstr "&Propietario"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lectura"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "tfrmfileproperties.lblsizestr.caption"
msgid "Size:"
msgstr "Tamaño:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Enlace simbólico a:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Tipo:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Escritura"
#: tfrmfileproperties.sgimage.columns[0].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Nombre"
#: tfrmfileproperties.sgimage.columns[1].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Valor"
#: tfrmfileproperties.tsattributes.caption
msgctxt "tfrmfileproperties.tsattributes.caption"
msgid "Attributes"
msgstr "Atributos"
#: tfrmfileproperties.tsplugins.caption
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Complementos"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Propiedades"
#: tfrmfinddlg.actcancel.caption
msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION"
msgid "C&ancel"
msgstr "C&ancelar"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "&Cerrar"
#: tfrmfinddlg.actclose.caption
msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION"
msgid "&Close"
msgstr "Cerrar"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Configuración de atajos de teclado"
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "&Editar"
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "En&listar"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr "Cancelar búsqueda, cerrar y quitar de la memoria"
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr "Para los demás «Archivos encontrados», cancelar, cerrar y quitar de la memoria"
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Ir al archivo"
#: tfrmfinddlg.actintellifocus.caption
msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION"
msgid "Find Data"
msgstr "Buscar datos"
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "Ú&ltima búsqueda"
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Nueva búsqueda"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr "Nueva &búsqueda (borrar filtros)"
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Ir a la página «Avanzado»"
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Ir a la página «Cargar/Guardar»"
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr "Cambiar a la página siguien&te"
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Ir a la página «Complementos»"
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr "Cambiar a la &página anterior"
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Ir a la página «Resultados»"
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Ir a la página «General»"
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "Comen&zar"
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Ver"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Añadir"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "A&yuda"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Guardar"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "B&orrar"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "Car&gar"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "Gu&ardar"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "&Guardar con la ruta"
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr ""
"Si eliges «Guardar con la ruta», cuando cargue la plantilla\n"
"restaurará también la ruta de búsqueda.\n"
"Úsalo si quieres dirigirla a una carpeta concreta.\n"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Usar plantilla"
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Buscar archivos"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Sensible a capitalización"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "Fecha &desde:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "F&echa hasta:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "&Tamaño desde:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Tamaño &hasta:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "Buscar en &ficheros"
#: tfrmfinddlg.cbfindtext.caption
msgid "Find &text in file"
msgstr "Buscar &texto en archivo"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgid "Follow s&ymlinks"
msgstr "Seguir enlaces simbólicos"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgid "Find files N&OT containing the text"
msgstr "Buscar archivos que N&O contengan el texto"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "N&o más antiguo de:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Pestañas abiertas"
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Buscar partes del nombre del archivo"
#: tfrmfinddlg.cbregexp.caption
msgid "&Regular expression"
msgstr "Expresiones &regulares"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "Ree&mplazar por"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Carpetas y archivos seleccionados"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "&Expresiones regulares"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "&Hora desde:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "H&ora hasta:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "&Usar complemento de búsqueda:"
#: tfrmfinddlg.chkhex.caption
msgid "Hexadecimal"
msgstr ""
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr ""
"Introducir las carpetas que serán excluidas\n"
"de la búsqueda separadas con «;»\n"
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr ""
"Introducir los archivos que serán excluidos\n"
"de la búsqueda separados con «;»\n"
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Introducir nombres de archivos separados con «;»"
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Carpetas"
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Archivos"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Buscar datos"
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Atri&butos"
#: tfrmfinddlg.lblencoding.caption
msgid "Encodin&g:"
msgstr "Codi&ficación:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "E&xcluir subcarpetas"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "&Excluir archivos"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "Máscara de &archivos"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Comenzar en la carpeta"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Buscar en su&bcarpetas:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "Búsquedas anteriores:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr "&Acción"
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr "Para los todos demás, cancelar, cerrar y quitar de la memoria"
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "A&brir ruta en una pestaña nueva"
#: tfrmfinddlg.mioptions.caption
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Opciones"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Borrar de la lista"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr "&Resultado"
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Mostrar todos los elementos encontrados"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Mostrar en Editor"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Mostrar en Visor"
#: tfrmfinddlg.miviewtab.caption
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Ver"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Avanzado"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Cargar/Guardar"
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Complementos"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Resultados"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "General"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Buscar"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Buscar"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "Sensible a c&apitalización"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Crear enlace duro"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "tfrmhardlink.lblexistingfile.caption"
msgid "&Destination that the link will point to"
msgstr "&Destino al que apuntará el enlace"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "tfrmhardlink.lbllinktocreate.caption"
msgid "&Link name"
msgstr "Nombre del en&lace"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr "¡Importar todo!"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr "Importar seleccionado"
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr "Selecciona los apuntes que quieras importar"
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Cuando pulses un submenú, seleccionará el menú completo."
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Para seleccionar varios apuntes mantén CTRL y púlsalos"
#: tfrmlinker.btnsave.caption
msgctxt "tfrmlinker.btnsave.caption"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgid "Linker"
msgstr "Enlazador"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Guardar en..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Elemento"
#: tfrmlinker.lblfilename.caption
msgid "&File name"
msgstr "&Nombre del archivo"
#: tfrmlinker.spbtndown.caption
msgid "Do&wn"
msgstr "Aba&jo"
#: tfrmlinker.spbtndown.hint
msgid "Down"
msgstr "Abajo"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "&Eliminar"
#: tfrmlinker.spbtnrem.hint
msgctxt "TFRMLINKER.SPBTNREM.HINT"
msgid "Delete"
msgstr "Borrar"
#: tfrmlinker.spbtnup.caption
msgctxt "tfrmlinker.spbtnup.caption"
msgid "&Up"
msgstr "A&rriba"
#: tfrmlinker.spbtnup.hint
msgid "Up"
msgstr "Arriba"
#: tfrmmain.actabout.caption
msgid "&About"
msgstr "&Acerca de..."
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Añadir nombre del archivo a la línea de comandos"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr "Nueva petición de búsqueda..."
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Añadir ruta y nombre del archivo a la línea de comandos"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Copiar ruta a la línea de comandos"
#: tfrmmain.actbenchmark.caption
msgid "&Benchmark"
msgstr ""
#: tfrmmain.actbriefview.caption
msgid "Brief view"
msgstr "Vista breve"
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Vista breve"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Calcular espacio &ocupado"
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Cambiar de carpeta"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Cambiar a la carpeta del usuario"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Cambiar a carpeta superior"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Cambiar a la carpeta raíz"
#: tfrmmain.actchecksumcalc.caption
msgid "Calculate Check&sum..."
msgstr "Calcular &suma de verificación..."
#: tfrmmain.actchecksumverify.caption
msgid "&Verify Checksum..."
msgstr "Comprobar suma de &verificación..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Borrar archivo de registro"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Borrar ventana de registro"
#: tfrmmain.actclosealltabs.caption
msgid "Close &All Tabs"
msgstr "Cerrar tod&as las pestañas"
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Cerrar las pestañas duplicadas"
#: tfrmmain.actclosetab.caption
msgid "&Close Tab"
msgstr "&Cerrar pestaña"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Línea de comandos siguiente"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Poner en la línea de comandos el comando siguiente en historial"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Línea de comandos anterior"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Poner en la línea de comandos el comando anterior en historial"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Columnas"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Vista de columnas"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Comparar por &contenidos"
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr "Co&mparar carpetas"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Comparar carpetas"
#: tfrmmain.actconfigarchivers.caption
msgid "Configuration of Archivers"
msgstr ""
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Configuración de la lista de marcadores"
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Configuración de las pestañas favoritas"
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Configuración de las pestañas de carpetas"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Configuración de atajos de teclado"
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Guardar ajustes"
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr "Configuración de búsquedas"
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Barra de herramientas..."
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Configuración del menú de la vista de árbol "
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Configuración del menú de colores de la vista de árbol"
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Mostrar menú contextual"
#: tfrmmain.actcopy.caption
msgctxt "TFRMMAIN.ACTCOPY.CAPTION"
msgid "Copy"
msgstr "Copiar"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Copiar todas las pestañas al panel opuesto"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Copi&ar las columnas de los archivos seleccionados"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Copiar nombre(s) con la r&uta completa"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Copiar nombre(s) al por&tapapeles"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Copiar archivos sin pedir confirmación"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr "Copiar ruta completa de los archivos seleccionados sin el último delimitador"
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Copiar ruta completa de los archivos seleccionados"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Copiar en el mismo panel"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Copiar"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "Mostrar &espacio ocupado"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "Cor&tar"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Mostrar parámetros del comando"
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Eliminar"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr "Para todas las búsquedas, cancelar, cerrar y quitar de la memoria"
#: tfrmmain.actdirhistory.caption
msgid "Directory history"
msgstr "Historial de carpetas"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Marcadores de carpetas"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Seleccionar cualquier comando y ejecutarlo"
#: tfrmmain.actedit.caption
msgctxt "TFRMMAIN.ACTEDIT.CAPTION"
msgid "Edit"
msgstr "Editar"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Editar co&mentario..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Editar archivo nuevo"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Editar campo de ruta encima de la lista de archivos"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Intercambiar paneles"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr "Ejecutar script"
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Salir"
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "&Extraer archivos..."
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Configuración de asociaciones de archivos"
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "Com&binar archivos..."
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Mostrar p&ropiedades del archivo"
#: tfrmmain.actfilespliter.caption
msgid "Spl&it File..."
msgstr "D&ividir archivo..."
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "Ver archivos anidados"
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Foco en la línea de comandos"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr "Intercambiar foco"
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr "Cambia entre la lista de archivos izquierda y derecha"
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Colocar el cursor sobre el primer archivo"
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Colocar el cursor sobre el último archivo"
#: tfrmmain.acthardlink.caption
msgid "Create &Hard Link..."
msgstr "Crear enlace &duro..."
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "&Contenidos"
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "Paneles en modo &horizontal"
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Teclado"
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Vista breve en el panel izquierdo"
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Vista de columnas en el panel izquierdo"
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Panel izquierdo &= Panel derecho"
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "Vista anidada en el panel izquierdo"
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Abrir lista izquierda de unidades"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Orden in&verso en el panel izquierdo"
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Ordenar panel izquierdo por &atributos"
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Or&denar panel izquierdo por fecha"
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "Ordenar panel izquierdo por &extensión"
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "Ordenar panel izquierdo por &nombre"
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Ordenar panel izquierdo por &tamaño"
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Vista de miniaturas en el panel izquierdo"
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "&Cargar pestañas desde favoritas"
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Cargar selección desde el p&ortapapeles"
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "Cargar se&lección desde archi&vo..."
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "&Cargar pestañas desde archivo"
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "Crear carpeta"
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Sele&ccionar todos con la misma e&xtensión"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr "Seleccionar todos los archivos con el mismo nombre"
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr "Seleccionar todos los archivos con el mismo nombre y extensión"
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr "Seleccionar todos en la misma ruta"
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "&Invertir selección"
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "Se&leccionar todo"
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "D&eseleccionar grupo..."
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "&Seleccionar grupo..."
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "&Deseleccionar todo"
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Minimizar ventana"
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "&Renombrado múltiple"
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "&Conectar a unidad de red..."
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "&Desconectar de unidad de red..."
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Conexión &rápida de red..."
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "&Pestaña nueva"
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr "Cargar la siguiente pestaña favorita de la lista"
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Cambiar a la pestaña siguien&te"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Abrir"
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Abrir fichero"
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Abrir archivo de barra"
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "A&brir ruta en una pestaña nueva"
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgid "Open &VFS List"
msgstr "Abrir listado &VFS"
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "&Visor de operaciones"
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Opciones..."
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "Co&mprimir archivos..."
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Fijar posición de separación"
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "&Pegar"
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Cargar la anterior pestaña favorita de la lista"
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Cambiar a la pestaña a&nterior"
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Filtro rápido"
#: tfrmmain.actquicksearch.caption
msgid "Quick search"
msgstr "Búsqueda rápida"
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "Panel de vista rápida"
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "Actualiza&r"
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Recargar la última pestaña favorita cargada"
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Mover"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Mover/Eliminar sin pedir confirmación"
#: tfrmmain.actrenameonly.caption
msgctxt "tfrmmain.actrenameonly.caption"
msgid "Rename"
msgstr "Renombrar"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "&Renombrar pestaña"
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Volver a guardar las últimas favoritas cargadas"
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "&Restaurar selección"
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "Orden in&verso"
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Vista breve en el panel derecho"
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Vista de columnas en el panel derecho"
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Panel derecho &= Panel izquierdo"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "Vista anidada en el panel derecho"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Abrir lista derecha de unidades"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "Orden in&verso en el panel derecho"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Ordenar panel derecho por &atributos"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Or&denar panel derecho por fecha"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Ordenar panel derecho por &extensión"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Ordenar panel derecho por &nombre"
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Ordenar panel derecho por &tamaño"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Vista de miniaturas en el panel derecho"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Ejecutar &terminal"
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Guardar las pestañas actuales como favoritas"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "&Guardar selección"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Guardar selección en arc&hivo..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "&Guardar pestañas a archivo"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Buscar..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Todas bloqueadas, abre las rutas en pes&tañas nuevas"
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Poner todas las pestañas normales"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Poner todas las pestañas bloqueadas"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Todas bloqueadas, pero permite cambiar de ruta"
#: tfrmmain.actsetfileproperties.caption
msgid "Change &Attributes..."
msgstr "Cambiar &atributos..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Bloqueada, abre las rutas en pes&tañas nuevas"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normal"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "B&loqueada"
#: tfrmmain.actsettaboptionpathresets.caption
msgid "Locked with &Directory Changes Allowed"
msgstr "Bloqueada, pero permite cambiar de ruta"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Abrir"
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Abrir usando asociaciones del sistema"
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Mostrar menú de botones"
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Mostrar historial de la línea de comandos"
#: tfrmmain.actshowmainmenu.caption
msgid "Menu"
msgstr "Menú"
#: tfrmmain.actshowsysfiles.caption
msgid "Show &Hidden/System Files"
msgstr "Mostrar archivos oc&ultos/sistema"
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Ordenar por &atributos"
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Or&denar por fecha"
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Ordenar por &extensión"
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Ordenar por &nombre"
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Ordenar por &tamaño"
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Abrir lista de unidades"
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "Habilitar/Deshabilitar lista de ignorados para no mostrar nombres de archivo"
#: tfrmmain.actsymlink.caption
msgid "Create Symbolic &Link..."
msgstr "Crear en&lace simbólico..."
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr "Sincronizar carpetas..."
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Destino &= Origen"
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Compro&bar fichero(s)"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Miniaturas"
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Vista de miniaturas"
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr "Cambiar a modo consola en pantalla completa"
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Transferir carpeta bajo el cursor a la izquierda"
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Transferir carpeta bajo el cursor a la derecha"
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "Panel de la vista de árbol"
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr "Ordenar de acuerdo con los parámetros"
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Deselecci&onar todos con la misma extensión"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr "Deseleccionar todos los archivos con el mismo nombre"
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr "Deseleccionar todos los archivos con el mismo nombre y extensión"
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr "Deseleccionar todos en la misma ruta"
#: tfrmmain.actview.caption
msgctxt "TFRMMAIN.ACTVIEW.CAPTION"
msgid "View"
msgstr "Ver"
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Mostrar historial de las rutas visitadas por vista activa"
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Ir al apunte siguiente en historial"
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Ir al apunte anterior en historial"
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Ver el contenido del archivo registro"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr "Ver las peticiones de búsqueda actuales"
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Visitar web de Double Commander"
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Destruir"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr "Trabajar con marcadores y parámetros"
#: tfrmmain.btnf10.caption
msgctxt "TFRMMAIN.BTNF10.CAPTION"
msgid "Exit"
msgstr "Salir"
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Carpeta nueva"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Borrar"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminal"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Marcadores"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Mostrar la carpeta actual del panel derecho en el panel izquierdo"
#: tfrmmain.btnlefthome.caption
msgctxt "tfrmmain.btnlefthome.caption"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "Ir a la carpeta del usuario"
#: tfrmmain.btnleftroot.caption
msgctxt "tfrmmain.btnleftroot.caption"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Ir a la carpeta raíz"
#: tfrmmain.btnleftup.caption
msgctxt "tfrmmain.btnleftup.caption"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Ir a la carpeta superior"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Marcadores"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Mostrar la carpeta actual del panel izquierdo en el panel derecho"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "tfrmmain.lblcommandpath.caption"
msgid "Path"
msgstr "Ruta"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Copiar..."
#: tfrmmain.mihardlink.caption
msgid "Create link..."
msgstr "Crear enlace..."
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Borrar"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Copiar"
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Ocultar"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Seleccionar todo"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Mover..."
#: tfrmmain.misymlink.caption
msgid "Create symlink..."
msgstr "Crear enlace simbólico..."
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Opciones de la pestaña"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Salir"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Restaurar"
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Comenzar"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Comandos"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "C&onfiguración"
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "Pestañas favoritas"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Archivo"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "A&yuda"
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Seleccionar"
#: tfrmmain.mnunetwork.caption
msgctxt "tfrmmain.mnunetwork.caption"
msgid "Network"
msgstr "Red"
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Vista"
#: tfrmmain.mnutaboptions.caption
msgid "Tab &Options"
msgstr "Opciones de la pestaña"
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "Pes&tañas"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Copiar"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Cortar"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Borrar"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Editar"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Pegar"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr "Selecciona el comando interno"
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Orden heredado"
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
msgid "Legacy sorted"
msgstr "Orden heredado"
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Selecciona todas las categorías predeterminadas"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Selección:"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "C&ategorías:"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "Coma&ndo:"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Filtro:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Acción:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Atajo:"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr "cm_name"
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "C&ategorías"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Ayuda"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Consejo"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Atajos"
#: tfrmmaskinputdlg.btnaddattribute.caption
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Añadir"
#: tfrmmaskinputdlg.btnattrshelp.caption
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "A&yuda"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Definir..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Sensible a capitalización"
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr "Ignorar acentos y ligaduras"
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr "Atri&butos:"
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Máscara de entrada:"
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "O escoge tipo de selección predefinida:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Crear carpeta nueva"
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "&Introduce el nombre de la carpeta nueva:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr "Tamaño nuevo"
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Altura :"
#: tfrmmodview.lblpath1.caption
msgctxt "tfrmmodview.lblpath1.caption"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Calidad de compresión jpg"
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Anchura:"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Altura"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "tfrmmodview.tewidth.text"
msgid "Width"
msgstr "Anchura"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr "456456465465465"
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Cerrar"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "&Borrar"
#: tfrmmultirename.btnedit.caption
msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "Carg&ar"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Renombrar"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Res&tablecer todo"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Guardar"
#: tfrmmultirename.caption
msgid "MultiRename"
msgstr "Renombrado múltiple"
#: tfrmmultirename.cblog.caption
msgid "Ena&ble"
msgstr "Acti&var"
#: tfrmmultirename.cbregexp.caption
msgid "Regular e&xpressions"
msgstr "E&xpresiones regulares"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "&Usar sustitución"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E] Extensión"
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Contador"
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Buscar y Reemplazar"
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Registro de resultados"
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Máscara"
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Preajustes"
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "Exten&sión"
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "B&uscar..."
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "&Intervalo"
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "&Nombre del archivo"
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "Ree&mplazar..."
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "Número inicia&l"
#: tfrmmultirename.lbwidth.caption
msgid "&Width"
msgstr "&Dígitos"
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Contador"
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Día"
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Día (2 dígitos)"
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Día de la semana (corto, ejem., «lu.»)"
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Día de la semana (largo, ejem., «lunes»)"
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex] Carácter en posición x"
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] Caracteres desde posición x a y"
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Hora"
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Hora (2 dígitos)"
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minuto"
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minutos (2 dígitos)"
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Mes"
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Mes (2 dígitos)"
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Mes (corto, ejem., «Ene»)"
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Mes (largo, ejem., «Enero»)"
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Nombre"
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Carácter en posición x"
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Caracteres desde posición x a y"
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Hora..."
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Extensión..."
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Nombre..."
#: tfrmmultirename.miplugin.caption
msgctxt "tfrmmultirename.miplugin.caption"
msgid "Plugin"
msgstr "Complemento"
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[s] Segundo"
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Segundos (2 dígitos)"
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Año (2 dígitos)"
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Año (4 dígitos)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr "Editar nombres..."
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr "Cargar nombres desde el archivo..."
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgid "Old File Name"
msgstr "Nombre antiguo"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgid "New File Name"
msgstr "Nombre nuevo"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgid "File Path"
msgstr "Ruta"
#: tfrmmultirenamewait.caption
msgctxt "TFRMMULTIRENAMEWAIT.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr "Pulsa en «Aceptar» cuando hayas cerrado el editor para efectuar los cambios"
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Selecciona una aplicación"
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Comando personalizado"
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Guardar asociación"
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Establecer la aplicación como predeterminada"
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Tipo de archivo a abrir: «%s»"
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Nombres de archivos múltiples"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "URIs múltiples"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Nombre de archivo único"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "URI individual"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgid "&Apply"
msgstr "A&plicar"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Opciones"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Por favor, selecciona una de las subpáginas, esta página no contiene ningún ajuste."
#: tfrmoptionsarchivers.btnarchiveradd.caption
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
msgid "A&dd"
msgstr "Aña&dir"
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverapply.caption
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
msgid "A&pply"
msgstr "A&plicar"
#: tfrmoptionsarchivers.btnarchivercopy.caption
msgid "Cop&y"
msgstr "Copiar"
#: tfrmoptionsarchivers.btnarchiverdelete.caption
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
msgid "Delete"
msgstr "&Borrar"
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverother.caption
msgid "Oth&er..."
msgstr "Otros..."
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccionar la ruta apropiada"
#: tfrmoptionsarchivers.btnarchiverrename.caption
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
msgid "&Rename"
msgstr "&Renombrar"
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiverids.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
msgid "Options:"
msgstr "Opciones:"
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
msgid "Format parsing mode:"
msgstr "Formato modo de análisis:"
#: tfrmoptionsarchivers.chkarchiverenabled.caption
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
msgid "E&nabled"
msgstr "Acti&vado"
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
msgid "De&bug mode"
msgstr "Modo de depuración"
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
msgid "S&how console output"
msgstr "Mo&strar salida de consola"
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
msgid "Uni&x file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
msgid "&Unix path delimiter \"/\""
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
msgid "Windows &file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
msgid "Windows path deli&miter \"\\\""
msgstr ""
#: tfrmoptionsarchivers.lblarchiveradd.caption
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
msgid "Add&ing:"
msgstr "Añad&iendo:"
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
msgid "Arc&hiver:"
msgstr "Co&mpresor:"
#: tfrmoptionsarchivers.lblarchiverdelete.caption
msgid "De&lete:"
msgstr "Borrar:"
#: tfrmoptionsarchivers.lblarchiverdescription.caption
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
msgid "De&scription:"
msgstr "De&scripción:"
#: tfrmoptionsarchivers.lblarchiverextension.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
msgid "E&xtension:"
msgstr "E&xtensión:"
#: tfrmoptionsarchivers.lblarchiverextract.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
msgid "Ex&tract:"
msgstr "Ex&traer:"
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
msgid "Extract &without path:"
msgstr "Extraer sin ruta:"
#: tfrmoptionsarchivers.lblarchiveridposition.caption
msgid "ID Po&sition:"
msgstr "Posición ID:"
#: tfrmoptionsarchivers.lblarchiverids.caption
msgid "&ID:"
msgstr "ID:"
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
msgid "ID See&k Range:"
msgstr "Rango de búsqueda ID:"
#: tfrmoptionsarchivers.lblarchiverlist.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
msgid "&List:"
msgstr "&Listar:"
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
msgid "Archi&vers:"
msgstr "Compresores:"
#: tfrmoptionsarchivers.lblarchiverlistend.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
msgid "Listing &finish (optional):"
msgstr "&Finalizar listado (opcional):"
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
msgid "Listing for&mat:"
msgstr "For&mato de listado:"
#: tfrmoptionsarchivers.lblarchiverliststart.caption
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
msgid "Listin&g start (optional):"
msgstr "Comenzar listado (opcional):"
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
msgid "Password &query string:"
msgstr "Pregunta para la contraseña:"
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
msgid "Create self extractin&g archive:"
msgstr "Crear archivo autoextraíble:"
#: tfrmoptionsarchivers.lblarchivertest.caption
msgid "Tes&t:"
msgstr "Comprobar:"
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
msgid "Auto Configure"
msgstr "A&utoconfigurar"
#: tfrmoptionsarchivers.miarchiverdisableall.caption
msgid "Disable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
msgid "Discard modifications"
msgstr ""
#: tfrmoptionsarchivers.miarchiverenableall.caption
msgid "Enable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverexport.caption
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
msgid "Export..."
msgstr "Exportar..."
#: tfrmoptionsarchivers.miarchiverimport.caption
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
msgid "Import..."
msgstr "Importar..."
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
msgid "Sort archivers"
msgstr ""
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgid "Additional"
msgstr "Adicional"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr "General"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgid "When &size, date or attributes change"
msgstr "Cua&ndo cambien de tamaño, fecha o atributos"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr "Para la&s rutas siguientes y sus subcarpetas:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgid "When &files are created, deleted or renamed"
msgstr "C&uando se creen, borren o renombren archivos"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgid "When application is in the &background"
msgstr "Cuan&do la aplicación esté en segundo plano"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgid "Disable auto-refresh"
msgstr "Deshabilitar actualización automática"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgid "Refresh file list"
msgstr "Actualizar la lista de archivos"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgid "Al&ways show tray icon"
msgstr "Mostrar siempre el icono en la bande&ja del sistema"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "&Ocultar automáticamente los dispositivos sin montar"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgid "Mo&ve icon to system tray when minimized"
msgstr "Mo&ver icono a la bandeja del sistema al minimizar"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgid "A&llow only one copy of DC at a time"
msgstr "Permitir so&lo una copia a la vez de Double Commander"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr ""
"Aquí puedes introducir una o más unidades\n"
"o puntos de montaje, separados por «;».\n"
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Unidades &no permitidas:"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Tamaño de columnas"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Mostrar extensiones de archivos"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "Alineado (tabulado)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "Di&rectamente tras el nombre del archivo"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Automático"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Número de columnas fijas"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Ancho fijo de columnas"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "Ajustar &texto al ancho de columna"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr "Am&pliar el ancho de la celda si el texto no se ajusta a la columna"
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr "Líneas &horizontales"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr "Líneas &verticales"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr "&Rellenar automáticamente las columnas"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Mostrar rejilla"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Tamaño automático de columnas"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr "Colu&mna de tamaño automático:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "A&plicar"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "Historial de línea de co&mandos"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgid "&Directory history"
msgstr "Historial de carpetas"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr "Historial de &máscaras de archivos"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr "&Guardar la configuración"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr "&Historial de buscar/reemplazar"
#: tfrmoptionsconfiguration.gbdirectories.caption
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Carpetas"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Ubicación de los archivos de configuración"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Guardar al salir"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Ordenación de configuración en el árbol izquierdo"
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "Fijar en la línea de comandos"
#: tfrmoptionsconfiguration.lblhighlighters.caption
msgid "Highlighters:"
msgstr ""
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr "Temas de iconos:"
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr "Caché de miniaturas:"
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "Ca&rpeta del programa (versión portable)"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "Carpeta del &usuario"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
msgid "All"
msgstr "Todo"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
msgid "Apply modification to all columns"
msgstr "Aplica la modificación a todas las columnas"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
msgid "&Delete"
msgstr "&Borrar"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Configuración predeterminada"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
msgid "New"
msgstr "Nuevo"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "&Siguiente"
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "&Anterior"
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
msgid "Rename"
msgstr "Renombrar"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
msgid "Reset to default"
msgstr "Restablecer valores"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
msgid "Save as"
msgstr "Guardar como"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
msgid "Save"
msgstr "Guardar"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Permitir sobrecolor"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "Al pulsar para cambiar algo, cambia para todas las columnas"
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
msgid "General"
msgstr "General"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Borde del cursor"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Usar cursor &enmarcado"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Usar color de selección inactiva"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "U&sar selección invertida"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Usar tipografía y color personalizados"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgid "BackGround:"
msgstr "Segundo plano:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgid "Background 2:"
msgstr "Segundo plano 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Con&figurar vistas de columnas"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Nombre actual de columna]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgid "Cursor Color:"
msgstr "Color del cursor:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgid "Cursor Text:"
msgstr "Texto en cursor:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgid "Font:"
msgstr "Tipografía:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
msgid "Size:"
msgstr "Tamaño:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgid "Text Color:"
msgstr "Color del texto:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Color cursor inactivo:"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Color selecc. inactiva:"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgid "Mark Color:"
msgstr "Color de selección:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "A continuación se muestra una vista previa. Puedes mover el cursor y seleccionar archivos para ver el aspecto de los distintos ajustes."
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Ajustes de columna:"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgid "Add column"
msgstr "Añadir columna"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Posición de cuadro de panel después de comparación:"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr "Añadir la carpeta del cuadro &activo"
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr "Añadir carpetas de los cua&dros activo e inactivo"
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr "Añadir car&peta a seleccionar..."
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgid "Add a copy of the selected entry"
msgstr "Añadir una copia del apunte seleccionado"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr "Añadir las carpetas actuales &seleccionadas o activas del cuadro activo"
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgid "Add a separator"
msgstr "Añadir separador"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr "Añadir submenú"
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr "Añadir carpeta nueva"
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Contraer todo"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr "Contraer elemento"
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr "Cortar apuntes seleccionados"
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr "¡Eliminar todo!"
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Eliminar elemento seleccionado"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr "Borrar submenú y todos sus elementos"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr "Borrar solo submenú pero mantener elementos"
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr "Expandir elemento"
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr "Foco en la ventana del árbol "
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr "Ir al primer elemento"
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr "Ir al último elemento"
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr "Ir al elemento siguiente"
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr "Ir al elemento anterior"
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr "Insertar carpeta del cuadro &activo"
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr "Insertar carpetas de los cua&dros activo e inactivo"
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr "Insertar carpeta a seleccionar..."
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr "Insertar una copia del apunte seleccionado"
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr "Insertar las carpetas actuales &seleccionadas o activas del cuadro activo"
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr "Insertar un separador"
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr "Insertar submenú"
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr "Insertar carpeta nueva"
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr "Mover al siguiente"
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr "Mover al anterior"
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Expandir todo"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr "Pegar lo que se cortó"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr "Buscar y reem&plazar en la ruta"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr "Buscar y reemplazar tanto en ruta como en destino"
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr "Buscar y reemplazar en la ru&ta de destino"
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr "Ajustar ruta"
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr "Ajustar ruta de destino"
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Aña&dir..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Res&paldo..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Bo&rrar..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "E&xportar..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION"
msgid "&Help"
msgstr "A&yuda"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Impor&tar..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "&Insertar..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "&Miscelánea..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccionar ruta apropiada"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgid "Some functions to select appropriate target"
msgstr "Algunas funciones para seleccionar el destino apropiado"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "&Ordenar..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "Al a&ñadir carpeta, agregar también destino"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Expa&ndir siempre el árbol"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Mostrar solo &variables de entorno válidas"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr "Mostrar la r&uta en el menú emergente"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Nombre, a-z"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr "Nombre, a-z"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Lista de marcadores (reordenar con arrastrar y soltar) "
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Otras opciones"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr "Nombre:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr "Ruta:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgid "&Target:"
msgstr "Des&tino:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "...ni&vel actual de elemento(s) seleccionados solamente"
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Comprobar &que existen las rutas de los marcadores"
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "Comprobar que exi&sten las rutas y destinos de los marcadores"
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "a un archivo marcadores (.&hotlist)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "al «wincmd.ini» de TC (mant&ener existente)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "al «wincmd.ini» de TC (borrando &existente)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Ir a info &configurar TC"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
msgid "Go to &configure TC related info"
msgstr "Ir a info &configurar TC"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "Menú de pruebas para las carpetas de favoritos"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "desde un archivo marcadores (.&hotlist)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "desde «&wincmd.ini» de TC"
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr "&Navegar..."
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "&Recuperar un respaldo de la lista de marcadores"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "Guardar un re&spaldo de la lista de marcadores actual"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Buscar y &reemplazar..."
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...todo, de la A a la &Z"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "...solo &grupo único de elemento(s)"
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "...&contenido de submenú(s) seleccionado, sin subnivel"
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "...contenido de submenú(s) seleccion&ado y todos sus subniveles"
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr "Prue&ba del menú resultante"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr "Ajustar &la ruta"
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr "Ajustar la ru&ta de destino"
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr "Adición desde el panel principal"
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Desde todos los formatos soportados, preguntar cual se usará cada vez"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Cuando guarde texto Unicode, guardarlo en formato UTF8 (de todos modos será UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Cuando suelte texto, generar automáticamente nombre del archivo (de otra manera le preguntará al usuario)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Mo&strar diálogo de confirmación después de soltar"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Cuando arrastre y suelte texto dentro de paneles:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Ponga el formato preferido al comienzo de la lista (usar arrastrar y soltar):"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(si el preferido no está presente, se tomará el segundo y así sucesivamente)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(no funcionará con alguna aplicación origen, intente desmarcar si hay problema)"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Mostrar &sistema de archivos"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Mostrar &espacio libre"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Mostrar eti&queta"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Lista de unidades"
#: tfrmoptionseditor.chkautoindent.caption
msgid "Auto Indent"
msgstr ""
#: tfrmoptionseditor.chkautoindent.hint
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
msgstr ""
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Al final de la marca de inserción"
#: tfrmoptionseditor.chkscrollpastendline.hint
msgid "Allows caret to go into empty space beyond end-of-line position"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Mostrar caracteres especiales"
#: tfrmoptionseditor.chkshowspecialchars.hint
msgid "Shows special characters for spaces and tabulations"
msgstr ""
#: tfrmoptionseditor.chktabindent.caption
msgid "Tab indents blocks"
msgstr ""
#: tfrmoptionseditor.chktabindent.hint
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.caption
msgid "Use spaces instead tab characters"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.hint
msgid "Converts tab characters to a specified number of space characters (when entering)"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.caption
msgid "Delete trailing spaces"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.hint
msgid "Auto delete trailing spaces, this applies only to edited lines"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Opciones del editor interno"
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "Segundo plano"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "Segundo plano"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Restablecer"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr "Guardar"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Atributos de elemento"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Primer plano"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "Primer plano"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "Marca de &texto"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Usar (y editar) esquema de ajustes &globales"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Usar esquema de ajuste &local"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Negrita"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&vertir"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&ff"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "O&n"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "Cursiva"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&vertir"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&ff"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "O&n"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "Tachado"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "In&vertir"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "O&ff"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "O&n"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "S&ubrayado"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "In&vertir"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "O&ff"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "O&n"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION"
msgid "Add..."
msgstr "Añadir..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION"
msgid "Delete..."
msgstr "Borrar..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Importar/Exportar"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION"
msgid "Insert..."
msgstr "Insertar..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION"
msgid "Rename"
msgstr "Renombrar"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION"
msgid "Sort..."
msgstr "Ordenar..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Ninguno"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION"
msgid "Always expand tree"
msgstr "Expandir siempre el árbol"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "No"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "&Izquierda"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "De&recha"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Lista de pestañas favoritas (reordenar con arrastrar y soltar)"
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION"
msgid "Other options"
msgstr "Otras opciones:"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr "Qué restaurar y dónde para el apunte seleccionado:"
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Pestañas existentes que deben mantenerse:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Guardar historial de direcciones:"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr "Pestañas guardadas a la izquierda se restaurarán en:"
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr "Pestañas guardadas a la derecha se restaurarán en:"
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION"
msgid "a separator"
msgstr "separador"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Añadir separador"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION"
msgid "sub-menu"
msgstr "submenú"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION"
msgid "Add sub-menu"
msgstr "Añadir submenú"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION"
msgid "Collapse all"
msgstr "Contraer todo"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION"
msgid "...current level of item(s) selected only"
msgstr "...nivel actual de elemento(s) seleccionados solamente"
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION"
msgid "Cut"
msgstr "Cortar"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION"
msgid "delete all!"
msgstr "¡eliminar todo!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION"
msgid "sub-menu and all its elements"
msgstr "submenú y todos sus elementos"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION"
msgid "just sub-menu but keep elements"
msgstr "solo submenú pero mantener elementos"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION"
msgid "selected item"
msgstr "elemento seleccionado"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION"
msgid "Delete selected item"
msgstr "Eliminar elemento seleccionado"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr "Exportar selección a archivo(s) .tab heredado(s)"
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr "Menú de pruebas para las pestañas favoritas"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr "Importar archivo(s) .tab heredado(s) según la configuración predeterminada"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Importar archivo(s) .tab heredado(s) en la posición seleccionada"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Importar archivo(s) .tab heredado(s) en la posición seleccionada"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr "Importar archivo(s) .tab heredado(s) en la posición seleccionada en un submenú"
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Insertar separador"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Insertar submenú"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION"
msgid "Open all branches"
msgstr "Expandir todo"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION"
msgid "Paste"
msgstr "Pegar"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION"
msgid "Rename"
msgstr "Renombrar"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTEVERYTHING.CAPTION"
msgid "...everything, from A to Z!"
msgstr "...todo, de la A a la Z"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP.CAPTION"
msgid "...single group of item(s) only"
msgstr "...solo grupo único de elemento(s)"
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP2.CAPTION"
msgid "Sort single group of item(s) only"
msgstr "Ordenar solo grupo único de elemento(s)"
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLESUBMENU.CAPTION"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "...contenido de submenú(s) seleccionado, sin subnivel"
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSUBMENUANDSUBLEVEL.CAPTION"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "...contenido de submenú(s) seleccionado y todos sus subniveles"
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MITESTRESULTINGFAVORITETABSMENU.CAPTION"
msgid "Test resulting menu"
msgstr "Prueba del menú resultante"
#: tfrmoptionsfileassoc.btnaddact.caption
msgid "Add"
msgstr "Añadir"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
msgid "&Add"
msgstr "&Añadir"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
msgid "A&dd"
msgstr "Añadir"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr "Clonar"
#: tfrmoptionsfileassoc.btndownact.caption
msgid "&Down"
msgstr "Abajo"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION"
msgid "Edit"
msgstr "Editar"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Insertar..."
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION"
msgid "Insert"
msgstr "Insertar..."
#: tfrmoptionsfileassoc.btnremoveact.caption
msgid "Remo&ve"
msgstr "&Eliminar"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgid "Re&move"
msgstr "&Eliminar"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
msgid "&Remove"
msgstr "&Eliminar"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "R&enombrar"
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
msgid "&Up"
msgstr "Arriba"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr "Comienzo de la ruta del comando. Nunca entrecomillar esta cadena."
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr "Nombre de la acción. Nunca se pasa al sistema, es solo un nombre nemotécnico elegido por ti y para ti."
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr "Parámetro para pasar al comando. Nombre de archivo largo con espacios debe ser entrecomillado."
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr "Comando a ejecutar. Nombre de archivo largo con espacios debe ser entrecomillado."
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr "&Descripción de la acción:"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Acciones"
#: tfrmoptionsfileassoc.gbexts.caption
msgid "Extensions"
msgstr "Extensiones"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Se puede ordenar con arrastrar y soltar"
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Tipos de archivos"
#: tfrmoptionsfileassoc.gbicon.caption
msgid "Icon"
msgstr "Icono"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Las acciones se pueden ordenar con arrastar y soltar"
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Las extensiones se pueden ordenar con arrastrar y soltar"
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Los tipos de archivos se pueden ordenar con arrastrar y soltar"
#: tfrmoptionsfileassoc.lblaction.caption
msgid "Action name:"
msgstr "Acción:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgid "&Command:"
msgstr "Co&mando:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Parámetro&s:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "&Ruta inicial:"
#: tfrmoptionsfileassoc.menuitem1.caption
msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Personalizar con..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Comando personalizado"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
msgid "Edit"
msgstr "Editar"
#: tfrmoptionsfileassoc.mieditor.caption
msgid "Open in Editor"
msgstr "Abrir en Editor"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Editar con..."
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgid "Get output from command"
msgstr "Obtener salida del comando"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Abrir con el editor interno"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Abrir con el visor interno"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
msgid "Open"
msgstr "Abrir"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Abrir con..."
#: tfrmoptionsfileassoc.miseparator.caption
msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgid "Run in terminal"
msgstr "Ejecutar en terminal"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
msgid "View"
msgstr "Vista"
#: tfrmoptionsfileassoc.miviewer.caption
msgid "Open in Viewer"
msgstr "Abrir en Visor"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Ver con..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Pulsa aquí para cambiar el icono"
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "&Ejecutar en terminal"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Menú contextual extendido"
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Configuración de asociación de archivos"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr "Ofrecer añadir la selección a asociación de archivos si no está ya incluida"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Cuando accede a la asociación de archivos, ofrece añadir el archivo seleccionado en ese momento si no está ya incluido en un tipo de archivo configurado"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "&Ejecutar en terminal y cerrar"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "&Ejecutar en terminal y mantener abierto"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Elementos de opciones extendidas:"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgid "Show confirmation window for:"
msgstr "Mostrar ventana de confirmación para:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Operac&iones de copia"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "Operaciones de &borrado"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Enviar a la papelera (la tecla de Mayúsculas invalida este ajuste)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "Op&eraciones de enviar a la papelera"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgid "D&rop readonly flag"
msgstr "Quitar ma&rca de solo lectura"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "Operaciones de &mover"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "&Procesar comentarios con archivos/carpetas"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Seleccionar al &renombrar solo el nombre del archivo, sin la extensión"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "Mostrar las pestañas del panel de destino en el diálogo «copiar/mover»"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "Sa&ltar errores en operaciones con archivos y anotarlos en la ventana de registro"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Ejecución de operaciones"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Interfaz de usuario"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "Tamaño de &memoria para operaciones con archivos (en KB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr "Tamaño del búfer para el cálculo de hash (en KB):"
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Mostrar &inicialmente las operaciones en curso en"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgid "Duplicated name auto-rename style:"
msgstr "Estilo de autorrenombrado para nombres duplicados:"
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "&Número de sobrescrituras para destruir:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Restablecer valores predeterminados de DC"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION"
msgid "Allow Overcolor"
msgstr "Permitir sobrecolor"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Usar cursor &enmarcado"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Indicador de color &degradado"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Usar color de selección inactiva"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "U&sar selección invertida"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION"
msgid "Cursor border"
msgstr "Borde del cursor"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr "Indicador de espacio libre"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "Color de fondo:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgid "Backg&round 2:"
msgstr "Color de fondo 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgid "C&ursor Color:"
msgstr "Color del c&ursor:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgid "Cursor Te&xt:"
msgstr "Te&xto en el cursor:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION"
msgid "Inactive Cursor Color:"
msgstr "Color cursor inactivo:"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION"
msgid "Inactive Mark Color:"
msgstr "Color selección inactiva:"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "Nivel de &brillo del panel inactivo"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Color segundo plano:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Color primer plano:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgid "&Mark Color:"
msgstr "Color de &selección:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "A continuación se muestra una vista previa. Puedes mover el cursor y seleccionar archivos para ver el aspecto de los distintos ajustes."
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgid "T&ext Color:"
msgstr "Color del t&exto:"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr "Al iniciar la búsqueda de archivos, borrar el filtro de máscara de archivos"
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "Bu&scar parte del nombre del archivo"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr "Mostrar la barra de menús en «Archivos encontrados»"
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr "Búsqueda de texto en archivos"
#: tfrmoptionsfilesearch.gbfilesearch.caption
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Búsqueda de archivos"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr "Filtros presentes con el botón «Búsqueda nueva»:"
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr "Plantilla de búsqueda predeterminada:"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Usar mapeado de memoria para buscar te&xto en archivos"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "&Usar cadena para buscar texto en archivos"
#: tfrmoptionsfilesviews.btnaddattribute.caption
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "&Añadir"
#: tfrmoptionsfilesviews.btnattrshelp.caption
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "A&yuda"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr "Cambiar a la carpeta superior al hacer doble clic en una zona vacía de la vista de archivos"
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "&No cargar la lista de archivos hasta que la pestaña esté activada"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "Mostrar los nombres de carpetas entre corc&hetes []"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "&Resaltar los archivos nuevos y actualizados"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Habilitar «doble clic pausado» para renombrar archivo/carpeta en el panel"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgid "Load &file list in separate thread"
msgstr "Cargar la &lista de archivos en proceso separado"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgid "Load icons af&ter file list"
msgstr "Cargar los &iconos después de la lista de archivos"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgid "Show s&ystem and hidden files"
msgstr "Mostrar archivos ocultos &y de sistema"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Al seleccionar archivos con la &barra espaciadora, bajar al archivo siguiente (como con «Insertar»)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr "Filtro al estilo de Windows cuando se marcan los archivos («*.*» también selecciona archivos sin extensión, etc.)"
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr "Utilizar cada vez un filtro de atributo independiente en el diálogo de entrada de máscara"
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Formateando"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr "Marcar/Desmarcar apuntes"
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Orden"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr "Valor predeterminado de máscara de atributo a utilizar:"
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "S&ensible a capitalización:"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Formato incorrecto"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "Formato &de fecha y hora:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Formato de &tamaño de archivo:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr "&Insertar archivos nuevos:"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "O&rden de las carpetas:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "&Método para ordenar:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr "&Mover archivos actualizados:"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "Aña&dir"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "A&plicar"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "Borrar"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
msgid "Template..."
msgstr "Plantilla..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Colores para los tipos de archivos (or&denar con arrastrar y soltar)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "A&tributos:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Co&lor:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
msgid "Category &mask:"
msgstr "&Máscara:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr "Tipo de archivo:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNPATHEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSEARCHRESULTSFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "Tipografía de la c&onsola"
#: tfrmoptionsfonts.lbleditorfont.caption
msgid "&Editor font"
msgstr "Tipografía del &editor"
#: tfrmoptionsfonts.lbllogfont.caption
msgid "&Log font"
msgstr "Tipografía del re&gistro"
#: tfrmoptionsfonts.lblmainfont.caption
msgid "Main &font"
msgstr "&Tipografía principal"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Tipografía de la &ruta del panel"
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Resultados de la búsqueda"
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgid "Viewer&Book Font"
msgstr "Tipografía de la vista de li&bro"
#: tfrmoptionsfonts.lblviewerfont.caption
msgid "&Viewer font"
msgstr "Tipografía del &visor"
#: tfrmoptionshotkeys.actaddhotkey.caption
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Añadir ata&jo"
#: tfrmoptionshotkeys.actcopy.caption
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Copiar"
#: tfrmoptionshotkeys.actdelete.caption
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Borrar"
#: tfrmoptionshotkeys.actdeletehotkey.caption
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "&Borrar atajo"
#: tfrmoptionshotkeys.actedithotkey.caption
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "&Editar atajo"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr "Categoría siguiente"
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr "Hacer emergente el menú relacionado con el archivo"
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr "Categoría anterior"
#: tfrmoptionshotkeys.actrename.caption
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Renombrar"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr "Restaurar predeterminado de DC"
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr "Guardar ahora"
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr "Ordenar por nombre de comando"
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr "Ordenar por atajo de teclado (agrupado)"
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr "Ordenar por atajo de teclado (uno por fila)"
#: tfrmoptionshotkeys.lbfilter.caption
msgid "&Filter"
msgstr "&Filtro"
#: tfrmoptionshotkeys.lblcategories.caption
msgid "C&ategories:"
msgstr "C&ategorías:"
#: tfrmoptionshotkeys.lblcommands.caption
msgid "Co&mmands:"
msgstr "Co&mandos:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgid "&Shortcut files:"
msgstr "Archivo&s de atajos:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr "O&rdenación:"
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr "Categorías"
#: tfrmoptionshotkeys.micommands.caption
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Comando"
#: tfrmoptionshotkeys.miseparator1.caption
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr "Ordenación"
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Para las rutas siguientes y sus subcarpetas:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Mostrar iconos para acciones en &menús"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr "Mostrar iconos en botones"
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgid "Show o&verlay icons, e.g. for links"
msgstr "Mostrar &iconos superpuestos (por ejemplo, para enlaces)"
#: tfrmoptionsicons.chkshowhiddendimmed.caption
msgid "&Dimmed hidden files (slower)"
msgstr ""
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Deshabilitar iconos especiales"
#: tfrmoptionsicons.gbiconssize.caption
msgid " Icon size "
msgstr " Tamaño de los iconos "
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr "Tema de icono"
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr "Mostrar iconos"
#: tfrmoptionsicons.gbshowiconsmode.caption
msgid " Show icons to the left of the filename "
msgstr " Mostrar iconos a la izquierda del nombre del archivo "
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr "Panel de discos:"
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr "Panel de archivos:"
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
msgid "A&ll"
msgstr "&Todo"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgid "All associated + &EXE/LNK (slow)"
msgstr "Todo lo asociado + &EXE/LNK (lento)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgid "&No icons"
msgstr "Si&n iconos"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgid "Only &standard icons"
msgstr "Solo iconos e&stándar"
#: tfrmoptionsignorelist.btnaddsel.caption
msgid "A&dd selected names"
msgstr "Aña&dir nombres seleccionados"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgid "Add selected names with &full path"
msgstr "Añadir nombres seleccionados con &ruta completa"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccionar la ruta apropiada"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignorar (no mostrar) los archivos y carpetas siguientes:"
#: tfrmoptionsignorelist.lblsavein.caption
msgid "&Save in:"
msgstr "&Guardar en:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Las &flechas izquierda y derecha cambian de carpeta (como Lynx)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Tecleado"
#: tfrmoptionskeyboard.lblalt.caption
msgid "Alt+L&etters:"
msgstr "Alt+L&etras:"
#: tfrmoptionskeyboard.lblctrlalt.caption
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+Le&tras:"
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "&Letras:"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr "&Botones planos"
#: tfrmoptionslayout.cbflatinterface.caption
msgid "Flat i&nterface"
msgstr "&Interfaz plana"
#: tfrmoptionslayout.cbflattoolbar.caption
msgid "Flat b&uttons"
msgstr "Bo&tones planos"
#: tfrmoptionslayout.cbfreespaceind.caption
msgid "Show fr&ee space indicator on drive label"
msgstr "Mostrar i&ndicador de espacio libre en la etiqueta de unidad"
#: tfrmoptionslayout.cblogwindow.caption
msgid "Show lo&g window"
msgstr "&Mostrar la ventana de registro"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgid "Show panel of operation in background"
msgstr "Mostrar el panel de operaciones en seg&undo plano"
#: tfrmoptionslayout.cbproginmenubar.caption
msgid "Show common progress in menu bar"
msgstr "Mostrar el progreso com&ún en la barra de menús"
#: tfrmoptionslayout.cbshowcmdline.caption
msgid "Show command l&ine"
msgstr "Mostrar la línea de co&mandos"
#: tfrmoptionslayout.cbshowcurdir.caption
msgid "Show current director&y"
msgstr "Mostrar barra de nave&gación"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgid "Show &drive buttons"
msgstr "Mostrar &botones de unidades"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgid "Show free s&pace label"
msgstr "Mostrar et&iqueta de espacio libre"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Mostrar &el botón de lista de unidades"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgid "Show function &key buttons"
msgstr "Mostrar los botones de teclas de &función"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgid "Show &main menu"
msgstr "M&ostrar menú principal"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgid "Show tool&bar"
msgstr "Mo&strar barra de herramientas"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Mostrar eti&queta corta de espacio libre"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgid "Show &status bar"
msgstr "Mostrar &la barra de estado"
#: tfrmoptionslayout.cbshowtabheader.caption
msgid "S&how tabstop header"
msgstr "Mostrar los encabe&zados de columnas"
#: tfrmoptionslayout.cbshowtabs.caption
msgid "Sho&w folder tabs"
msgstr "Mostrar pesta&ñas de carpetas"
#: tfrmoptionslayout.cbtermwindow.caption
msgid "Show te&rminal window"
msgstr "Mostrar la &ventana de terminal"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Mostrar &dos barras de botones de unidad (ancho fijo, sobre la lista de archivos)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgid " Screen layout "
msgstr " Apariencia de pantalla "
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccionar la ruta apropiada"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Ver el contenido del archivo registro"
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Incluir fecha en el archivo de registro"
#: tfrmoptionslog.cblogarcop.caption
msgid "&Pack/Unpack"
msgstr "Co&mprimir/Descomprimir"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Ejecución en línea de comandos externa"
#: tfrmoptionslog.cblogcpmvln.caption
msgid "Cop&y/Move/Create link/symlink"
msgstr "Cop&iar/Mover/Crear enlace/Enlace simbólico"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "E&liminar"
#: tfrmoptionslog.cblogdirop.caption
msgid "Crea&te/Delete directories"
msgstr "Crear/Eliminar carpe&tas"
#: tfrmoptionslog.cblogerrors.caption
msgid "Log &errors"
msgstr "Registrar &errores"
#: tfrmoptionslog.cblogfile.caption
msgid "C&reate a log file:"
msgstr "C&rear archivo de registro:"
#: tfrmoptionslog.cbloginfo.caption
msgid "Log &information messages"
msgstr "Registrar mensajes de &información"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Encendido/apa&gado"
#: tfrmoptionslog.cblogsuccess.caption
msgid "Log &successful operations"
msgstr "Registrar operaciones exito&sas"
#: tfrmoptionslog.cblogvfs.caption
msgid "&File system plugins"
msgstr "Co&mplementos del sistema de archivos"
#: tfrmoptionslog.gblogfile.caption
msgid "File operation log file"
msgstr "Archivo de registro de operaciones con archivos"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Registro de operaciones"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Estado de la operación"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccionar la ruta apropiada"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccionar la ruta apropiada"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccionar la ruta apropiada"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "Bo&rrar miniaturas de archivos que ya no existen"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
msgid "View log file content"
msgstr "Ver contenido del archivo registro"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION"
msgid "Create new with the encoding:"
msgstr "Crear nuevo con la codificación:"
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Ir siempre a la carpeta raíz de la unidad al cambiar de unidad"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Mostrar mensa&jes de advertencia (solo botón «Aceptar»)"
#: tfrmoptionsmisc.chkthumbsave.caption
msgid "&Save thumbnails in cache"
msgstr "Guardar miniatura&s en caché"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Miniaturas"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr "Comentarios del archivo (descript.ion)"
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "Relacionado a TC exportar/importar:"
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION"
msgid "Default encoding:"
msgstr "Codificación predeterminada:"
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Archivo de configuración:"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "Ejecutable de TC:"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Ruta de salida de la barra de herramientas:"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "píxeles"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr "X"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Tamaño de miniaturas:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Selección por ratón"
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
msgid "By clic&king on icon"
msgstr ""
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Desplazamiento"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Selección"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Modo:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "Número de &líneas"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Línea a línea con el &movimiento del cursor"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Página a página"
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "Aña&dir"
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "Con&figurar"
#: tfrmoptionsplugins.btnenableplugin.caption
msgid "E&nable"
msgstr "&Habilitar"
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "&Eliminar"
#: tfrmoptionsplugins.btntweakplugin.caption
msgid "&Tweak"
msgstr "Ajus&te avanzado"
#: tfrmoptionsplugins.lbldsxdescription.caption
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Los complementos de búsqueda permiten el uso de algoritmos de búsqueda alternativos o herramientas externas (como «locate», etc.)"
#: tfrmoptionsplugins.lblwcxdescription.caption
msgid "Pack&er plugins are used to work with archives"
msgstr "Los compl&ementos de compresión son usados para trabajar con ficheros"
#: tfrmoptionsplugins.lblwdxdescription.caption
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Los complementos de contenido permiten mostrar detalles extendidos de archivos: etiquetas mp3, atributos de imagen (en listas de archivos); o pueden usarse en las búsquedas o en renombrado múltiple"
#: tfrmoptionsplugins.lblwfxdescription.caption
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Los complementos «Sistema de archivos» permiten acceder a discos inaccesibles por el sistema operativo o a aparatos externos como Palm/PocketPC."
#: tfrmoptionsplugins.lblwlxdescription.caption
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Los complementos de visualización permiten mostrar formatos de archivos como imágenes, base de datos, etc., en Visor (F3, Ctrl+Q)"
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr "Activo"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr "Complemento"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr "Registrado por"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr "Nombre del archivo"
#: tfrmoptionsplugins.tsdsx.caption
msgid "&Search plugins (.DSX)"
msgstr "Bú&squeda (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
msgid "Pac&ker plugins (.WCX)"
msgstr "Co&mpresión (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
msgid "Content pl&ugins (.WDX)"
msgstr "&Contenido (.WDX)"
#: tfrmoptionsplugins.tswfx.caption
msgid "F&ile system plugins (.WFX)"
msgstr "S&istema de archivos (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
msgid "&Viewer plugins (.WLX)"
msgstr "&Visualización (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgid "&Beginning (name must start with first typed character)"
msgstr "Ini&cio (el nombre debe empezar con el primer carácter tecleado)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgid "En&ding (last character before a typed dot . must match)"
msgstr "Fi&nal (debe coincidir el último carácter antes del punto '.')"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Opciones"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Coincidencia exacta de nombre"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Buscar por capitalización"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Buscar por estos elementos"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Mantener el renombrado cuando se desbloquee una pestaña"
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Activar el pa&nel de destino al pulsar en una de sus pestañas"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgid "&Show tab header also when there is only one tab"
msgstr "Mo&strar pestañas también cuando haya una sola"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Cerrar las pestañas duplicadas cuando se cierre la aplicación"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgid "Con&firm close all tabs"
msgstr "Con&firmación para cerrar todas las pestañas"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Confirmación para cerrar las pestañas &bloqueadas"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr "&Limitar la longitud del título a:"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgid "Show locked tabs &with an asterisk *"
msgstr "Mostrar &bloqueo con un asterisco *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgid "&Tabs on multiple lines"
msgstr "Pes&tañas en varias líneas"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+Arriba abre una pestaña nueva en primer plano"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgid "Open &new tabs near current tab"
msgstr "Abrir las pestañas nuevas al lado de la actual"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Reutilizar la pestaña existente cuando sea posible"
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgid "Show ta&b close button"
msgstr "Mostrar &botón de cierre de pestaña"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Siempre mostrar letra de unidad en el título de la pestaña"
#: tfrmoptionstabs.gbtabs.caption
msgid "Folder tabs headers"
msgstr "Cabecera de las pestañas"
#: tfrmoptionstabs.lblchar.caption
msgid "characters"
msgstr "caracteres"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Acción a realizar al hacer doble clic en una pestaña:"
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr "Posición de las pestañas"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTEXISTINGTABSTOKEEP.TEXT"
msgid "None"
msgstr "Ninguna"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTSAVEDIRHISTORY.TEXT"
msgid "No"
msgstr "No"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELLEFTSAVED.TEXT"
msgid "Left"
msgstr "&Izquierda"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELRIGHTSAVED.TEXT"
msgid "Right"
msgstr "De&recha"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr "Ir a configuración de pestañas favoritas tras reguardar"
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr "Ir a configuración de pestañas favoritas tras guardar una"
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr "Habilitar opciones extra de pestañas favoritas (seleccionar lado activo cuando restaure, etc.)"
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr "Configuración extra predeterminada cuando se guarden nuevas pestañas favoritas:"
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr "Encabezados de pestañas extra"
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr "Al restaurar pestaña, pestañas existentes que deben mantenerse:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr "Pestañas guardadas a la izquierda se restaurarán en:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr "Pestañas guardadas a la derecha se restaurarán en:"
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Guardar historial de direcciones con pestañas favoritas:"
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr "Posición predeterminada en el menú cuando guarde nuevas pestañas favoritas:"
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{comando] normalmente debería estar presente aquí para mostrar el comando a ejecutar en el terminal"
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{comando] normalmente debería estar presente aquí para mostrar el comando a ejecutar en el terminal"
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{comando] normalmente debería estar presente aquí para mostrar el comando a ejecutar en el terminal"
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Comando para ejecutar solo en terminal:"
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Comando para ejecutar una orden en terminal y cerrar después:"
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Comando para ejecutar una orden en terminal y mantener abierto:"
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parámetros:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parámetros:"
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION"
msgid "Command:"
msgstr "Comando:"
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION"
msgid "Parameters:"
msgstr "Parámetros:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "C&lonar botón"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "&Borrar"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgid "Edit hot&key"
msgstr "Editar ata&jo"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgid "&Insert new button"
msgstr "Botón nue&vo"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Seleccionar"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "&Otro..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr "Borrar atajo"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Consejo"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
"DC sugiere información sobre herramientas en función\n"
"del tipo de botón, comando y parámetros\n"
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "TFRMOPTIONSTOOLBAR.CBFLATBUTTONS.CAPTION"
msgid "&Flat buttons"
msgstr "&Botones planos"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Informar de errores con comandos"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr ""
"Introducir parámetros de comando, cada uno en línea separada.\n"
"Presiona F1 para ver ayuda sobre parámetros.\n"
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Apariencia"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "Tamaño de &barra:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgid "Comman&d:"
msgstr "Coman&do:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Parámetro&s:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION"
msgid "Help"
msgstr "Ayuda"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Atajo:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "Ico&no:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Tamaño de ic&ono:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgid "Co&mmand:"
msgstr "Co&mando:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgid "&Parameters:"
msgstr "&Parámetros:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLSTARTPATH.CAPTION"
msgid "Start pat&h:"
msgstr "&Ruta inicial:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "A&yuda:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "Añadir barra con TODOS los comandos de DC"
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "para un comando externo"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "para un comando interno"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "para un separador"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "para subbarra de herramientas"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION"
msgid "Backup..."
msgstr "Respaldo..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION"
msgid "Export..."
msgstr "Exportar..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Barra de herramientas actual..."
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
msgid "to a Toolbar File (.toolbar)"
msgstr "a un archivo de barra (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
msgid "to a TC .BAR file (keep existing)"
msgstr "a un archivo TC.BAR (mantener existente)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
msgid "to a TC .BAR file (erase existing)"
msgstr "a un archivo TC.BAR (borrar existente)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "a «wincmd.ini» de TC (mantener existente)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "a «wincmd.ini» de TC (borrar existente)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Barra de herramientas..."
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Guardar un respaldo de la barra"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "a un archivo de barra (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "a un archivo TC.BAR (mantener existente)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "a un archivo TC.BAR (borrar existente)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "a «wincmd.ini» de TC (mantener existente)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "a «wincmd.ini» de TC (borrar existente)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "después de la selección actual"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "como primer elemento"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "como último elemento"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "antes de la selección actual"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION"
msgid "Import..."
msgstr "Importar..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Restablecer un respaldo de la barra"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "añadir a la barra actual"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "añadir una barra nueva a la barra actual"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "añadir una barra nueva a la barra superior"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "añadir a la barra superior"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "para reemplazar la barra superior"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "desde un archivo de barra (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "añadir a la barra actual"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "añadir una barra nueva a la barra actual"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "añadir una barra nueva a la barra superior"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "añadir a la barra superior"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "para reemplazar la barra superior"
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "desde un archivo TC .BAR"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "añadir a la barra actual"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "añadir una barra nueva a la barra actual"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "añadir una barra nueva a la barra superior"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "añadir a la barra superior"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "para reemplazar la barra superior"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "desde «wincmd.ini» de TC..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr "añadir a la barra actual"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr "añadir una barra nueva a la barra actual"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr "añadir una barra nueva a la barra superior"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr "para añadir a la barra superior"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr "para reemplazar la barra superior"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "después de la selección actual"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "como primer elemento"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "como último elemento"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "antes de la selección actual"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION"
msgid "Search and replace..."
msgstr "Buscar y reemplazar..."
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "después de la selección actual"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "como primer elemento"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "como último elemento"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "antes de la selección actual"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "en todas de todo lo anterior..."
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "en todos los comandos..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "en todos los nombres de iconos..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "en todos los parámetros..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "en todas las rutas de inicio..."
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr "después de la selección actual"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr "como primer elemento"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
msgid "as last element"
msgstr "como último elemento"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr "antes de la selección actual"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Tipo de botón"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccionar la ruta apropiada"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "&Mantener abierta la ventana del terminal después de ejecutar el programa"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "&Ejecutar en terminal"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "&Usar programa externo"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "Parámetros a&dicionales"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "&Ruta del programa a ejecutar"
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "Aña&dir"
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "A&plicar"
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "&Borrar"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Plantilla..."
#: tfrmoptionstooltips.chkshowtooltip.caption
msgid "&Show tooltip for files in the file panel"
msgstr "Mostrar información emergente para los archivos del panel"
#: tfrmoptionstooltips.gbcustomfields.caption
msgid "Custom fields by file type"
msgstr "Campos personalizados por tipo de archivo"
#: tfrmoptionstooltips.lblfieldslist.caption
msgid "Category &hint:"
msgstr "Tipo de a&yuda:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Máscara:"
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "&Nombre:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr "Con doble clic en la barra sobre el panel de archivos"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr "Con el menú y comando interno"
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr "Doble clic en el árbol selecciona y sale"
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION"
msgid "With the menu and internal command"
msgstr "Con el menú y comando interno"
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr "Con doble clic en una pestaña (si está configurado para ello)"
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr "Al usar el atajo de teclado, saldrá de la ventana volviendo a la opción actual"
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr "Un clic de ratón en el árbol selecciona y sale"
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr "Utilizarlo para el historial de la línea de comandos"
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr "Utilizarlo para el historial de direcciones"
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr "Utilizarlo para el historial de vistos (rutas visitadas de la vista activa)"
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr "Comportamiento respecto a la selección:"
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr "Opciones de menú de la vista de árbol:"
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr "Dónde usar los menús de la vista de árbol:"
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr "*NOTA: Respecto a opciones como sensibilidad a capitalización, ignorar acentos o no, se guardarán y restaurarán individualmente para cada contexto de uso y de una sesión a otra."
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr "Con marcadores:"
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr "Con pestañas favoritas:"
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr "Con historial:"
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr "Usar y mostrar atajos de teclado para seleccionar elementos"
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr "Diseño y opciones de colores:"
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Color de fondo:"
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Color del cursor:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr "Color del texto buscado:"
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr "Color del texto buscado bajo el cursor:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr "Color del texto normal:"
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr "Color del texto normal bajo el cursor:"
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Vista previa del menú de la vista de árbol:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr "Color secundario del texto:"
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr "Color secundario del texto bajo el cursor:"
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Color de acceso directo:"
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr "Acceso directo bajo el cursor:"
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr "Color del texto no seleccionable:"
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr "Color de no seleccionable bajo el cursor:"
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr "Cambia de color en la izquierda y verás aquí un ejemplo de cómo se verán los menús de la vista de árbol con la nueva configuración."
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Visualizar en modo libro"
#: tfrmoptionsviewer.gbviewerexample.caption
msgid "Example"
msgstr "Ejemplo"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "Color de fondo en vista de libro"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "Color de &tipografía en vista de libro"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "&Nº de columnas en vista de libro"
#: tfrmpackdlg.btnconfig.caption
msgctxt "tfrmpackdlg.btnconfig.caption"
msgid "Con&figure"
msgstr "Con&figurar"
#: tfrmpackdlg.caption
msgid "Pack files"
msgstr "Comprimir archivos"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "C&rear ficheros distintos, uno por cada elemento seleccionado"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Crear fichero autoe&xtraíble"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "Ci&frar"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Mo&ver al fichero"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "Fichero de discos &múltiples"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "Poner primero en fichero TAR"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Co&mprimir también nombres de rutas (solo recursivo)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Comprimir en el archivo:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Compresor"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Cerrar"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Descomprimir todo y ejecut&ar"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "Descomprimir y ejec&utar"
#: tfrmpackinfodlg.caption
msgid "Properties of packed file"
msgstr "Propiedades del archivo comprimido"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Atributos:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Tasa de compresión:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Fecha:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Método:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Tamaño original:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Archivo:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Tamaño comprimido:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Compresor:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Tiempo:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "X"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Cerrar panel de filtro"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Introducir texto a buscar o filtro"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Sensible a capitalización"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "C"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "TFRMQUICKSEARCH.SBDIRECTORIES.HINT"
msgid "Directories"
msgstr "Carpetas"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "A"
#: tfrmquicksearch.sbfiles.hint
msgctxt "TFRMQUICKSEARCH.SBFILES.HINT"
msgid "Files"
msgstr "Archivos"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Coincidir al comienzo"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Coincidir al final"
#: tfrmquicksearch.tglfilter.caption
msgid "Filter"
msgstr "Filtro"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Conmutar entre búsqueda o filtro"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "&Más reglas"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "M&enos reglas"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Usar plugins de &contenido, combinado con:"
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
msgid "Plugin"
msgstr "Complemento"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Campo"
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Operador"
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Valor"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&AND (toda coincidencia)"
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&OR (cualquier coincidencia)"
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "&Cerrar"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "A&yuda"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "&Seleccionar los caracteres a insertar:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmsetfileproperties.caption
msgid "Change attributes"
msgstr "Cambiar atributos"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Sticky"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgid "Archive"
msgstr "Archivo"
#: tfrmsetfileproperties.chkcreationtime.caption
msgid "Created:"
msgstr "Creado:"
#: tfrmsetfileproperties.chkhidden.caption
msgid "Hidden"
msgstr "Oculto"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Accedido:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Modificado:"
#: tfrmsetfileproperties.chkreadonly.caption
msgid "Read only"
msgstr "Solo lectura"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Incluyendo subcarpetas"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "tfrmsetfileproperties.chksystem.caption"
msgid "System"
msgstr "Sistema"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Propiedades de la versión más actual"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributos"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Atributos"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grupo"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(campo gris significa valor sin cambio)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Otros"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Propietario"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Texto:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Ejecución"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION"
msgid "(gray field means unchanged value)"
msgstr "(campo gris significa valor sin cambio)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Octal"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lectura"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Escritura"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
msgid "Some functions to select appropriate path"
msgstr "Algunas funciones para seleccioanr ruta apropiada"
#: tfrmsplitter.caption
msgid "Splitter"
msgstr "Divisor"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Requiere un archivo de verificación CRC32"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Nombre del archivo"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Tamaño y número de partes"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "Carpeta des&tino"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Archivo ori&gen"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "&Número de partes"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Bytes"
#: tfrmsplitter.rbtngigab.caption
msgid "&Gigabytes"
msgstr "&Gigabytes"
#: tfrmsplitter.rbtnkilob.caption
msgid "&Kilobytes"
msgstr "&Kilobytes"
#: tfrmsplitter.rbtnmegab.caption
msgid "&Megabytes"
msgstr "&Megabytes"
#: tfrmstartingsplash.caption
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
msgid "Build"
msgstr "Hecho"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
msgid "Free Pascal"
msgstr "Free Pascal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Sistema Operativo"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Plataforma"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revisión"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr "Versión"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr "Versión de Widget"
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Crear enlace simbólico"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Destino a donde apuntará el enlace"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Nombre del en&lace"
#: tfrmsyncdirsdlg.actselectclear.caption
msgid "Remove selection"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopydefault.caption
msgid "Select for copying (default direction)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
msgid "Select for copying -> (left to right)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
msgid "Reverse copy direction"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
msgid "Select for copying <- (right to left)"
msgstr ""
#: tfrmsyncdirsdlg.actselectdeleteright.caption
msgid "Select for deleting -> (right)"
msgstr ""
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr "Cerrar"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr "Comparar"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Sincronizar"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Sincronizar directorios"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "asimétrico"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "por contenido"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "ignorar fecha"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "solo seleccionado"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Subcarpetas"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Mostrar:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
msgid "Name"
msgstr "Nombre"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
msgid "Size"
msgstr "Tamaño"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
msgid "Date"
msgstr "Fecha"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
msgid "Date"
msgstr "Fecha"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
msgid "Size"
msgstr "Tamaño"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
msgid "Name"
msgstr "Nombre"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(en la ventana principal)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
msgid "Compare"
msgstr "Comparar"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Mostrar izquierdo"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Mostrar derecho"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "duplicados"
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "simples"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Por favor, presiona «Comparar» para comenzar"
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr "Sincronizar"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Confirmar sobrescritura"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Menús de la vista de árbol"
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr "Selecciona tu marcador:"
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr "La búsqueda es sensible a capitalización"
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr "Contraer todo"
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr "Expandir todo"
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr "La búsqueda ignora acentos y ligaduras"
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr "La búsqueda no es sensible a capitalización"
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr "La búsqueda es estricta en cuanto a acentos y ligaduras"
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr "No mostrar el contenido de una rama \"solo\" porque la cadena de búsqueda se encuentra en el nombre de una rama"
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr "Si se encuentra en una cadena de búsqueda el nombre de la rama, mostrar toda la rama incluso si los elementos no coinciden"
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr "Cierra el menú de la vista de árbol"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT"
msgid "Configuration of Tree View Menu"
msgstr "Configuración del menú de la vista de árbol"
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT"
msgid "Configuration of Tree View Menu Colors"
msgstr "Configuración del menú de colores de la vista de árbol"
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "Aña&dir nuevo"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Cancelar"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "Cam&biar"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Por de&fecto"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&Aceptar"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "&Eliminar"
#: tfrmtweakplugin.caption
msgid "Tweak plugin"
msgstr "Ajuste avanzado"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "De&tectar tipo de fichero por contenido"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Puede &borrar archivos"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Soporta ci&frado"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "Mostrar como archivos normales (ocultar icono de compresión)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Soporta co&mpresión en memoria"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Puede &modificar los ficheros existentes"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "El &fichero puede contener múltiples archivos"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Puede crear nue&vos ficheros"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "&Soporta la ventana de diálogo con opciones"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Permitir búsqueda de texto en ficheros"
#: tfrmtweakplugin.lbldescription.caption
msgid "&Description:"
msgstr "&Descripción:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "D&etectar cadena:"
#: tfrmtweakplugin.lblextension.caption
msgid "&Extension:"
msgstr "&Extensión:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Opciones:"
#: tfrmtweakplugin.lblname.caption
msgctxt "tfrmtweakplugin.lblname.caption"
msgid "&Name:"
msgstr "&Nombre:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "tfrmtweakplugin.lblplugin.caption"
msgid "&Plugin:"
msgstr "Co&mplemento:"
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "Co&mplemento:"
#: tfrmviewer.actabout.caption
msgid "About Viewer..."
msgstr "Acerca del Visor..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Mostrar el mensaje «Acerca de...»"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr "Cambiar codificación"
#: tfrmviewer.actcopyfile.caption
msgctxt "tfrmviewer.actcopyfile.caption"
msgid "Copy File"
msgstr "Copiar archivo"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Copiar archivo"
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "TFRMVIEWER.ACTCOPYTOCLIPBOARD.CAPTION"
msgid "Copy To Clipboard"
msgstr "Copiar al portapapeles"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr "Copiar al portapapeles con formato"
#: tfrmviewer.actdeletefile.caption
msgctxt "tfrmviewer.actdeletefile.caption"
msgid "Delete File"
msgstr "Eliminar archivo"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Eliminar archivo"
#: tfrmviewer.actexitviewer.caption
msgctxt "TFRMVIEWER.ACTEXITVIEWER.CAPTION"
msgid "E&xit"
msgstr "Salir"
#: tfrmviewer.actfind.caption
msgctxt "TFRMVIEWER.ACTFIND.CAPTION"
msgid "Find"
msgstr "Buscar"
#: tfrmviewer.actfindnext.caption
msgctxt "TFRMVIEWER.ACTFINDNEXT.CAPTION"
msgid "Find next"
msgstr "Buscar siguiente"
#: tfrmviewer.actfindprev.caption
msgctxt "TFRMVIEWER.ACTFINDPREV.CAPTION"
msgid "Find previous"
msgstr "Buscar anterior"
#: tfrmviewer.actfullscreen.caption
msgctxt "TFRMVIEWER.ACTFULLSCREEN.CAPTION"
msgid "Full Screen"
msgstr "Pantalla completa"
#: tfrmviewer.actimagecenter.caption
msgid "Center"
msgstr "Centrar"
#: tfrmviewer.actloadnextfile.caption
msgid "&Next"
msgstr "&Siguiente"
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Cargar archivo siguiente"
#: tfrmviewer.actloadprevfile.caption
msgid "&Previous"
msgstr "&Anterior"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Cargar archivo anterior"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr "Reflejar horizontalmente"
#: tfrmviewer.actmirrorhorz.hint
msgid "Mirror"
msgstr "Reflejar"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr "Reflejar verticalmente"
#: tfrmviewer.actmovefile.caption
msgctxt "tfrmviewer.actmovefile.caption"
msgid "Move File"
msgstr "Mover archivo"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Mover archivo"
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Vista previa"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Recargar"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Recargar el archivo actual"
#: tfrmviewer.actrotate180.caption
msgid "+ 180"
msgstr "+ 180"
#: tfrmviewer.actrotate180.hint
msgid "Rotate 180 degrees"
msgstr "Girar 180 grados"
#: tfrmviewer.actrotate270.caption
msgid "- 90"
msgstr "- 90"
#: tfrmviewer.actrotate270.hint
msgid "Rotate -90 degrees"
msgstr "Girar -90 grados"
#: tfrmviewer.actrotate90.caption
msgid "+ 90"
msgstr "+ 90"
#: tfrmviewer.actrotate90.hint
msgid "Rotate +90 degrees"
msgstr "Girar +90 grados"
#: tfrmviewer.actsave.caption
msgctxt "TFRMVIEWER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Guardar"
#: tfrmviewer.actsaveas.caption
msgid "Save As..."
msgstr "Guardar como..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Guardar archivo como..."
#: tfrmviewer.actscreenshot.caption
msgctxt "TFRMVIEWER.ACTSCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Captura de pantalla"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "Retrasar 3 seg"
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "Retrasar 5 sec"
#: tfrmviewer.actselectall.caption
msgctxt "TFRMVIEWER.ACTSELECTALL.CAPTION"
msgid "Select All"
msgstr "Seleccionar todo"
#: tfrmviewer.actshowasbin.caption
msgid "Show as &Bin"
msgstr "Mostrar como &binario"
#: tfrmviewer.actshowasbook.caption
msgid "Show as B&ook"
msgstr "Mostrar como libr&o"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr "Mostrar como &decimal"
#: tfrmviewer.actshowashex.caption
msgid "Show as &Hex"
msgstr "Mostrar como &hexadecimal"
#: tfrmviewer.actshowastext.caption
msgid "Show as &Text"
msgstr "Mostrar como &texto"
#: tfrmviewer.actshowaswraptext.caption
msgid "Show as &Wrap text"
msgstr "Ajustar texto"
#: tfrmviewer.actshowgraphics.caption
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Gráficos"
#: tfrmviewer.actshowplugins.caption
msgctxt "TFRMVIEWER.ACTSHOWPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Complementos"
#: tfrmviewer.actstretchimage.caption
msgid "Stretch"
msgstr "Ajustar"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Ajustar imagen"
#: tfrmviewer.actstretchonlylarge.caption
msgid "Stretch only large"
msgstr "Ajustar sólo grandes"
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Zoom"
#: tfrmviewer.actzoomin.caption
msgid "Zoom In"
msgstr "Acercar"
#: tfrmviewer.actzoomout.caption
msgid "Zoom Out"
msgstr "Alejar"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Copiar"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Copiar"
#: tfrmviewer.btncuttuimage.hint
msgid "Crop"
msgstr "Recortar"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Eliminar"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Eliminar"
#: tfrmviewer.btnfullscreen.hint
msgctxt "tfrmviewer.btnfullscreen.hint"
msgid "Full Screen"
msgstr "Pantalla completa"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Resaltar"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Mover"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Mover"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Dibujar"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Ojos rojos"
#: tfrmviewer.btnresize.hint
msgid "Resize"
msgstr "Redimensionar"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Deshacer"
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Visor"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Diapositivas"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Lápiz"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "tfrmviewer.gboxhightlight.caption"
msgid "Highlight"
msgstr "Resaltar"
#: tfrmviewer.gboxpaint.caption
msgctxt "tfrmviewer.gboxpaint.caption"
msgid "Paint"
msgstr "Pintar"
#: tfrmviewer.gboxslideshow.caption
msgctxt "tfrmviewer.gboxslideshow.caption"
msgid "Slide Show"
msgstr "Diapositivas"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Ver"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "Acerca de..."
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Editar"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Codificar"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Archivo"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Imagen"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Imprimir..."
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Girar"
#: tfrmviewer.miscreenshot.caption
msgctxt "tfrmviewer.miscreenshot.caption"
msgid "Screenshot"
msgstr "Captura"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Ver"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Seleccionar todo"
#: tfrmviewoperations.btnstartpause.caption
#, fuzzy
msgctxt "tfrmviewoperations.btnstartpause.caption"
msgid "&Start"
msgstr "Comen&zar"
#: tfrmviewoperations.btnstop.caption
msgid "S&top"
msgstr ""
#: tfrmviewoperations.caption
#, fuzzy
msgctxt "tfrmviewoperations.caption"
msgid "File operations"
msgstr "Operaciones con archivos"
#: tfrmviewoperations.cbalwaysontop.caption
msgid "Always on top"
msgstr ""
#: tfrmviewoperations.lblusedragdrop.caption
msgid "&Use \"drag && drop\" to move operations between queues"
msgstr ""
#: tfrmviewoperations.mnucanceloperation.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmviewoperations.mnucancelqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
msgid "Cancel"
msgstr "Cancelar"
#: tfrmviewoperations.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnunewqueue.caption"
msgid "New queue"
msgstr "Cola nueva"
#: tfrmviewoperations.mnuoperationshowdetached.caption
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.mnuputfirstinqueue.caption
msgid "Put first in queue"
msgstr ""
#: tfrmviewoperations.mnuputlastinqueue.caption
msgid "Put last in queue"
msgstr ""
#: tfrmviewoperations.mnuqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue.caption"
msgid "Queue"
msgstr "En cola"
#: tfrmviewoperations.mnuqueue0.caption
msgid "Out of queue"
msgstr ""
#: tfrmviewoperations.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Cola 1"
#: tfrmviewoperations.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Cola 2"
#: tfrmviewoperations.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Cola 3"
#: tfrmviewoperations.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Cola 4"
#: tfrmviewoperations.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Cola 5"
#: tfrmviewoperations.mnuqueueshowdetached.caption
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.tbpauseall.caption
msgid "&Pause all"
msgstr ""
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Si el archivo ya existe"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Si el archivo ya existe"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION"
msgid "Copy d&ate/time"
msgstr "Copiar fech&a/hora"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Trabajar en segundo plano (conexión separada)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Si el archivo ya existe"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr "Fecha de la toma"
#: uexifreader.rsimageheight
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Altura"
#: uexifreader.rsimagewidth
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Anchura"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr "Fabricante"
#: uexifreader.rsmodel
msgid "Camera model"
msgstr "Modelo de la cámara"
#: uexifreader.rsorientation
msgid "Orientation"
msgstr "Orientación"
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
"Este archivo no se puede encontrar y podría ayudar a validar la combinación final de los archivos:\n"
"%s\n"
"¿Podrías hacerlo disponible y presionar «Aceptar» cuando esté listo,\n"
"o presionar «Cancelar» para continuar sin él?\n"
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Cancelar filtro rápido"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Cancelar operación en curso"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Introduce el nombre de archivo, con extensión, para soltar texto"
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Formato de texto a importar"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Dañados:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Resultado:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Perdidos:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Errores de lectura:"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Correctos:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Introduce suma de verificación y selecciona algoritmo:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Comprobar suma de verificación"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Total:"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr "¿Quieres borrar los filtros para esta nueva búsqueda?"
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "El portapapeles no contiene ningún dato de herramienta válido"
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr "Todo;Panel activo;Panel izquierdo;Panel derecho;Operaciones con archivos;Configuración;Red;Miscelánea;Puerto paralelo;Imprimir;Selección;Seguridad;Portapapeles;FTP;Navegación;Ayuda;Ventana;Línea de comandos;Herramientas;Vista;Usuario;Pestañas;Ordenar;Registro"
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr "Orden heredado;Orden A-Z"
#: ulng.rscolattr
msgid "Attr"
msgstr "Atributos"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Fecha"
#: ulng.rscolext
msgid "Ext"
msgstr "Ext"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Nombre"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Tamaño"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Alinear"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Texto"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Borrar"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Contenido del campo"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Mover"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Ancho"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Columna personalizada"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Configurar asociaciones de archivos"
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "Confirmación de línea de comandos y parámetros"
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Copiar (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Barra de herramientas DC importada"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Barra de herramientas TC importada"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "_TextoSoltado"
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "_TextoHTMLSoltado"
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "_TextoEnriquecidoSoltado"
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "_TextoSimpleSoltado"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "_TextoUnicodeUTF16Soltado"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "TextoUnicodeUTF8Soltado"
#: ulng.rsdiffadds
msgid " Adds: "
msgstr " Añadidos: "
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr " Eliminados: "
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "¡Los dos archivos son idénticos!"
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr " Coincidentes: "
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr " Modificados: "
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "In&terrumpir"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "&Todos"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Añadir"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "A&utorrenombrar archivos origen"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Cancelar"
#: ulng.rsdlgbuttoncompare
msgid "Compare &by content"
msgstr ""
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Continuar"
#: ulng.rsdlgbuttoncopyinto
msgid "&Merge"
msgstr "&Mezclar"
#: ulng.rsdlgbuttoncopyintoall
msgid "Mer&ge All"
msgstr "Me&zclar todo"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "&Salir del programa"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr "Ig&norar"
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "I&gnorar todo"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&No"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "&Ninguno"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&Aceptar"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "Ot&ras alternativas"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "S&obrescribir"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Sobrescribir &todo"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Sobrescribir los más &grandes"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Sobrescribir los más anti&guos"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Sobrescribir los más peque&ños"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Renombrar"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Reanudar"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Rein&tentar"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr "Como ad&ministrador"
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Saltar"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Saltar &todos"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Sí"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Copiar archivo(s)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Mover archivo(s)"
#: ulng.rsdlgoppause
msgid "Pau&se"
msgstr "Pau&sa"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "Comen&zar"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "En cola"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Velocidad: %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Velocidad: %s/s, tiempo restante: %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr "Formato de texto enriquecido;Formato HTML;Formato Unicode;Formato de texto plano"
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<sin etiqueta>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<sin medio>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Editor interno de Double Commander."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Ir a la línea:"
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr "Ir a la línea:"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "nuevo.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Nombre del archivo:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Abrir archivo"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "Hacia &atrás"
#: ulng.rseditsearchcaption
msgid "Search"
msgstr "Búsqueda"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "Hacia a&delante"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Reemplazar"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "con editor externo"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "con editor interno"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Ejecutar vía consola"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Ejecutar en terminal y cerrar"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Ejecutar en terminal y dejar abierto"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Izquierda;Derecha;Activa;Inactiva;Ambas;Ninguna"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "No;Sí"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Exportado_desde_DC"
#: ulng.rsfileopdirectoryexistsoptions
msgid "Ask;Merge;Skip"
msgstr "Preguntar;Mezclar;Saltar"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Preguntar;Sobrescribir;Sobrescribir antiguo;Saltar"
#: ulng.rsfileopsetpropertyerroroptions
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Preguntar;No ajustar más;Ignorar errores"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "FILTRO"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Definir plantilla"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s nivel(es)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "todo (profundidad sin límites)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "solo carpeta actual"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "¡La carpeta «%s» no existe!"
#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Encontrados: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Guardar platilla de búsqueda"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Nombre de la plantilla:"
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Examinados: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Explorando"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Buscar archivos"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Tiempo de exploración: "
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Comienza en"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "%s bytes libres de %s bytes"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s bytes libres"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Fecha/hora de último acceso"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Atributos"
#: ulng.rsfunccomment
msgid "Comment"
msgstr "Comentario"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Tamaño comprimido"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Fecha/hora de creación"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Extensión"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Grupo"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Cambio de fecha/hora"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Enlace a..."
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Fecha/hora de última modificación"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Nombre"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Nombre sin extensión"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Propietario"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Ruta"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Tamaño"
#: ulng.rsfunctype
msgid "Type"
msgstr "Tipo"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Error creando el enlace duro"
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "Ninguno;Nombre, a-z;Nombre, z-a;Ext, a-z;Ext, z-a;Tamaño 9-0;Tamaño 0-9;Fecha 9-0;Fecha 0-9"
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"¡Advertencia! Cuando se restablece un archivo de respaldo .hotlist, este borrará la lista existente y la reemplazará.\n"
"\n"
"¿Seguro que quieres continuar?\n"
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Diálogo «Copiar/Mover»"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Comparar"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Editar comentario de diálogo"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Buscar archivos"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Principal"
#: ulng.rshotkeycategorysyncdirs
msgid "Synchronize Directories"
msgstr ""
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Visor"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
"Ya existe una configuración con ese nombre.\n"
"¿Quieres sobrescribirla?\n"
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr "¿Seguro que quieres restaurar el valor predeterminado?"
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr "¿Seguro que quieres borrar la configuración «%s»?"
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr "Copia de %s"
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr "Introduce un nombre nuevo"
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr "Debes mantener al menos un archivo de acceso directo."
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr "Nombre nuevo"
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
"La configuración de «%s» ha sido modificada.\n"
"¿Quieres guardarla ahora?\n"
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr "No hay acceso directo con «ENTER»"
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr "Por nombre de comando;Por atajo de teclado (agrupado);Por atajo de teclado (uno por fila)"
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "No se pudo encontrar referencia al archivo de barra predeterminado"
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr "Lista de ventanas de «Archivos encontrados»"
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Deseleccionar máscara"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Seleccionar máscara"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Máscara de entrada:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Ya existe una vista de columnas con ese nombre."
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr "Para cambiar la edición actual de vista de colmunas, ya sea GUARDAR, COPIAR o ELIMINAR la edición en curso"
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Configurar columnas a medida"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Introducir nuevo nombre de vista de columnas"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Acciones"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr "Copiar nombres con la ruta UNC"
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Desconectar de unidad de red..."
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Editar"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Expulsar"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Extraer aquí..."
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "A unidad de red"
#: ulng.rsmnumount
msgid "Mount"
msgstr "Montar"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Nuevo"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "No hay ningún medio disponible"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Abrir"
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Abrir con..."
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Otro..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Comprimir aquí..."
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Ordenar por"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Desmontar"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Ver"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Cuenta:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr "Todos los comandos internos de Double Commander"
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Parámetros adicionales para la línea de comandos:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr "¿Quieres incluirlo entre comillas?"
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"Error de CRC32 en el archivo:\n"
"«%s»\n"
"\n"
"¿Quieres conservar el archivo corrupto de todos modos?\n"
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "¡No puedes copiar/mover el archivo «%s» dentro de sí mismo!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "No se puede borrar la carpeta «%s»"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr "No se puede sobrescribir la carpeta «%s» porque «%s» no es una carpeta"
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "¡No se puede cambiar a «%s»!"
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "¿Cerrar todas las pestañas inactivas?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr ""
"¡Esta pestaña (%s) está bloqueada!\n"
"¿Quieres cerrarla de todos modos?\n"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr "Confirmación de parámetro"
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "¿Estás seguro de querer salir?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "El archivo %s ha cambiado. ¿Quieres copiar una versión previa?"
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "No se puede hacer una copia previa. ¿Quieres mantener el archivo modificado?"
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "¿Copiar los %d archivos/carpetas seleccionados?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "¿Copiar «%s»?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Crear un nuevo tipo de archivo «archivos %s» >"
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Introduce ubicación y nombre del archivo donde guardar la barra de DC"
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Acción personalizada"
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "¿Quieres eliminar el archivo parcialmente copiado?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "¿Quieres eliminar los %d archivos/carpetas seleccionados?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "¿Quieres enviar %d archivos/carpetas a la papelera?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "¿Quieres eliminar «%s»?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "¿Quieres enviar a «%s» a la papelera?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr ""
"¡No se puede enviar «%s» a la papelera!\n"
"¿Quieres eliminarlo directamente?\n"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Disco no está disponible"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr "Introduce el nombre de la acción:"
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Introduce la extensión del archivo:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Introduce el nombre:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Introduce el nombre del nuevo tipo de archivo a crear para la extensión «%s»"
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Error de CRC en los datos del fichero"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Datos corrompidos"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "No se puede conectar al servidor: «%s»"
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "No se puede copiar el archivo «%s» a «%s»"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Ya existe una carpeta llamada «%s»."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "La fecha «%s» no está soportada"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "¡La carpeta «%s» ya existe!"
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Función interrumpida por usuario"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Error cerrando archivo"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Imposible crear el archivo"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "No hay más archivos en el fichero"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "No se puede abrir el archivo solicitado"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Error leyendo desde archivo"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Error escribiendo al archivo"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "¡No se puede crear la carpeta «%s»!"
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Enlace no válido"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "No se encontraron archivos"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Memoria insuficiente"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "¡Función no soportada!"
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Error en el comando del menú contextual"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Error al cargar la configuración"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "¡Error de sintaxis en expresión regular!"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "No se puede renombrar el archivo «%s» a «%s»"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "¡No se puede guardar asociación!"
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "No se puede guardar el archivo"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "No se pueden fijar atributos para «%s»"
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "No se pueden fijar fecha/hora para «%s»"
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "No se pueden fijar propietario/grupo para «%s»"
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "No se pueden fijar permisos para «%s»"
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Buffer demasiado pequeño"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Demasiados archivos para comprimir"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Formato de fichero desconocido"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "¿Seguro que quieres eliminar todos los apuntes de la lista de pestañas favoritas?) (¡No es posible deshacer esta acción!)"
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Arrastra aquí otros apuntes"
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr "Introduce un nombre para esta pestaña favorita"
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "Guardando un nuevo apunte de pestañas favoritas"
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Número de pestañas favoritas exportadas con éxito: %d de %d"
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr "Configuración extra predeterminada para guardar el historial de direcciones de nuevas pestañas favoritas:"
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Número de archivo(s) importados con éxito: %d de %d"
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Pestañas heredadas importadas"
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr "Selecciona el archivo .tab a importar (se pueden marcar varios)"
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
"La última modificación de pestañas favoritas no ha sido guardada todavía.\n"
"¿Quieres guardarla antes de continuar?\n"
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Seguir guardando el historial de direcciones con pestañas favoritas:"
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Nombre del submenú"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "Esto cargará las pestañas favoritas: «%s»"
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr "Guardar las pestañas actuales sobre una favorita ya existente"
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr ""
"El archivo «%s» ha cambiado.\n"
"¿Quieres guardarlo?\n"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s bytes, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Sobrescribir:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr ""
"El archivo «%s» ya existe.\n"
"¿Quieres sobrescribirlo?\n"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Con archivo:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Archivo «%s» no encontrado."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Operaciones con archivo activas"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Algunas operaciones con archivos no han terminado todavía. Si cierra Double Commander puede perder datos."
#: ulng.rsmsgfilepathovermaxpath
#, fuzzy,badformat
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
"La longitud del nombre de destino (%d) tiene más de %d caracteres\n"
"%s\n"
"La mayoría de los programas no podrán acceder a un archivo/carpeta con un nombre tan largo\n"
"%s\n"
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr ""
"El archivo «%s» está marcado como de solo lectura/oculto/de sistema.\n"
"¿Quieres borrarlo?\n"
#: ulng.rsmsgfilereloadwarning
msgid "Are you sure you want to reload the current file and lose the changes?"
msgstr ""
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "¡El tamaño del archivo de «%s» es demasiado grande para el sistema de archivos de destino!"
#: ulng.rsmsgfolderexistsrwrt
msgid "Folder %s exists, merge?"
msgstr ""
"La carpeta «%s» ya existe.\n"
"¿Quieres mezclarla?\n"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "¿Seguir enlace simbólico «%s»?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Selecciona el formato de texto a importar"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Añadir las %d carpetas seleccionadas"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Añadir la carpeta seleccionada: "
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Añadir la carpeta actual: "
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Crear comando"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr "cm_somthing"
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Configuración de la lista de marcadores"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "¿Seguro que quieres eliminar todos los apuntes de tu lista de marcadores? (¡No es posible deshacer esta acción!)"
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Este ejecutará el comando siguiente:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "Este es un marcador llamado "
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Esto cambiará el cuadro activo a la ruta siguiente:"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "Y el cuadro inactivo cambiará a la ruta siguiente:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Error al hacer respaldo de apuntes..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Error exportando apuntes..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "¡Exportar todo!"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Exportar marcadores - Selecciona los apuntes que quieres exportar"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Exp. selección"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "¡Importar todo!"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Importar marcadores - Selecciona los apuntes que quieres importar"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Imp. selección"
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "&Ruta:"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Ubicar archivo «.hotlist» a importar"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Nombre del marcador"
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Número de apuntes nuevos: %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "¡Nada seleccionado para exportar!"
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Ruta del marcador"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Reañadir la carpeta seleccionada:"
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Reañadir la carpeta actual:"
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Introduce ubicación y nombre del respaldo de la lista de marcadores a recuperar"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Comando:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(fin de submenú)"
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Nombre del me&nú:"
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "&Nombre:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(separador)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Nombre del submenú"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Destino del marcador"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Indica si quieres que el cuadro activo se clasifique en un orden específico tras cambiar de carpeta"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Indica si quieres que el cuadro no activo se clasifique en un orden específico tras cambiar carpeta"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Algunas funciones para seleccionar ruta relativa apropiada, absoluta, carpetas especiales de Windows, etc."
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Total de apuntes guardados: %d\n"
"\n"
"Archivo de respaldo: «%s»\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Total apuntes exportados:"
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"¿Quieres eliminar todos los elementos dentro del submenú «%s»?\n"
"Si respondes NO solo borrará los delimitadores del menú, pero mantendrá el elemento dentro del submenú.\n"
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Introduce ubicación y nombre del archivo donde guardar el respaldo de los marcadores"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Longitud de archivo incorrecto en: «%s»"
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Por favor, inserte disco siguiente o algo similar.\n"
"\n"
"Permitirá escribir este archivo:\n"
"«%s»\n"
"\n"
"Número de bytes restantes a escribir: %d\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Error en la línea de comandos"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Nombre no válido"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Formato no válido de archivo de configuración"
#: ulng.rsmsginvalidhexnumber
msgid "Invalid hexadecimal number: \"%s\""
msgstr ""
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Ruta no válida"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "La ruta «%s» contiene caracteres no permitidos."
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "¡Este no es un complemento válido!"
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Este complemento esta escrito para Double Commander por %s.%sPuede no funcionar con Double Commander por %s!"
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Cita no válida"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Selección no válida"
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Cargando lista de archivos..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr "Ubicar archivo de configuración de TC (wincmd.ini)"
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "Ubicar archivo ejecutable de TC (totalcmd.exe o totalcmd64.exe)"
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Copiar archivo «%s»"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Borrar archivo «%s»"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Error: "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr "Lanzamiento externo"
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr "Resultado externo"
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Extraer archivo «%s»"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Información: "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Crear enlace «%s»"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Crear carpeta «%s»"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Mover archivo «%s»"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Comprimir en archivo «%s»"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Eliminar carpeta «%s»"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Hecho: "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Crear enlace simbólico «%s»"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Comprobar integridad del archivo «%s»"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Destruir archivo «%s»"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Destruir carpeta «%s»"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Contraseña maestra"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Por favor, introduce la contraseña maestra:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Archivo nuevo"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Se descomprimirá el volumen siguiente"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "No hay archivos"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Ningún archivo seleccionado."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Espacio insuficiente en unidad de destino, ¿continuar?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Espacio insuficiente en unidad de destino, ¿reintentar?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "No se puede borrar archivo «%s»"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "No se ha implementado."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr "¡El objeto no existe!"
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "A continuación se muestra una vista previa. Puedes mover el cursor y seleccionar archivos para ver el aspecto de los distintos ajustes."
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Contraseña:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "¡Las contraseñas son diferentes!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Por favor, introduce la contraseña:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Contraseña (Firewall):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Por favor, reintroduce la contraseña para verificación:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Borrar «%s»"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr ""
"El preajuste «%s» ya existe.\n"
"¿Quieres sobrescribirlo?\n"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Problema al ejecutar comando (%s)"
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Archivo para texto soltado:"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Por favor, haz este archivo disponible. ¿Reintentar?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Introducir nuevo nombre descriptivo para estas pestañas favoritas"
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Introducir nombre nuevo para este menú"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "¿Renombrar/mover los %d archivos/carpetas seleccionados?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "¿Renombrar/mover «%s»?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Por favor, reinicia Double Commander para aplicar los cambios"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Seleccionar a qué tipo de archivo agregar la extensión «%s»"
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Seleccionados: %s de %s Archivos: %d de %d Carpetas: %d de %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Selecciona ejecutable para"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Por favor, selecciona solo archivos de suma de verificación"
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Por favor, selecciona ubicación del volumen siguiente"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Definir etiqueta de volumen"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Carpetas especiales"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Añadir ruta de cuadro activo"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Añadir ruta de cuadro inactivo"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Navegar y usar la ruta seleccionada"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Usar variables de entorno..."
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Ir a ruta especial de DC..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Ir a variable de entorno..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Ir a otra carpeta especial de Windows..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Ir a carpeta especial de Windows (TC)..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Relacionar con ruta de marcador..."
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Poner ruta absoluta"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Relacionar con ruta especial de DC..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Relacionar con variable de entorno..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Relacionar con carpeta especial de Windows (TC)..."
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Relacionar con otra carpeta especial de Windows..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Usar ruta especial de DC..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr "Usar ruta de marcador..."
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Usar otra carpeta especial de Windows..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Usar carpeta especial de Windows (TC)..."
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr ""
"¡Esta pestaña (%s) está bloqueada!\n"
"¿Quieres abrir la ruta en otra pestaña?\n"
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Renombrar pestaña"
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Nombre de la pestaña nueva:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Ruta de destino:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"¡Error! No se pudo encontrar el archivo de configuración de TC:\n"
"%s\n"
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"¡Error! No se pudo encontrar la configuración del ejecutable de TC:\n"
"%s\n"
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"¡Error! TC está ejecutándose, pero debe cerrarse para esta operación.\n"
"Ciérralo y pulsa «Aceptar» o «Cancelar» para interrumpir.\n"
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"¡Error! No se pudo encontrar la carpeta de salida de la barra de herramientas TC:\n"
"%s\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Introduce la ubicación y nombre del archivo donde guardar el respaldo de barra de TC"
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr "«%s» está ahora en el portapapeles"
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr "La extensión del archivo seleccionado no es un tipo de archivo reconocido"
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Ubicar archivo «.toolbar» para importar"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Ubicar archivo «.BAR» para importar"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Introduce la ubicación y nombre del respaldo de donde recuperar la barra de herramientas"
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"¡Guardada!\n"
"Nombre del respaldo de la barra: «%s»\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Demasiados archivos seleccionados."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "No determinado"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr "¡ERROR: Uso imprevisto del menú de la vista de árbol!"
#: ulng.rsmsgurl
msgid "URL:"
msgstr "URL:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "<SIN EXT>"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr "<SIN NOMBRE>"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Nombre del usuario:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Nombre del usuario (Firewall):"
#: ulng.rsmsgverify
msgid "VERIFICATION:"
msgstr "VERIFICACIÓN:"
#: ulng.rsmsgverifywrong
msgid "The target file is corrupted, checksum mismatch!"
msgstr "El archivo de destino está dañado y la suma de verificación no coincide."
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Etiqueta del volumen:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Por favor, introduce el tamaño del volumen:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "¿Quieres destruir los %d archivos/carpetas seleccionados?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "¿Quieres destruir «%s»?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "con"
#: ulng.rsmsgwrongpasswordtryagain
msgid ""
"Wrong password!\n"
"Please try again!\n"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr "¿Cambiar automáticamente el nombre a «nombre (1).ext», «nombre (2).ext», etc.?"
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Sin cambios;MAYÚSCULAS;minúsculas;Primera letra en mayúscula;Primera Letra De Cada Palabra En Mayúsculas"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr "¡Advertencia, nombres duplicados!"
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr "El archivo contiene un número de líneas erróneo: %d, ¡debería ser %d!"
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr "Mantener;Borrar;Preguntar"
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr "No hay comando interno equivalente"
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr "Lo siento, no hay ventana de «Archivos encontrados» todavía..."
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr "Lo siento, no hay ventana de «Archivos encontrados» que cerrar y quitar de la memoria..."
#: ulng.rsopenwithdevelopment
msgid "Development"
msgstr ""
#: ulng.rsopenwitheducation
msgid "Education"
msgstr ""
#: ulng.rsopenwithgames
msgid "Games"
msgstr ""
#: ulng.rsopenwithgraphics
#, fuzzy
msgctxt "ulng.rsopenwithgraphics"
msgid "Graphics"
msgstr "Gráficos"
#: ulng.rsopenwithmultimedia
msgid "Multimedia"
msgstr ""
#: ulng.rsopenwithnetwork
#, fuzzy
msgctxt "ulng.rsopenwithnetwork"
msgid "Network"
msgstr "Red"
#: ulng.rsopenwithoffice
msgid "Office"
msgstr ""
#: ulng.rsopenwithother
#, fuzzy
msgctxt "ulng.rsopenwithother"
msgid "Other"
msgstr "Otros"
#: ulng.rsopenwithscience
msgid "Science"
msgstr ""
#: ulng.rsopenwithsettings
msgid "Settings"
msgstr ""
#: ulng.rsopenwithsystem
#, fuzzy
msgctxt "ulng.rsopenwithsystem"
msgid "System"
msgstr "Sistema"
#: ulng.rsopenwithutility
msgid "Accessories"
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Interrumpido"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Calculando suma de verificación"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Calculando suma de verificación en «%s»"
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "Calculando suma de verificación de «%s»"
#: ulng.rsopercalculatingstatictics
msgid "Calculating"
msgstr "Calculando"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Calculando «%s»"
#: ulng.rsopercombining
msgid "Joining"
msgstr "Juntando"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Juntando archivos de «%s» a «%s»"
#: ulng.rsopercopying
msgid "Copying"
msgstr "Copiando"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Copiando desde «%s» a «%s»"
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Copiando «%s» a «%s»"
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Creando carpeta"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Creando carpeta «%s»"
#: ulng.rsoperdeleting
msgid "Deleting"
msgstr "Borrando"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Borrando en «%s»"
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Borrando «%s»"
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Ejecutando"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Ejecutando «%s»"
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Extrayendo"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Extrayendo desde «%s» a «%s»"
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Finalizado"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Listando"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Listando «%s»"
#: ulng.rsopermoving
msgid "Moving"
msgstr "Moviendo"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Moviendo desde «%s» a «%s»"
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Moviendo «%s» a «%s»"
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Sin comenzar"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Comprimiendo"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Comprimiendo desde «%s» a «%s»"
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Comprimiendo «%s» a «%s»"
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Pausado"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Pausando"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Funcionando"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Configurando propiedad"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Configurando propiedad en «%s»"
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Configurando propiedad de «%s»"
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Dividiendo"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Dividiendo «%s» a «%s»"
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Comenzando"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Detenido"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Deteniendo"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Comprobando"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Comprobando en «%s»"
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Comprobando «%s»"
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Comprobando suma de verificación"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Comprobando suma de verificación en «%s»"
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "Comprobando suma de verificación de «%s»"
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Esperando para acceder al archivo origen"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Esperando la respuesta del usuario"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Destruyendo"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Destruyendo en «%s»"
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Destruyendo «%s»"
#: ulng.rsoperworking
msgid "Working"
msgstr "Trabajando"
#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Añadir al principio;Añadir al final;Añadido inteligente"
#: ulng.rsoptarchiveconfiguresavetochange
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsoptarchiveradditonalcmd
msgid "Mode dependent, additional command"
msgstr ""
#: ulng.rsoptarchiveraddonlynotempty
msgid "Add if it is non-empty"
msgstr ""
#: ulng.rsoptarchiverarchivel
msgid "Archive File (long name)"
msgstr ""
#: ulng.rsoptarchiverarchiver
msgid "Select archiver executable"
msgstr ""
#: ulng.rsoptarchiverarchives
msgid "Archive file (short name)"
msgstr ""
#: ulng.rsoptarchiverchangeencoding
msgid "Change Archiver Listing Encoding"
msgstr ""
#: ulng.rsoptarchiverconfirmdelete
msgid "Are you sure you want to delete: %s"
msgstr ""
#: ulng.rsoptarchiverdefaultexportfilename
msgid "Exported Archiver Configuration"
msgstr ""
#: ulng.rsoptarchivererrorlevel
msgid "errorlevel"
msgstr ""
#: ulng.rsoptarchiverexportcaption
msgid "Export archiver configuration"
msgstr ""
#: ulng.rsoptarchiverexportdone
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverexportprompt
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsoptarchiverfilelistl
msgid "Filelist (long names)"
msgstr ""
#: ulng.rsoptarchiverfilelists
msgid "Filelist (short names)"
msgstr ""
#: ulng.rsoptarchiverimportcaption
msgid "Import archiver configuration"
msgstr ""
#: ulng.rsoptarchiverimportdone
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverimportfile
msgid "Select the file to import archiver configuration(s)"
msgstr ""
#: ulng.rsoptarchiverimportprompt
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsoptarchiverjustname
msgid "Use name only, without path"
msgstr ""
#: ulng.rsoptarchiverjustpath
msgid "Use path only, without name"
msgstr ""
#: ulng.rsoptarchiverprograml
msgid "Archive Program (long name)"
msgstr ""
#: ulng.rsoptarchiverprograms
msgid "Archive Program (short name)"
msgstr ""
#: ulng.rsoptarchiverquoteall
msgid "Quote all names"
msgstr ""
#: ulng.rsoptarchiverquotewithspace
msgid "Quote names with spaces"
msgstr ""
#: ulng.rsoptarchiversinglefprocess
msgid "Single filename to process"
msgstr ""
#: ulng.rsoptarchivertargetsubdir
msgid "Target subdirecory"
msgstr ""
#: ulng.rsoptarchiveruseansi
msgid "Use ANSI encoding"
msgstr ""
#: ulng.rsoptarchiveruseutf8
msgid "Use UTF8 encoding"
msgstr ""
#: ulng.rsoptarchiverwheretosave
msgid "Enter location and filename where to save archiver configuration"
msgstr ""
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Nombre del tipo de fichero:"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Complemento asociado «%s» con:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Primera;Última;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Clásico, orden heredado;Orden alfabético (pero «Idioma» permanece primero)"
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Panel izquierdo activo, derecho inactivo (heredado);Panel izquierdo a la izquierda, derecho a la derecha"
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Deshabilitar"
#: ulng.rsoptenable
msgid "Enable"
msgstr "Habilitar"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Introducir extensión"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "Añadir al principio;Añadir al final;Orden alfabético"
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "ventana separada;ventana separada minimizada;panel de operaciones"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "Flotante;Bytes;Kibibytes;Mebibytes;Gibibytes"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "El atajo «%s» para cm_Delete será registrado, por lo que se puede utilizar para revertir este ajuste."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Añadir atajo para «%s»"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Añadir atajo"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "No se puede configurar el atajo"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Cambiar atajo"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Comando"
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "El atajo «%s» para cm_Delete tiene un parámetro que sobrescribe este ajuste ¿Quieres cambiar este parámetro para usar la configuración global?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "El atajo «%s» para cm_Delete necesita cambiar un parámetro para que coincida con el atajo «%s» ¿Quieres cambiarlo?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Descripción"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Editar atajo para «%s»"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Corregir parámetro"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Atajo"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Atajos"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<ninguna>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parámetros"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Configurar atajo para borrar archivo"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Para que este ajuste funcione con el atajo «%s», el atajo «%s» debe asignarse a cm_Delete pero ya está asignado a «%s» ¿Quieres cambiarlo?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "El atajo «%s» para cm_Delete es una secuencia a la que no se puede asignar una tecla con «Mayúsculas» invertida. Este ajuste podría no funcionar."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Atajo en uso"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "El atajo «%s» ya está en uso."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "¿Cambiarlo a «%s»?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "usado por «%s» en «%s»"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "usado para este comando pero con parámetros diferentes"
#: ulng.rsoptionseditorarchivers
msgid "Archivers"
msgstr "Compresores"
#: ulng.rsoptionseditorautorefresh
msgid "Auto refresh"
msgstr "Actualización de paneles"
#: ulng.rsoptionseditorbehavior
msgid "Behaviors"
msgstr "Comportamiento"
#: ulng.rsoptionseditorbriefview
msgid "Brief"
msgstr "Breve"
#: ulng.rsoptionseditorcolors
msgid "Colors"
msgstr "Colores"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Columnas"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Configuración"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Columnas personalizadas"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Marcadores"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Arrastrar y soltar"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Botón de lista de unidades"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Pestañas favoritas"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Asociaciones de archivos extra"
#: ulng.rsoptionseditorfileassoc
msgid "File associations"
msgstr "Asociaciones de archivos"
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Nuevo"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Operaciones con archivos"
#: ulng.rsoptionseditorfilepanels
msgid "File panels"
msgstr "Paneles de archivos"
#: ulng.rsoptionseditorfilesearch
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Búsqueda de archivos"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Vista de archivos"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Tipos de archivos"
#: ulng.rsoptionseditorfoldertabs
msgid "Folder tabs"
msgstr "Pestañas"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Pestañas extra"
#: ulng.rsoptionseditorfonts
msgid "Fonts"
msgstr "Tipografías"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Resaltadores"
#: ulng.rsoptionseditorhotkeys
msgid "Hot keys"
msgstr "Atajos"
#: ulng.rsoptionseditoricons
msgid "Icons"
msgstr "Iconos"
#: ulng.rsoptionseditorignorelist
msgid "Ignore list"
msgstr "Lista de ignorados"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Teclado"
#: ulng.rsoptionseditorlanguage
msgid "Language"
msgstr "Idioma"
#: ulng.rsoptionseditorlayout
msgid "Layout"
msgstr "Apariencia"
#: ulng.rsoptionseditorlog
msgid "Log"
msgstr "Registro de operaciones"
#: ulng.rsoptionseditormiscellaneous
msgid "Miscellaneous"
msgstr "Miscelánea"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Ratón"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
"Las opciones han cambiado en «%s»\n"
"\n"
"¿Quieres guardar las modificaciones?\n"
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Complementos"
#: ulng.rsoptionseditorquicksearch
msgid "Quick search/filter"
msgstr "Búsqueda/filtro rápidos"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Barra de herramientas"
#: ulng.rsoptionseditortools
msgid "Tools"
msgstr "Herramientas"
#: ulng.rsoptionseditortooltips
msgid "Tooltips"
msgstr "Información emergente"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Menú de la vista de árbol"
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr "Menú de colores de la vista de árbol"
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Nada;Línea de comandos;Búsqueda rápida;Filtro rápido"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Botón izquierdo;Botón derecho;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "al principio de la lista de archivos;después de las carpetas (si las carpetas están ordenadas antes que los archivos);en posición ordenada;al final de la lista de archivos"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "El complemento «%s» ya está asignado para las extensiones siguientes:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Activo"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Nombre del archivo"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Nombre"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Registrado por"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Sensible;&Insensible"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Archivos;Ca&rpetas;Archivos &y carpetas"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "Ocultar el panel del filtro cuando no esté enfocado;Guardar los ajustes para la siguiente sesión"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "no sensible a capitalización;de acuerdo a los ajustes locales (aAbBcC);primero mayúsculas, después minúsculas (ABCabc)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "ordenar por nombre y mostrar primero;ordenar como los archivos y mostrar primero;ordenar como los archivos"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "alfabético, considerando tildes;orden natural: alfabético y numérico"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Arriba;Abajo;"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "S&eparador;Comando inte&rno;Comando e&xterno;&Menú"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "Modo DC: «Copia (x) nombre.ext»;Windows: «nombre (x).ext»;Otro: «nombre(x).ext»"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "no cambiar posición;usar la misma configuración que para los archivos nuevos;en posición ordenada"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Archivos: %d, carpetas: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "No se pueden cambiar los derechos de acceso de «%s»"
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "No se puede cambiar el propietario de «%s»"
#: ulng.rspropsfile
msgid "File"
msgstr "Archivo"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Carpeta"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Tubería nombrada"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Zócalo"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Dispositivo especial de bloque"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Carácter especial de dispositivo"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Enlace simbólico"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Tipo desconocido"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Resultado de búsqueda"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "BUSCAR"
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<plantilla sin nombre>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Ya hay en curso una búsqueda de archivos mediante el complemento DSX.\n"
"Es necesario que se complete antes de lanzar una nueva.\n"
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
"Ya hay en curso una búsqueda de archivos mediante el complemento WDX.\n"
"Es necesario que se complete antes de lanzar una nueva.\n"
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Selecciona una carpeta"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr "Selecciona una ventana"
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "Mo&strar ayuda para «%s»"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Todo"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Categoría"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Columna"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Comando"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Nombre del archivo"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "archivos"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr "Letra"
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Parámetro"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Resultado"
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "Carpeta de trabajo"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bytes"
#: ulng.rssizeunitgbytes
msgid "Gigabytes"
msgstr "Gigabytes"
#: ulng.rssizeunitkbytes
msgid "Kilobytes"
msgstr "Kilobytes"
#: ulng.rssizeunitmbytes
msgid "Megabytes"
msgstr "Megabytes"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabytes"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Archivos: %d, Carpetas: %d, Tamaño: %s (%s bytes)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "¡No se pudo crear la carpeta de destino!"
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "¡Formato incorrecto de tamaño de archivo!"
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "¡No se puede dividir el archivo!"
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "¡El número de partes es mayor de 100! ¿continuar?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr "Automático;1457664B - 3.5\" Alta densidad 1.44M;1213952B - 5.25\" Alta densidad 1.2M;730112B - 3.5\" Doble densidad 720K;362496B - 5.25\" Doble densidad 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Seleccionar carpeta:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr "Solo vista previa"
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr "Otros"
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr "OU"
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr "Nota al margen"
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr "Plano"
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr "Limitado"
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr "Simple"
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr "Gourmets"
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr "Camp Nou"
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr "Estadounidenses"
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr "Escoge tu carpeta desde el historial"
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr "Escoge tus pestañas favoritas"
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr "Escoge tu orden desde el historial de la línea de comandos"
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr "Escoge tu acción desde el menú principal"
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr "Escoge tu acción desde la barra de herramientas principal"
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr "Escoge tu carpeta desde marcadores:"
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr "Escoge tu carpeta desde el historial de archivos"
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr "Escoge tu archivo o tu carpeta"
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Error creando el enlace simbólico."
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr "Texto predeterminado"
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr "Texto sin formato"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "No hacer nada;Cerrar pestaña;Ir a pestañas favoritas;Menú emergente de pestañas"
#: ulng.rstimeunitday
msgid "Day(s)"
msgstr "Día(s)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Hora(s)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minuto(s)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Mes(es)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Segundo(s)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Semana(s)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Año(s)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Renombrar pestañas favoritas"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Renombrar submenú de pestañas favoritas"
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Comparador"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Editor"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Error al abrir el comparador"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Error al abrir el editor"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Error al abrir el terminal"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Error al abrir el visor"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Visor"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Por favor, informa de este error al trazador de errores con una descripción de lo que estabas haciendo y el archivo siguiente:%sPulsa «%s» para continuar o «%s» para interrumpir el programa."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "Ambos paneles, de activo a inactivo"
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "Ambos paneles, de izquierda a derecha"
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Ruta del panel"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "Poner cada nombre entre paréntesis o lo que elijas"
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Solo el nombre, sin la extensión"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "Nombre de archivo completo (ruta+nombre)"
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr "Ayuda con variables «%»"
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr "Solicitará petición del usuario que introduzca un parámetro con un valor predeterminado sugerido"
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Panel izquierdo"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "Nombre de archivo temporal de la lista de nombres de archivo"
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "Nombre de archivo temporal de la lista de nombres de archivo completos (ruta+nombre)"
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr "Nombres de archivos enlistados en UTF-16 con BOM"
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr "Nombres de archivos enlistados en UTF-16 con BOM, dentro de comillas dobles"
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr "Nombres de archivos enlistados en UTF-8"
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr "Nombres de archivos enlistados en UTF-8, dentro de comillas dobles"
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "Nombre de archivo temporal de la lista de nombres de archivo con ruta relativa"
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Sólo la extensión del archivo"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Sólo el nombre del archivo"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Otro ejemplo de lo que es posible"
#: ulng.rsvarpath
msgid "Path, without ending delimiter"
msgstr "Ruta, sin delimitador final"
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr "Desde aquí hasta el final de línea, el indicador de porcentaje variable es el signo \"#\""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr "Devolver el signo de porcentaje"
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr "Desde aquí hasta el final de línea, el indicador de porcentaje variable es de nuevo el signo \"%\""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "Anteponer cada nombre con \"-a\" o lo que elijas"
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "%[Solicitar parámetro al usuario;Valor predeterminado propuesto]"
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "Nombre del archivo con la ruta relativa"
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Panel derecho"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "Ruta completa del segundo archivo seleccionado en el panel derecho"
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "Mostrar comando antes de ejecutar"
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "%[Mensaje sencillo]"
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "Mostrará un mensaje sencillo"
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Panel activo (origen)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Panel inactivo (destino)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr "Los nombres de archivos serán entrecomillados a partir de aquí (predeterminado)"
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "El comando será ejecutado en terminal, manteniéndose abierto al finalizar"
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr "Las rutas finalizarán con delimitador"
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "Los nombres de archivos no serán entrecomillados a partir de aquí"
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "El comando se ejecutará en terminal, cerrándose al finalizar"
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr "Las rutas no finalizarán con delimitador (predeterminado)"
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Red"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Visor interno de Double Commander."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Calidad inferior"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Codificación"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Tipo de imagen"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Tamaño nuevo"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "¡%s no encontrado!"
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "con visor externo"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "con visor interno"
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Número de sustituciones: %d"
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "No se ha sustituido nada."