doublecmd/language/doublecmd.hr.po
2018-07-22 15:07:42 +00:00

12997 lines
346 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: 2015-01-06 17:20+0100\n"
"Last-Translator: Ivica Pavelić <ivica.pavelic2@zg.ht.hr>\n"
"Language: hr\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
"X-Generator: Poedit 1.5.4\n"
"X-Language: hr_HR\n"
"X-Native-Language: hrvatski\n"
#: fsyncdirsdlg.rscomparingpercent
msgctxt "fsyncdirsdlg.rscomparingpercent"
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Uspoređujem... %d%% (ESC za otkazivanje)"
#: fsyncdirsdlg.rsdeleteright
msgctxt "fsyncdirsdlg.rsdeleteright"
msgid "Right: Delete %d file(s)"
msgstr "Desno: Obriši %d datoteku(e)"
#: fsyncdirsdlg.rsfilesfound
msgctxt "TFCOLUMNSSETCONF.BTNALLBACK.CAPTION"
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Pronađeno je datoteka: %d (istovjetnih: %d, različitih: %d, jedinstvenih lijevo: %d, jedinstvenih desno: %d)"
#: fsyncdirsdlg.rslefttorightcopy
msgctxt "TFCOLUMNSSETCONF.BTNALLBACK.CAPTION"
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Sa ljeva na desno: Kopiraj %d datoteka, ukupne veličine %d bajta"
#: fsyncdirsdlg.rsrighttoleftcopy
msgctxt "TFCOLUMNSSETCONF.BTNALLBACK.CAPTION"
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Sa desna na lijevo: Kopiraj %d datoteka, ukupne veličine %d bajta"
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgctxt "tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint"
msgid "Choose template..."
msgstr "Izaberite obrazac..."
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption"
msgid "C&heck free space"
msgstr "P&rovjeri slobodan prostor"
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption"
msgid "Cop&y attributes"
msgstr "Kopiraj& svojstva"
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption"
msgid "Copy o&wnership"
msgstr "Kopiraj v&lasništvo"
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption"
msgid "Copy &permissions"
msgstr "Kopiranje dopuštenja"
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopiraj v&rijeme i datum"
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption"
msgid "Correct lin&ks"
msgstr "Ispravi v&eze"
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
msgid "Drop readonly fla&g"
msgstr "Poništi osobinu samo za &čitanje"
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption"
msgid "E&xclude empty directories"
msgstr "I&zuzmi prazne mape"
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption"
msgid "Fo&llow links"
msgstr "S&ledi veze"
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbreservespace.caption"
msgid "&Reserve space"
msgstr "&Čuvaj slobodan prostor"
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgctxt "tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint"
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Šta činiti kada se ne mogu podesiti vreme, svojstva, itd."
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption"
msgid "Use file template"
msgstr "Koristi obrazac datoteke"
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption"
msgid "When dir&ectory exists"
msgstr "Kada &Mapa postoji"
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When &file exists"
msgstr "Kada &datoteka postoji"
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption"
msgid "When ca&nnot set property"
msgstr "Kada se ne& mogu postaviti osobine"
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption"
msgid "<no template>"
msgstr "<nema obrasca>"
#: tfrmabout.btnclose.caption
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zatvori"
#: tfrmabout.btncopytoclipboard.caption
msgctxt "tfrmabout.btncopytoclipboard.caption"
msgid "Copy to clipboard"
msgstr "Kopirati u međuspremnik"
#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Izgrađen"
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Slobodni Paskal"
#: tfrmabout.lblhomepage.caption
msgctxt "tfrmabout.lblhomepage.caption"
msgid "Home Page:"
msgstr "Početna stranica:"
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "prerađeno izdanje"
#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Izdanje"
#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmattributesedit.btnreset.caption
msgctxt "tfrmattributesedit.btnreset.caption"
msgid "&Reset"
msgstr "&Poništi"
#: tfrmattributesedit.caption
msgctxt "tfrmattributesedit.caption"
msgid "Choose attributes"
msgstr "Izaberite svojstva"
#: tfrmattributesedit.cbarchive.caption
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
msgid "&Archive"
msgstr "&Arhiva"
#: tfrmattributesedit.cbcompressed.caption
msgctxt "tfrmattributesedit.cbcompressed.caption"
msgid "Co&mpressed"
msgstr "st&isnuto"
#: tfrmattributesedit.cbdirectory.caption
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
msgid "&Directory"
msgstr "&Mapa"
#: tfrmattributesedit.cbencrypted.caption
msgctxt "tfrmattributesedit.cbencrypted.caption"
msgid "&Encrypted"
msgstr "&Šifrirano"
#: tfrmattributesedit.cbhidden.caption
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
msgid "&Hidden"
msgstr "&Skriveno"
#: tfrmattributesedit.cbreadonly.caption
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
msgid "Read o&nly"
msgstr "Samo za &čitanje"
#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmattributesedit.cbsparse.caption
msgctxt "tfrmattributesedit.cbsparse.caption"
msgid "S&parse"
msgstr "P&rorijeđeno"
#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Ljepljivo"
#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmattributesedit.cbsymlink.caption
msgctxt "tfrmattributesedit.cbsymlink.caption"
msgid "&Symlink"
msgstr "&Simbolička veza"
#: tfrmattributesedit.cbsystem.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "S&istem"
#: tfrmattributesedit.cbtemporary.caption
msgctxt "tfrmattributesedit.cbtemporary.caption"
msgid "&Temporary"
msgstr "&Privremeno"
#: tfrmattributesedit.gbntfsattributes.caption
msgctxt "tfrmattributesedit.gbntfsattributes.caption"
msgid "NTFS attributes"
msgstr "Svojstva NTFS "
#: tfrmattributesedit.gbwingeneral.caption
msgctxt "tfrmattributesedit.gbwingeneral.caption"
msgid "General attributes"
msgstr "Opća svojstva"
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bita:"
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Udruženje"
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Ostalo"
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlasnik"
#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Izvrši"
#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čitaj"
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Kao t&ekst:"
#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Piši"
#: tfrmbenchmark.caption
msgid "Benchmark"
msgstr ""
#: tfrmbenchmark.lblbenchmarksize.caption
msgid "Benchmark data size: %d MB"
msgstr ""
#: tfrmbenchmark.stgresult.columns[0].title.caption
msgid "Hash"
msgstr ""
#: tfrmbenchmark.stgresult.columns[1].title.caption
msgid "Time (ms)"
msgstr ""
#: tfrmbenchmark.stgresult.columns[2].title.caption
msgid "Speed (MB/s)"
msgstr ""
#: tfrmchecksumcalc.caption
msgctxt "TFRMCHECKSUMCALC.CAPTION"
msgid "Calculate checksum..."
msgstr "Izračunaj zbirnu provjeru"
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgctxt "tfrmchecksumcalc.cbopenafterjobiscomplete.caption"
msgid "Open checksum file after job is completed"
msgstr "Otvorite datoteku provjere nakon završetka zadatka"
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "&Učini posebnu datoteku zbirne provjere za svaku datoteku"
#: tfrmchecksumcalc.lblsaveto.caption
msgctxt "tfrmchecksumcalc.lblsaveto.caption"
msgid "&Save checksum file(s) to:"
msgstr "&Kopiraj zbirnu(e) ptovjeru(e) u"
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zatvori"
#: tfrmchecksumverify.caption
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Zbirna provjera..."
#: tfrmconnectionmanager.btnadd.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "D&odaj"
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Otk&aži"
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "Po&veži se"
#: tfrmconnectionmanager.btndelete.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmconnectionmanager.btnedit.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Upravnik veza"
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Poveži se na:"
#: tfrmcopydlg.btnaddtoqueue.caption
msgctxt "tfrmcopydlg.btnaddtoqueue.caption"
msgid "A&dd To Queue"
msgstr "&Dodaj u zakazano"
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmcopydlg.btnoptions.caption
#, fuzzy
msgctxt "tfrmcopydlg.btnoptions.caption"
msgid "O&ptions"
msgstr "&Mogućnosti"
#: tfrmcopydlg.btnsaveoptions.caption
msgctxt "tfrmcopydlg.btnsaveoptions.caption"
msgid "Sa&ve these options as default"
msgstr "Kopiraj ove mogućnosti kao podrazumijevane"
#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Kopiraj datoteku(e)"
#: tfrmcopydlg.mnunewqueue.caption
msgctxt "tfrmcopydlg.mnunewqueue.caption"
msgid "New queue"
msgstr "Novo zakazivanje"
#: tfrmcopydlg.mnuqueue1.caption
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Zakazano 1"
#: tfrmcopydlg.mnuqueue2.caption
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Zakazano 2"
#: tfrmcopydlg.mnuqueue3.caption
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Zakazano 3"
#: tfrmcopydlg.mnuqueue4.caption
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Zakazano 4"
#: tfrmcopydlg.mnuqueue5.caption
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Zakazano 5"
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Kopiraj opis"
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Napomena datoteke/mape"
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "Uredi& napomenu za:"
#: tfrmdescredit.lblencoding.caption
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "&Šifriranje:"
#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Samostalno upoređivanje"
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Binarno"
#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Otkaži"
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Otkaži"
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Kopiraj skup desno"
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Kopiraj skup desno"
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Kopiraj skup lijevo"
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Kopiraj skup lijevo"
#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Izreži"
#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Naljepi"
#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Ponovi"
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "Označi &sve"
#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Poništi"
#: tfrmdiffer.actexit.caption
msgctxt "TFRMDIFFER.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Izlaz"
#: tfrmdiffer.actfirstdifference.caption
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION"
msgid "First Difference"
msgstr "Prva razlika"
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr "Prva razlika"
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Zanemari veličinu slova"
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Zanemari praznine"
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Nastavi klizanje"
#: tfrmdiffer.actlastdifference.caption
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION"
msgid "Last Difference"
msgstr "Poslednja razlika"
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr "Poslednja razlika"
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Razlika linija"
#: tfrmdiffer.actnextdifference.caption
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION"
msgid "Next Difference"
msgstr "Sljedeća razlika"
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr "Sljedeća razlika"
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Otvori lijevo..."
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Otvori desno..."
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Oboji pozadinu"
#: tfrmdiffer.actprevdifference.caption
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION"
msgid "Previous Difference"
msgstr "Prethodna razlika"
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr "Prethodna razlika"
#: tfrmdiffer.actreload.caption
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
msgid "&Reload"
msgstr "&Učitaj ponovo"
#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Ponovo učitaj"
#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Sačuvaj"
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Sačuvaj"
#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Kopiraj kao..."
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Kopiraj kao..."
#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Kopiraj lijevo"
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Kopiraj lijevo"
#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Kopiraj lijevo kao..."
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Kopiraj lijevo kao..."
#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Kopiraj desno"
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Kopiraj desno"
#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Kopiraj desno kao..."
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Kopiraj desno kao..."
#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Usporedi"
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Usporedi"
#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Šifriranje"
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Šifriranje"
#: tfrmdiffer.caption
msgctxt "TFRMDIFFER.CAPTION"
msgid "Compare files"
msgstr "Usporedi datoteke"
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Lijevo"
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "&Desno"
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Radnje"
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmdiffer.mnuencoding.caption
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
msgid "En&coding"
msgstr "Ši&friranje"
#: tfrmdiffer.mnufile.caption
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
msgid "&File"
msgstr "&Datoteka"
#: tfrmdiffer.mnuoptions.caption
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
msgid "&Options"
msgstr "&Mogućnosti"
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Dodaj novu prečicu nizu"
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Odustani"
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Ukloni posljednju prečicu iz niza"
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION"
msgid "Only for these controls"
msgstr "Samo za sledeća poklapanja"
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Odrednice (svaka u posebnoj liniji):"
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Prečice:"
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr "O radnji"
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Postavke"
#: tfrmeditor.actconfhigh.hint
msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT"
msgid "Configuration"
msgstr "Postavke"
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Isjeci"
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr "Isjeci"
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "Obriši"
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr "Obriši"
#: tfrmeditor.acteditfind.caption
#, fuzzy
#| msgid "&Find "
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Pronađi"
#: tfrmeditor.acteditfind.hint
msgctxt "TFRMEDITOR.ACTEDITFIND.HINT"
msgid "Find"
msgstr "Pronađi"
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Nađi sljedeće"
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr "Nađi sljedeće"
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr ""
#: tfrmeditor.acteditgotoline.caption
msgctxt "tfrmeditor.acteditgotoline.caption"
msgid "Goto Line..."
msgstr "Idi na liniju..."
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mek (CR)"
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr "Mek (CR)"
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Uniks (LF)"
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr "Uniks (LF)"
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Priljepi"
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr "Priljepi"
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Ponovi"
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr "Ponovi"
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "&Zamjeni"
#: tfrmeditor.acteditrplc.hint
msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT"
msgid "Replace"
msgstr "Zamjeni"
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "Označi &sve"
#: tfrmeditor.acteditselectall.hint
msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT"
msgid "Select All"
msgstr "Označi sve"
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Opozovi"
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr "Opozovi"
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "&Zatvori"
#: tfrmeditor.actfileclose.hint
msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT"
msgid "Close"
msgstr "Zatvori"
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Izađi"
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Napusti"
#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "&Novo"
#: tfrmeditor.actfilenew.hint
msgctxt "TFRMEDITOR.ACTFILENEW.HINT"
msgid "New"
msgstr "Novo"
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Otvori"
#: tfrmeditor.actfileopen.hint
msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT"
msgid "Open"
msgstr "Otvori"
#: tfrmeditor.actfilereload.caption
#, fuzzy
msgctxt "tfrmeditor.actfilereload.caption"
msgid "Reload"
msgstr "Učitaj ponovo"
#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Sačuvaj"
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr "Sačuvaj"
#: tfrmeditor.actfilesaveas.caption
#, fuzzy
#| msgid "Save &As.."
msgid "Save &As..."
msgstr "Kopiraj&kao..."
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Kopiraj kao"
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Sač&uvaj sve"
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "_Kopiraj sve"
#: tfrmeditor.caption
msgctxt "TFRMEDITOR.CAPTION"
msgid "Editor"
msgstr "Uređivač"
#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "Po&moć"
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "Ši&friranje"
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Otvori kao"
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Kopiraj kao"
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Datoteka"
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "Isticanje sintakse"
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Završetak linije"
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&U redu"
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
msgid "C&ase sensitivity"
msgstr "O&setljivo na veličinu slova"
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
msgid "S&earch from caret"
msgstr "&Traži od umetnutog znaka"
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "&Regularni izrazi"
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
msgid "Selected &text only"
msgstr "Samo označeni tekst&"
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
msgid "&Whole words only"
msgstr "&Samo cijele riječi"
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
msgid "Option"
msgstr "&Mogućnosti"
#: tfrmeditsearchreplace.lblreplacewith.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
msgid "&Replace with:"
msgstr "&Zamjeni sa:"
#: tfrmeditsearchreplace.lblsearchfor.caption
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
msgid "&Search for:"
msgstr "&Traži:"
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
msgid "Direction"
msgstr "Smjer"
#: tfrmextractdlg.caption
msgctxt "TFRMEXTRACTDLG.CAPTION"
msgid "Unpack files"
msgstr "Raspakiraj datoteke"
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Raspakiraj imena putanje ako su sačuvana u datotekama"
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Raspakiraj svaku od arhiva u &posebnu podMapa (po imenima arhiva)"
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "P&repiši postojeće datoteke"
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "U &mapu:"
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "&Izvuci datoteke na osnovu poklapanja:"
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "&Lozinka za šifrirane datoteke:"
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zatvori"
#: tfrmfileexecuteyourself.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
msgid "Wait..."
msgstr "Sačekajte..."
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Ime datoteke:"
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "Iz:"
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Kliknite na „Zatvori“ ako se privremena datoteka ne može izbrisati. "
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Otkaži"
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&Na ploču"
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Pregledaj sve"
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "&Trenutna radnja:"
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Iz:"
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Ka:"
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zatvori"
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "&Podesite svojstva"
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "Dodeli svim odabranim datotekama"
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Preskoči& ovu datoteku "
#: tfrmfileproperties.caption
msgctxt "TFRMFILEPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Svojstva"
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Ljepljivo"
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Vlasnik"
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bita:"
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Udruženje"
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Drugo"
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlasnik"
#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Tekst:"
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Sadrži:"
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Izvrši"
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Ime datoteke"
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Ime datoteke"
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Putanja:"
#: tfrmfileproperties.lblgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
msgid "&Group"
msgstr "&Udruženje"
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Posljednji pristup:"
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Posljednja izmena:"
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Poslednja izmena stanja:"
#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Oktalno:"
#: tfrmfileproperties.lblownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
msgid "O&wner"
msgstr "Vlasnik&"
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čitanje"
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Veličina:"
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Veza ka:"
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Vrsta:"
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Pisanje"
#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Ime"
#: tfrmfileproperties.sgimage.columns[1].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Vrijednost"
#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Svojstva"
#: tfrmfileproperties.tsplugins.caption
#, fuzzy
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Priključci"
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Svojstva"
#: tfrmfinddlg.actcancel.caption
#, fuzzy
#| msgid "actCancel"
msgid "C&ancel"
msgstr "akcija otkaži"
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr ""
#: tfrmfinddlg.actclose.caption
#, fuzzy
#| msgid "actClose"
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "akcija zatvori"
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
#, fuzzy
#| msgid "actEdit"
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "akcija Uredi"
#: tfrmfinddlg.actfeedtolistbox.caption
#, fuzzy
#| msgid "actFeedToListbox"
msgid "Feed to &listbox"
msgstr "akcija Popunite popis"
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
#, fuzzy
#| msgid "actGoToFile"
msgid "&Go to file"
msgstr "akcija Idi na datoteku"
#: tfrmfinddlg.actintellifocus.caption
#, fuzzy
#| msgid "actIntelliFocus"
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "akcija IntelliFocus"
#: tfrmfinddlg.actlastsearch.caption
#, fuzzy
#| msgid "actLastSearch"
msgid "&Last search"
msgstr "akcija Zadnje pretraživanje"
#: tfrmfinddlg.actnewsearch.caption
#, fuzzy
#| msgid "actNewSearch"
msgid "&New search"
msgstr "akcija Novo pretraživanje"
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
#, fuzzy
#| msgid "actPageAdvanced"
msgid "Go to page \"Advanced\""
msgstr "akcija Napredna stranica"
#: tfrmfinddlg.actpageloadsave.caption
#, fuzzy
#| msgid "actPageLoadSave"
msgid "Go to page \"Load/Save\""
msgstr "akcija Spremanja i usnimavanja stranice"
#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
#, fuzzy
#| msgid "actPagePlugins"
msgid "Go to page \"Plugins\""
msgstr "akcija Ulomka stranica"
#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""
#: tfrmfinddlg.actpageresults.caption
#, fuzzy
#| msgid "actPageResults"
msgid "Go to page \"Results\""
msgstr "akcija Rezultati stranice "
#: tfrmfinddlg.actpagestandard.caption
#, fuzzy
#| msgid "actPageStandard"
msgid "Go to page \"Standard\""
msgstr "akcija Standardna stranica"
#: tfrmfinddlg.actstart.caption
#, fuzzy
#| msgid "actStart"
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "akcija pokrenite radnju"
#: tfrmfinddlg.actview.caption
#, fuzzy
#| msgid "actView"
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "akcija Pregled"
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Dodaj&"
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Pomoć"
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr "&Snimi"
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "U&čitaj"
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "Snimi&"
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "Snimi kao „Početak u mapi“"
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Ako se snimi, „Početak u mapi“ će biti povraćen prilikom učitavanja obrasca. Upotrebite to ako želite da primijenite pretragu na određenu mapu"
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Koristi obrazac"
#: tfrmfinddlg.caption
msgctxt "TFRMFINDDLG.CAPTION"
msgid "Find files"
msgstr "Pronađi datoteke"
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "O&setljivo na veličinu slova"
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "Od &datuma:"
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "Do &datuma:"
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "Od &veličine:"
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Do &veličine:"
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "Omogući pretraživanje arhivia"
#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "Pronađi &tekst u datoteci"
#: tfrmfinddlg.cbfollowsymlinks.caption
msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION"
msgid "Follow s&ymlinks"
msgstr "Prati &simboličke veze"
#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "Pronađi datoteke koje ne& sadrže tekst"
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Ne& starije od:"
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr ""
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Traži& po djelu imena datoteke"
#: tfrmfinddlg.cbregexp.caption
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "&Regularni izraz"
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "Zameni& sa"
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Označi mape i &datoteke"
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "&Regularni izraz"
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "Od &vremena:"
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "Do vre&mena:"
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "&Koristi priključak za pretragu:"
#: tfrmfinddlg.chkhex.caption
msgid "Hexadecimal"
msgstr ""
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Unesite imena mapa koji bi trebali biti isključeni iz pretrage odvojene znakom \";\""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Unesite imena datoteka koje bi trebale biti isključene iz pretrage odvojene znakom \";\""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Unesite imena datoteka razdvojena znakom \";\""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION"
msgid "Directories"
msgstr "Mape"
#: tfrmfinddlg.gbfiles.caption
msgctxt "TFRMFINDDLG.GBFILES.CAPTION"
msgid "Files"
msgstr "Datoteke"
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "Pronađi podatke"
#: tfrmfinddlg.lblattributes.caption
msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION"
msgid "Attri&butes"
msgstr "Odrednice&"
#: tfrmfinddlg.lblencoding.caption
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
msgid "Encodin&g:"
msgstr "&Šifriranje:"
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "I&zuzmi podmape"
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "&Izuzmi datoteke"
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "&Maska datoteke"
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "Počni u &mapi"
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "traži u &podmapi:"
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Prethodne pretrage:"
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "Otvori u novoj kartici"
#: tfrmfinddlg.mioptions.caption
#, fuzzy
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Mogućnosti"
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Ukloni sa spiska"
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Prikaži sve pronađene stavke"
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "Pokaži u uređivaču"
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Prikaži u pregledniku"
#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Pregled"
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Napredno"
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Učitaj/Sačuvaj"
#: tfrmfinddlg.tsplugins.caption
msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION"
msgid "Plugins"
msgstr "Priključci"
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Izlazi"
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Standardno"
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Pronađi"
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Pronađi"
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "O&setljivo na veličinu slova"
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Napravi čvrstu vezu"
#: tfrmhardlink.lblexistingfile.caption
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Odredište na koje će veza biti usmerena"
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Ime &veze"
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTALL.CAPTION"
msgid "Import all!"
msgstr "Uvezi sve!"
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "TFRMHOTDIREXPORTIMPORT.BTNSELECTIONDONE.CAPTION"
msgid "Import selected"
msgstr "Uvezi izabrano"
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr "Izaberite stavke koje želite uvesti"
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Klikom na podizbornik će se izabrati cijeli izbornik"
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Držite CTRL i kliknite na stavke radi izbora više njih"
#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmlinker.caption
msgctxt "TFRMLINKER.CAPTION"
msgid "Linker"
msgstr "Usmerivač"
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Kopiraj u..."
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Stavka"
#: tfrmlinker.lblfilename.caption
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "&Ime datoteke"
#: tfrmlinker.spbtndown.caption
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "Dolje&"
#: tfrmlinker.spbtndown.hint
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
msgid "Down"
msgstr "Dolje"
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "Ukloni&"
#: tfrmlinker.spbtnrem.hint
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "Obriši"
#: tfrmlinker.spbtnup.caption
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "&gore"
#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Gore"
#: tfrmmain.actabout.caption
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
msgid "&About"
msgstr "&O programu"
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Dodaj ime datoteke u naredbenu liniju"
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Dodaj putanju i ime datoteke u naredbenu liniju"
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "Kopiraj putanju u naredbenu liniju"
#: tfrmmain.actbenchmark.caption
msgid "&Benchmark"
msgstr ""
#: tfrmmain.actbriefview.caption
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr "Sažeto"
#: tfrmmain.actbriefview.hint
msgctxt "tfrmmain.actbriefview.hint"
msgid "Brief View"
msgstr "Sažeti pregled"
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Izračunaj zauzeće prostora"
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Promeni mapu"
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Pređi na mapu korisnika"
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "Pređi u roditeljsku mapu"
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Pređi u izvorno sistemsku mapu"
#: tfrmmain.actchecksumcalc.caption
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "Računanje zbirne &provere..."
#: tfrmmain.actchecksumverify.caption
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "&Provera zbroja..."
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Očisti dnevničku datoteku"
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Očisti prozor dnevničke datoteke"
#: tfrmmain.actclosealltabs.caption
msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION"
msgid "Close &All Tabs"
msgstr "Zatvori &sve kartice"
#: tfrmmain.actcloseduplicatetabs.caption
msgctxt "tfrmmain.actcloseduplicatetabs.caption"
msgid "Close Duplicate Tabs"
msgstr "Zatvori duple kartice"
#: tfrmmain.actclosetab.caption
msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION"
msgid "&Close Tab"
msgstr "&Zatvori karticu"
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Sledeća naredbena linija"
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Postavi sledeću naredbu iz istorije u naredbenu liniju"
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Prethodna naredbena linija"
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Postavi prethodnu naredbu iz istorije u naredbenu liniju"
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Potpuno"
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Pregled u vidu stupaca"
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Usporedi po &sadržaju"
#: tfrmmain.actcomparedirectories.caption
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
msgid "Compare Directories"
msgstr "Usporedba mapa"
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Usporedba mapa"
#: tfrmmain.actconfigarchivers.caption
msgid "Configuration of Archivers"
msgstr ""
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Postavke brzog spiska mapa"
#: tfrmmain.actconfigfavoritetabs.caption
msgctxt "tfrmmain.actconfigfavoritetabs.caption"
msgid "Configuration of Favorite Tabs"
msgstr "Uređivanje omiljenih kartica"
#: tfrmmain.actconfigfoldertabs.caption
msgctxt "tfrmmain.actconfigfoldertabs.caption"
msgid "Configuration of folder tabs"
msgstr "Podešavanje kartica mapa"
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr ""
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Alatna traka"
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "Prikaži priručni izbornik"
#: tfrmmain.actcopy.caption
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Kopirajte sve kartice u suprotni prozor"
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Kopiraj sve prikazane &stupce"
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Kopiraj potpunu putanju sa imenima datoteka"
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Kopiraj imena datoteka u međuspremnik"
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Kopiraj datoteke bez pitanja za potvrdu"
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr "Kopiranje cijelog puta odabranih datoteka bez završnog razdvajanja"
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Kopiranje cijelog puta odabrane datoteke"
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Kopiraj u istu table"
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Kopiraj"
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "&Prikaži zauzeće memorije"
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "&Iseci"
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Prikaži parametre naredbe"
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "Povijest mapa"
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Brzi spisak &mapa"
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Odaberite bilo koju naredbu za pokretanje"
#: tfrmmain.actedit.caption
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Uredi"
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Uredi &napomenu..."
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Uredi novu datoteku"
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Uredi polje putanje iznad spiska"
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "Zamjeni table"
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Napusti"
#: tfrmmain.actextractfiles.caption
msgctxt "tfrmmain.actextractfiles.caption"
msgid "&Extract Files..."
msgstr "&Izvuci datoteke..."
#: tfrmmain.actfileassoc.caption
msgctxt "tfrmmain.actfileassoc.caption"
msgid "Configuration of File &Associations"
msgstr "Pridruživanje &datoteka..."
#: tfrmmain.actfilelinker.caption
msgctxt "tfrmmain.actfilelinker.caption"
msgid "Com&bine Files..."
msgstr "&Spoji datoteke..."
#: tfrmmain.actfileproperties.caption
msgctxt "tfrmmain.actfileproperties.caption"
msgid "Show &File Properties"
msgstr "Prikaži svojstva &datoteka"
#: tfrmmain.actfilespliter.caption
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
msgid "Spl&it File..."
msgstr "Podeli& datoteku..."
#: tfrmmain.actflatview.caption
msgctxt "tfrmmain.actflatview.caption"
msgid "&Flat view"
msgstr "&Ravan prikaz"
#: tfrmmain.actfocuscmdline.caption
msgctxt "tfrmmain.actfocuscmdline.caption"
msgid "Focus command line"
msgstr "Žiža na naredbenu liniju"
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgctxt "tfrmmain.actgotofirstfile.caption"
msgid "Place cursor on first file in list"
msgstr "Postavi pokazivač na prvu datoteku kartice"
#: tfrmmain.actgotolastfile.caption
msgctxt "tfrmmain.actgotolastfile.caption"
msgid "Place cursor on last file in list"
msgstr "Postavi pokazivač na posljednju datoteku kartice"
#: tfrmmain.acthardlink.caption
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
msgid "Create &Hard Link..."
msgstr "Napravi &čvrstu vezu..."
#: tfrmmain.acthelpindex.caption
msgctxt "tfrmmain.acthelpindex.caption"
msgid "&Contents"
msgstr "&Sadržaj"
#: tfrmmain.acthorizontalfilepanels.caption
msgctxt "tfrmmain.acthorizontalfilepanels.caption"
msgid "&Horizontal Panels Mode"
msgstr "&Vodoravan prikaz tabli"
#: tfrmmain.actkeyboard.caption
msgctxt "tfrmmain.actkeyboard.caption"
msgid "&Keyboard"
msgstr "&Tastatura"
#: tfrmmain.actleftbriefview.caption
msgctxt "tfrmmain.actleftbriefview.caption"
msgid "Brief view on left panel"
msgstr "Sažet pogled lijeve ploče"
#: tfrmmain.actleftcolumnsview.caption
msgctxt "tfrmmain.actleftcolumnsview.caption"
msgid "Columns view on left panel"
msgstr "Prikaz stupaca na lijevoj ploči"
#: tfrmmain.actleftequalright.caption
msgctxt "tfrmmain.actleftequalright.caption"
msgid "Left &= Right"
msgstr "lijevo &= Desno"
#: tfrmmain.actleftflatview.caption
msgctxt "tfrmmain.actleftflatview.caption"
msgid "&Flat view on left panel"
msgstr "Ravni pogled na lijevu ploču"
#: tfrmmain.actleftopendrives.caption
msgctxt "tfrmmain.actleftopendrives.caption"
msgid "Open left drive list"
msgstr "Otvori spisak lijevog uređaja"
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Pr&eokrenuti redosljed na lijevoj ploči"
#: tfrmmain.actleftsortbyattr.caption
msgctxt "tfrmmain.actleftopendrives.caption"
msgid "Sort left panel by &Attributes"
msgstr "Sortiraj lijevi prozor prema &Atributima"
#: tfrmmain.actleftsortbydate.caption
msgctxt "tfrmmain.actleftsortbydate.caption"
msgid "Sort left panel by &Date"
msgstr "Poredaj u lijevoj ploči po datumu"
#: tfrmmain.actleftsortbyext.caption
msgctxt "tfrmmain.actleftsortbyext.caption"
msgid "Sort left panel by &Extension"
msgstr "Poredaj u lijevoj ploči po tipu datoteke"
#: tfrmmain.actleftsortbyname.caption
msgctxt "tfrmmain.actleftsortbyname.caption"
msgid "Sort left panel by &Name"
msgstr "Poredaj u lijevoj ploči abecedi"
#: tfrmmain.actleftsortbysize.caption
msgctxt "tfrmmain.actleftsortbysize.caption"
msgid "Sort left panel by &Size"
msgstr "Poredaj u lijevoj ploči po veličini"
#: tfrmmain.actleftthumbview.caption
msgctxt "tfrmmain.actleftthumbview.caption"
msgid "Thumbnails view on left panel"
msgstr "Prikaz ikona na lijevoj ploči"
#: tfrmmain.actloadfavoritetabs.caption
msgctxt "tfrmmain.actloadfavoritetabs.caption"
msgid "Load tabs from Favorite Tabs"
msgstr "Usnimi karticu iz omiljene kartice"
#: tfrmmain.actloadselectionfromclip.caption
msgctxt "tfrmmain.actloadselectionfromclip.caption"
msgid "Load Selection from Clip&board"
msgstr "Učitaj sadržaj međuspremnika"
#: tfrmmain.actloadselectionfromfile.caption
msgctxt "tfrmmain.actloadselectionfromfile.caption"
msgid "&Load Selection from File..."
msgstr "&Učitaj izbor iz datoteke..."
#: tfrmmain.actloadtabs.caption
msgctxt "tfrmmain.actloadtabs.caption"
msgid "&Load Tabs from File"
msgstr "&Učitaj kartice iz datoteke"
#: tfrmmain.actmakedir.caption
msgctxt "tfrmmain.actmakedir.caption"
msgid "Create &Directory"
msgstr "Napravi &Mapu"
#: tfrmmain.actmarkcurrentextension.caption
msgctxt "tfrmmain.actmarkcurrentextension.caption"
msgid "Select All with the Same E&xtension"
msgstr "Označi sve sa istim nastavkom&"
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
msgctxt "tfrmmain.actmarkinvert.caption"
msgid "&Invert Selection"
msgstr "&Okreni izbor"
#: tfrmmain.actmarkmarkall.caption
msgctxt "tfrmmain.actmarkmarkall.caption"
msgid "&Select All"
msgstr "&Označi sve"
#: tfrmmain.actmarkminus.caption
msgctxt "tfrmmain.actmarkminus.caption"
msgid "Unselect a Gro&up..."
msgstr "Poništi izbor &skupa..."
#: tfrmmain.actmarkplus.caption
msgctxt "tfrmmain.actmarkminus.caption"
msgid "Select a &Group..."
msgstr "Izaberi &skup..."
#: tfrmmain.actmarkunmarkall.caption
msgctxt "tfrmmain.actmarkunmarkall.caption"
msgid "&Unselect All"
msgstr "&Odznači sve"
#: tfrmmain.actminimize.caption
msgctxt "tfrmmain.actminimize.caption"
msgid "Minimize window"
msgstr "Umanji prozor"
#: tfrmmain.actmultirename.caption
msgctxt "tfrmmain.actmultirename.caption"
msgid "Multi &Rename Tool"
msgstr "Pribor za masovno &preimenovanje"
#: tfrmmain.actnetworkconnect.caption
msgctxt "tfrmmain.actnetworkconnect.caption"
msgid "Network &Connect..."
msgstr "Uspostavi mrežnu &vezu..."
#: tfrmmain.actnetworkdisconnect.caption
msgctxt "tfrmmain.actnetworkdisconnect.caption"
msgid "Network &Disconnect"
msgstr "Prekini mrežnu &vezu"
#: tfrmmain.actnetworkquickconnect.caption
msgctxt "tfrmmain.actnetworkquickconnect.caption"
msgid "Network &Quick Connect..."
msgstr "&Brza mrežna veza..."
#: tfrmmain.actnewtab.caption
msgctxt "tfrmmain.actnewtab.caption"
msgid "&New Tab"
msgstr "&Nova kartica"
#: tfrmmain.actnextfavoritetabs.caption
msgctxt "tfrmmain.actnextfavoritetabs.caption"
msgid "Load the Next Favorite Tabs in the list"
msgstr "Učitaj sljedeće omiljene table na karticu"
#: tfrmmain.actnexttab.caption
#, fuzzy
msgctxt "tfrmmain.actnexttab.caption"
msgid "Switch to Nex&t Tab"
msgstr "Pređi na &sljedeću karticu"
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Otvori"
#: tfrmmain.actopenarchive.caption
msgctxt "tfrmmain.actopenarchive.caption"
msgid "Try open archive"
msgstr "Pokušaj otvoriti arhivu"
#: tfrmmain.actopenbar.caption
msgctxt "tfrmmain.actopenbar.caption"
msgid "Open bar file"
msgstr "Otvori datoteku sa trake"
#: tfrmmain.actopendirinnewtab.caption
msgctxt "tfrmmain.actopendirinnewtab.caption"
msgid "Open &Folder in a New Tab"
msgstr "Otvori &Mapu u novoj kartici"
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
msgid "Open &VFS List"
msgstr "Otvori &VFS spisak"
#: tfrmmain.actoperationsviewer.caption
msgctxt "tfrmmain.actoperationsviewer.caption"
msgid "Operations &Viewer"
msgstr "Preglednik &napretka radnji"
#: tfrmmain.actoptions.caption
msgctxt "tfrmmain.actoptions.caption"
msgid "&Options..."
msgstr "&Mogućnosti..."
#: tfrmmain.actpackfiles.caption
msgctxt "tfrmmain.actpackfiles.caption"
msgid "&Pack Files..."
msgstr "&Arhivirati sažimanjem datoteke..."
#: tfrmmain.actpanelssplitterperpos.caption
msgctxt "tfrmmain.actpanelssplitterperpos.caption"
msgid "Set splitter position"
msgstr "Podesite položaj djeljenja"
#: tfrmmain.actpastefromclipboard.caption
msgctxt "tfrmmain.actpastefromclipboard.caption"
msgid "&Paste"
msgstr "&Priljepi"
#: tfrmmain.actpreviousfavoritetabs.caption
msgctxt "tfrmmain.actpreviousfavoritetabs.caption"
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Učitaj sljedeće omiljene table na karticu"
#: tfrmmain.actprevtab.caption
msgctxt "tfrmmain.actprevtab.caption"
msgid "Switch to &Previous Tab"
msgstr "Pređi na &prethodni list"
#: tfrmmain.actquickfilter.caption
msgctxt "tfrmmain.actquickfilter.caption"
msgid "Quick filter"
msgstr "Brzi propusnik"
#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Brza pretraga"
#: tfrmmain.actquickview.caption
msgctxt "tfrmmain.actquickview.caption"
msgid "&Quick View Panel"
msgstr "&table za brzi pregled"
#: tfrmmain.actrefresh.caption
msgctxt "tfrmmain.actrefresh.caption"
msgid "&Refresh"
msgstr "&Osvježi"
#: tfrmmain.actreloadfavoritetabs.caption
msgctxt "tfrmmain.actreloadfavoritetabs.caption"
msgid "Reload the last Favorite Tabs loaded"
msgstr "Ponovno učitajte posljednje učitane kartice "
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Premjesti"
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Premještanje i preimenovanje datoteke bez pitanja za potvrdu"
#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Preimenovanje"
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "&Preimenovanje kartice"
#: tfrmmain.actresavefavoritetabs.caption
msgctxt "tfrmmain.actresavefavoritetabs.caption"
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Ponovo učitaj posljednje učitane table "
#: tfrmmain.actrestoreselection.caption
msgctxt "tfrmmain.actrestoreselection.caption"
msgid "&Restore Selection"
msgstr "&Povrati izbor"
#: tfrmmain.actreverseorder.caption
msgctxt "tfrmmain.actreverseorder.caption"
msgid "Re&verse Order"
msgstr "&Obrnuti redosled"
#: tfrmmain.actrightbriefview.caption
msgctxt "tfrmmain.actrightbriefview.caption"
msgid "Brief view on right panel"
msgstr "Kratak prikaz na desnoj ploči"
#: tfrmmain.actrightcolumnsview.caption
msgctxt "tfrmmain.actrightcolumnsview.caption"
msgid "Columns view on right panel"
msgstr "Prikaz stupaca na desnoj ploči"
#: tfrmmain.actrightequalleft.caption
msgctxt "tfrmmain.actrightequalleft.caption"
msgid "Right &= Left"
msgstr "Desno &= lijevo"
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "Ravni prikaz na desnoj ploči"
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Otvori spisak desnog uređaja"
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "preokrenuti prikaz na desnoj ploči"
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Sortiraj desnu ploču prema &Atributima"
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Sortiraj desnu ploču prema &Datumu"
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Sortiraj desnu ploču prema tipu &Datoteka"
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Sortiraj desnu ploču prema &Nazivu datoteka "
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Sortiraj desnu ploču prema &veličini datoteka"
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Prikaz ikona na desnoj ploči"
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Pokreni u &terminalu"
#: tfrmmain.actsavefavoritetabs.caption
msgctxt "tfrmmain.actsavefavoritetabs.caption"
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Spremi otvorenu karticu u novu omiljenu"
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "&Kopiraj izbor"
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Kopiraj &izbor u datoteku..."
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "&Kopiraj kartice u datoteku"
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Traži..."
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Sve kartice Zaključane s mapama otvaraju se u novim karticama"
#: tfrmmain.actsetalltabsoptionnormal.caption
msgctxt "tfrmmain.actsetalltabsoptionnormal.caption"
msgid "Set all tabs to Normal"
msgstr "Postavljanje svih kartica na uobičajene vrijednosti"
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgctxt "tfrmmain.actsetalltabsoptionpathlocked.caption"
msgid "Set all tabs to Locked"
msgstr "Onemogučavanje promjena na svim karticama"
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgctxt "tfrmmain.actsetalltabsoptionpathresets.caption"
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Dopuštanje promjena na svim karticama"
#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "Promjeni &svojstva..."
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgctxt "tfrmmain.actsettaboptiondirsinnewtab.caption"
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Zaključano sa mapom otvorenom u novoj &kartici"
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Obično"
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Zaključano"
#: tfrmmain.actsettaboptionpathresets.caption
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
msgid "Locked with &Directory Changes Allowed"
msgstr "Zaključeno sa dozvolom izmene &mapa"
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr "Otvori"
#: tfrmmain.actshellexecute.hint
msgctxt "tfrmmain.actshellexecute.hint"
msgid "Open using system associations"
msgstr "Otvori koristeći pridruživanje datoteka"
#: tfrmmain.actshowbuttonmenu.caption
msgctxt "tfrmmain.actshowbuttonmenu.caption"
msgid "Show button menu"
msgstr "Prikaži izbornik gumba"
#: tfrmmain.actshowcmdlinehistory.caption
msgctxt "tfrmmain.actshowcmdlinehistory.caption"
msgid "Show command line history"
msgstr "prikaži povijest naredbi"
#: tfrmmain.actshowmainmenu.caption
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Izbornik"
#: tfrmmain.actshowsysfiles.caption
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "prikaži &skrivene i sistemske datoteke"
#: tfrmmain.actsortbyattr.caption
msgctxt "tfrmmain.actsortbyattr.caption"
msgid "Sort by &Attributes"
msgstr "Posloži po &svojstvima"
#: tfrmmain.actsortbydate.caption
msgctxt "tfrmmain.actsortbydate.caption"
msgid "Sort by &Date"
msgstr "Posloži po &datumu"
#: tfrmmain.actsortbyext.caption
msgctxt "tfrmmain.actsortbyext.caption"
msgid "Sort by &Extension"
msgstr "Posloži po &nastavku"
#: tfrmmain.actsortbyname.caption
msgctxt "tfrmmain.actsortbyname.caption"
msgid "Sort by &Name"
msgstr "Posloži po &imenu"
#: tfrmmain.actsortbysize.caption
msgctxt "tfrmmain.actsortbysize.caption"
msgid "Sort by &Size"
msgstr "Posloži po &veličini"
#: tfrmmain.actsrcopendrives.caption
msgctxt "tfrmmain.actsrcopendrives.caption"
msgid "Open drive list"
msgstr "Otvori listu uređaja"
#: tfrmmain.actswitchignorelist.caption
msgctxt "tfrmmain.actswitchignorelist.caption"
msgid "Enable/disable ignore list file to not show file names"
msgstr "Omogući/onemogući prikaz zanemarenih datoteka sa spiska"
#: tfrmmain.actsymlink.caption
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "Napravi simboličku &vezu..."
#: tfrmmain.actsyncdirs.caption
msgctxt "tfrmmain.actsyncdirs.caption"
msgid "Synchronize dirs..."
msgstr "Usklađivanje mapa..."
#: tfrmmain.acttargetequalsource.caption
msgctxt "tfrmmain.acttargetequalsource.caption"
msgid "Target &= Source"
msgstr "Cilj = izvor"
#: tfrmmain.acttestarchive.caption
msgctxt "tfrmmain.acttestarchive.caption"
msgid "&Test Archive(s)"
msgstr "&Provjeri arhivu"
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Ikone"
#: tfrmmain.actthumbnailsview.hint
msgctxt "tfrmmain.actthumbnailsview.hint"
msgid "Thumbnails View"
msgstr "Pregled ikona"
#: tfrmmain.acttogglefullscreenconsole.caption
msgctxt "tfrmmain.actthumbnailsview.hint"
msgid "Toggle fullscreen mode console"
msgstr "Prebacivanje na konzolu s prikazom preko cijelog zaslona"
#: tfrmmain.acttransferleft.caption
msgctxt "tfrmmain.acttransferleft.caption"
msgid "Transfer dir under cursor to left window"
msgstr "Premjesti mape pod pokazivačem na levi prozor"
#: tfrmmain.acttransferright.caption
msgctxt "tfrmmain.acttransferright.caption"
msgid "Transfer dir under cursor to right window"
msgstr "Premjesti mape pod pokazivačem na desni prozor"
#: tfrmmain.acttreeview.caption
msgctxt "tfrmmain.acttreeview.caption"
msgid "&Tree View Panel"
msgstr "Ploča za pregled grananja mapa"
#: tfrmmain.actuniversalsingledirectsort.caption
msgctxt "tfrmmain.actuniversalsingledirectsort.caption"
msgid "Sort according to parameters"
msgstr "Sortiraj prema parametrima"
#: tfrmmain.actunmarkcurrentextension.caption
msgctxt "tfrmmain.actunmarkcurrentextension.caption"
msgid "Unselect All with the Same Ex&tension"
msgstr "Odznači sve sa istim nastavkom&"
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Pregled"
#: tfrmmain.actviewhistory.caption
msgctxt "tfrmmain.actviewhistory.caption"
msgid "Show history of visited paths for active view"
msgstr "Prikaži povijest posećenih putanja pod ovakvim pregledom"
#: tfrmmain.actviewhistorynext.caption
msgctxt "tfrmmain.actviewhistorynext.caption"
msgid "Go to next entry in history"
msgstr "Idi na sljedeću stavku povijesti"
#: tfrmmain.actviewhistoryprev.caption
msgctxt "tfrmmain.actviewhistoryprev.caption"
msgid "Go to previous entry in history"
msgstr "Idi na prethodnu stavku povijesti"
#: tfrmmain.actviewlogfile.caption
msgctxt "tfrmmain.actviewlogfile.caption"
msgid "View log file"
msgstr "Pregled dnevničke datoteke"
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
msgctxt "tfrmmain.actvisithomepage.caption"
msgid "&Visit Double Commander Website"
msgstr "&Posetite Veb stranicu Double Commander-a"
#: tfrmmain.actwipe.caption
msgctxt "frmmain.actwipe.caption"
msgid "Wipe"
msgstr "Briši potpuno"
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgctxt "tfrmmain.actworkwithdirectoryhotlist.caption"
msgid "Work with Directory Hotlist and parameters"
msgstr "Rad s kazalima Hotlist-a i parametrima"
#: tfrmmain.btnf10.caption
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Izlaz"
#: tfrmmain.btnf7.caption
msgctxt "TFRMMAIN.BTNF7.CAPTION"
msgid "Directory"
msgstr "mapa"
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminal"
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr "Brzi spisak mapa"
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"
#: tfrmmain.btnleftequalright.hint
msgctxt "tfrmmain.btnleftequalright.hint"
msgid "Show current directory of the right panel in the left panel"
msgstr "Prikaži trenutna mapa sa desne tablei na levu table"
#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnlefthome.hint
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
msgid "Go to home directory"
msgstr "Idi u korisničku mapu"
#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnleftroot.hint
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
msgid "Go to root directory"
msgstr "Idi u sistemsku mapu"
#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.btnleftup.hint
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
msgid "Go to parent directory"
msgstr "Idi u roditeljsku mapu"
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Brzi spisak mapa"
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"
#: tfrmmain.btnrightequalleft.hint
msgctxt "tfrmmain.btnrightequalleft.hint"
msgid "Show current directory of the left panel in the right panel"
msgstr "Prikaži trenutna mapa sa leve tablei na desnu table"
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Putanja"
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Otkaži"
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Umnožavanje..."
#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Stvaranje veze..."
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Očisti"
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmmain.miloghide.caption
msgctxt "tfrmmain.miloghide.caption"
msgid "Hide"
msgstr "Sakrij"
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Označi sve"
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Premjesti..."
#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Stvaranje simboličke veze..."
#: tfrmmain.mitaboptions.caption
msgctxt "tfrmmain.mitaboptions.caption"
msgid "Tab options"
msgstr "Mogućnosti kartice"
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "Izlaz&"
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Povrati"
#: tfrmmain.mnualloperpause.caption
msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr "Početak"
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr "Otkaži"
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Naredbe"
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "&Postavke"
#: tfrmmain.mnufavoritetabs.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
msgid "Favorites"
msgstr "Omiljeno"
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "Datoteke&"
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "Pomoć&"
#: tfrmmain.mnumark.caption
msgctxt "tfrmmain.mnumark.caption"
msgid "&Mark"
msgstr "Oznaka&"
#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "Mreža"
#: tfrmmain.mnushow.caption
msgctxt "tfrmmain.mnushow.caption"
msgid "&Show"
msgstr "Prikaži&"
#: tfrmmain.mnutaboptions.caption
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "&Podešavanje kartice"
#: tfrmmain.mnutabs.caption
msgctxt "tfrmmain.mnutabs.caption"
msgid "&Tabs"
msgstr "Kartice&"
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "CD"
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Iseci"
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "Izbriši"
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Uredi"
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Priljepi"
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&U redu"
#: tfrmmaincommandsdlg.caption
msgctxt "tfrmmaincommandsdlg.caption"
msgid "Select your internal command"
msgstr "Odabir korisničke naredbe"
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Nasljeđivanje je sortirano"
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr "Nasljeđivanje je sortirano"
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
#, fuzzy
msgctxt "tfrmmaincommandsdlg.cbselectallcategorydefault.caption"
msgid "Select all categories by default"
msgstr "Odabiranje svih kategorije prema zadanim postavkama"
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Izbor"
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "&Kategorije"
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "&Naziv naredbe"
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Filter:"
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Savjet:"
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Prečac"
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr "cm_ime"
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "Kategorija"
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Pomoć"
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Savjet"
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Prečac"
#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "Dodaj&"
#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "&Pomoć"
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Otkaži&"
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgctxt "tfrmmaskinputdlg.btndefinetemplate.caption"
msgid "&Define..."
msgstr "Opiši&..."
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "U redu&"
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr ""
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr ""
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "Ili& odaberi predodređenu vrstu izbora:"
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Otkaži&"
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "U redu&"
#: tfrmmkdir.caption
msgctxt "tfrmmkdir.caption"
msgid "Create new directory"
msgstr "Napravi novu mapu"
#: tfrmmkdir.lblmakedir.caption
msgctxt "tfrmmkdir.lblmakedir.caption"
msgid "&Input new directory name:"
msgstr "Unesite& ime nove mape:"
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmodview.caption
msgctxt "TFRMMODVIEW.CAPTION"
msgid "New Size"
msgstr "Nova veličina"
#: tfrmmodview.lblheight.caption
msgctxt "tfrmmodview.lblheight.caption"
msgid "Height :"
msgstr "Visina :"
#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"
#: tfrmmodview.lblpath2.caption
msgctxt "tfrmmodview.lblpath2.caption"
msgid "2"
msgstr "2"
#: tfrmmodview.lblpath3.caption
msgctxt "tfrmmodview.lblpath3.caption"
msgid "3"
msgstr "3"
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"
#: tfrmmodview.lblquality.caption
msgctxt "tfrmmodview.lblquality.caption"
msgid "Quality of compress to Jpg"
msgstr "Kakvoća sažimanjima JPG"
#: tfrmmodview.lblwidth.caption
msgctxt "tfrmmodview.lblwidth.caption"
msgid "Width :"
msgstr "Širina :"
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Visina"
#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"
#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Širina"
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "Zatvori&"
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "Izbriši&"
#: tfrmmultirename.btnedit.caption
#, fuzzy
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnloadpreset.caption
msgctxt "tfrmmultirename.btnloadpreset.caption"
msgid "&Load"
msgstr "Učitaj&"
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "Pre&imenuj"
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "Poništi sve&"
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "Snimi&"
#: tfrmmultirename.caption
msgctxt "TFRMMULTIRENAME.CAPTION"
msgid "MultiRename"
msgstr "Višestruko preimenovanje"
#: tfrmmultirename.cblog.caption
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "Omogući&"
#: tfrmmultirename.cbregexp.caption
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "Regularni &izrazi"
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "&Koristi zamenu"
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"
#: tfrmmultirename.extension.caption
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "[E] Extension"
msgstr "[E] nastavak"
#: tfrmmultirename.gbcounter.caption
msgctxt "tfrmmultirename.gbcounter.caption"
msgid "Counter"
msgstr "Brojač"
#: tfrmmultirename.gbfindreplace.caption
msgctxt "tfrmmultirename.gbfindreplace.caption"
msgid "Find && Replace"
msgstr "Nađi i zamjeni"
#: tfrmmultirename.gblog.caption
msgctxt "tfrmmultirename.gblog.caption"
msgid "Log Result"
msgstr "Izlazi datoteke događanja"
#: tfrmmultirename.gbmaska.caption
msgctxt "tfrmmultirename.gbmaska.caption"
msgid "Mask"
msgstr "Maska"
#: tfrmmultirename.gbpresets.caption
msgctxt "tfrmmultirename.gbpresets.caption"
msgid "Presets"
msgstr "Obrasci"
#: tfrmmultirename.lbext.caption
msgctxt "tfrmmultirename.lbext.caption"
msgid "&Extension"
msgstr "Nastavci&"
#: tfrmmultirename.lbfind.caption
msgctxt "frmmultirename.lbfind.caption"
msgid "&Find..."
msgstr "Pronađi&..."
#: tfrmmultirename.lbinterval.caption
msgctxt "tfrmmultirename.lbinterval.caption"
msgid "&Interval"
msgstr "&Međuvreme"
#: tfrmmultirename.lbname.caption
msgctxt "tfrmmultirename.lbname.caption"
msgid "File &Name"
msgstr "Ime datoteke"
#: tfrmmultirename.lbreplace.caption
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "Re&place..."
msgstr "Zamjeni&..."
#: tfrmmultirename.lbstnb.caption
msgctxt "tfrmmultirename.lbstnb.caption"
msgid "S&tart Number"
msgstr "Početni broj"
#: tfrmmultirename.lbwidth.caption
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "Širina&"
#: tfrmmultirename.micounter.caption
msgctxt "tfrmmultirename.micounter.caption"
msgid "[C] Counter"
msgstr "[C] Brojač"
#: tfrmmultirename.miday.caption
msgctxt "tfrmmultirename.miday.caption"
msgid "[D] Day"
msgstr "[D] dan"
#: tfrmmultirename.miday1.caption
msgctxt "tfrmmultirename.miday1.caption"
msgid "[DD] Day (2 digits)"
msgstr "[DD] dan (2 cifre)"
#: tfrmmultirename.miday2.caption
msgctxt "tfrmmultirename.miday2.caption"
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] dan u nedjelji (kratko, npr. „pon“)"
#: tfrmmultirename.miday3.caption
msgctxt "tfrmmultirename.miday3.caption"
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDD] dan u nedjelji (potpuno, npr. „ponedeljak“)"
#: tfrmmultirename.miextensionx.caption
msgctxt "tfrmmultirename.miextensionx.caption"
msgid "[Ex] Character at position x"
msgstr "[Ex] znak na položaju x"
#: tfrmmultirename.miextensionxx.caption
msgctxt "tfrmmultirename.miextensionxx.caption"
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y] znaci od položaja x do položaja y"
#: tfrmmultirename.mihour.caption
msgctxt "tfrmmultirename.mihour.caption"
msgid "[h] Hour"
msgstr "[h] sat"
#: tfrmmultirename.mihour1.caption
msgctxt "tfrmmultirename.mihour1.caption"
msgid "[hh] Hour (2 digits)"
msgstr "[hh] sat (2 znaka)"
#: tfrmmultirename.miminute.caption
msgctxt "tfrmmultirename.miminute.caption"
msgid "[n] Minute"
msgstr "[n] Minut"
#: tfrmmultirename.miminute1.caption
msgctxt "tfrmmultirename.miminute1.caption"
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minuta (2 znaka)"
#: tfrmmultirename.mimonth.caption
msgctxt "tfrmmultirename.mimonth.caption"
msgid "[M] Month"
msgstr "[M] Mejsec"
#: tfrmmultirename.mimonth1.caption
msgctxt "tfrmmultirename.mimonth1.caption"
msgid "[MM] Month (2 digits)"
msgstr "[MM] Mesec (2 znaka)"
#: tfrmmultirename.mimonth2.caption
msgctxt "tfrmmultirename.mimonth2.caption"
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Ime meseca (kratko, npr., „jan“)"
#: tfrmmultirename.mimonth3.caption
msgctxt "tfrmmultirename.mimonth3.caption"
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Ime meseca (puno, npr., „januar“)"
#: tfrmmultirename.miname.caption
msgctxt "tfrmmultirename.miname.caption"
msgid "[N] Name"
msgstr "[N] Ime"
#: tfrmmultirename.minamex.caption
msgctxt "tfrmmultirename.minamex.caption"
msgid "[Nx] Character at position x"
msgstr "[Nx] znak na položaju x"
#: tfrmmultirename.minamexx.caption
msgctxt "tfrmmultirename.minamexx.caption"
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] znaci od položaja x do položaja y"
#: tfrmmultirename.minext.caption
msgctxt "tfrmmultirename.minext.caption"
msgid "Time..."
msgstr "Vrijeme..."
#: tfrmmultirename.minextextension.caption
msgctxt "tfrmmultirename.minextextension.caption"
msgid "Extension..."
msgstr "Nastavak..."
#: tfrmmultirename.minextname.caption
msgctxt "tfrmmultirename.minextname.caption"
msgid "Name..."
msgstr "Ime..."
#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Priključak"
#: tfrmmultirename.misecond.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "[s] Second"
msgstr "[s] Sekund"
#: tfrmmultirename.misecond1.caption
msgctxt "tfrmmultirename.misecond1.caption"
msgid "[ss] Second (2 digits)"
msgstr "[ss] Sekund (2 znaka)"
#: tfrmmultirename.miyear.caption
msgctxt "tfrmmultirename.miyear.caption"
msgid "[Y] Year (2 digits)"
msgstr "[Y] Godina (2 znaka)"
#: tfrmmultirename.miyear1.caption
msgctxt "tfrmmultirename.miyear1.caption"
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Godina (4 znaka)"
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr ""
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr ""
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION"
msgid "Old File Name"
msgstr "Staro ime datoteke"
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION"
msgid "New File Name"
msgstr "Novo ime datoteke"
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION"
msgid "File Path"
msgstr "Putanja datoteke"
#: tfrmmultirenamewait.caption
#, fuzzy
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgctxt "tfrmopenwith.caption"
msgid "Choose an application"
msgstr "Izaberite program"
#: tfrmopenwith.chkcustomcommand.caption
msgctxt "tfrmopenwith.chkcustomcommand.caption"
msgid "Custom command"
msgstr "Prilagođena naredba"
#: tfrmopenwith.chksaveassociation.caption
msgctxt "tfrmopenwith.chksaveassociation.caption"
msgid "Save association"
msgstr "Kopiraj pridruživanje"
#: tfrmopenwith.chkuseasdefault.caption
msgctxt "tfrmopenwith.chkuseasdefault.caption"
msgid "Set selected application as default action"
msgstr "Postavi izabrani program kao podrazumijevani program"
#: tfrmopenwith.lblmimetype.caption
msgctxt "tfrmopenwith.lblmimetype.caption"
msgid "File type to be opened: %s"
msgstr "Vrsta datoteke koja će biti otvorena: %s"
#: tfrmopenwith.milistoffiles.caption
msgctxt "tfrmopenwith.milistoffiles.caption"
msgid "Multiple file names"
msgstr "Višestruka imena datoteka"
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr "%F"
#: tfrmopenwith.milistofurls.caption
msgctxt "tfrmopenwith.milistofurls.caption"
msgid "Multiple URIs"
msgstr "Višestruke adrese"
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr "%U"
#: tfrmopenwith.misinglefilename.caption
msgctxt "tfrmopenwith.misinglefilename.caption"
msgid "Single file name"
msgstr "Jedno ime datoteke"
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr "%f"
#: tfrmopenwith.misingleurl.caption
msgctxt "tfrmopenwith.misingleurl.caption"
msgid "Single URI"
msgstr "Jedna adresa"
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr "%u"
#: tfrmoptions.btnapply.caption
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
msgid "&Apply"
msgstr "Primeni&"
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Otkaži&"
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "U redu&"
#: tfrmoptions.caption
msgctxt "TFRMOPTIONS.CAPTION"
msgid "Options"
msgstr "Mogućnosti"
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Izaberite jednu podstranicu, ova stranica ne sadrži ni jednu postavku."
#: tfrmoptionsarchivers.btnarchiveradd.caption
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
msgid "A&dd"
msgstr "D&odaj"
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverapply.caption
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
msgid "A&pply"
msgstr "P&rimjeni"
#: tfrmoptionsarchivers.btnarchivercopy.caption
msgid "Cop&y"
msgstr "Kopiraj"
#: tfrmoptionsarchivers.btnarchiverdelete.caption
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
msgid "Delete"
msgstr "I&zbriši"
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchiverother.caption
msgid "Oth&er..."
msgstr "Ostalo..."
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmoptionsarchivers.btnarchiverrename.caption
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
msgid "&Rename"
msgstr "&Preimenovanje"
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
msgid "Variable reminder helper"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiverids.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
msgstr ""
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
msgid "Options:"
msgstr "Mogućnosti:"
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
msgid "Format parsing mode:"
msgstr "Način rada raščlanjivanja oblika:"
#: tfrmoptionsarchivers.chkarchiverenabled.caption
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
msgid "E&nabled"
msgstr "O&mogućen"
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
msgid "De&bug mode"
msgstr "Način otklanjanja &grešaka"
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
msgid "S&how console output"
msgstr "P&rikaži izlaz iz konzole"
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
msgid "Uni&x file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
msgid "&Unix path delimiter \"/\""
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
msgid "Windows &file attributes"
msgstr ""
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
msgid "Windows path deli&miter \"\\\""
msgstr ""
#: tfrmoptionsarchivers.lblarchiveradd.caption
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
msgid "Add&ing:"
msgstr "Dod&ajem:"
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
msgid "Arc&hiver:"
msgstr "Arh&ivar:"
#: tfrmoptionsarchivers.lblarchiverdelete.caption
msgid "De&lete:"
msgstr "Izbriši:"
#: tfrmoptionsarchivers.lblarchiverdescription.caption
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
msgid "De&scription:"
msgstr "Opis&:"
#: tfrmoptionsarchivers.lblarchiverextension.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
msgid "E&xtension:"
msgstr "T&ip datoteke:"
#: tfrmoptionsarchivers.lblarchiverextract.caption
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
msgid "Ex&tract:"
msgstr "Izdvoji&:"
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
msgid "Extract &without path:"
msgstr "Izdvoji bez putanje:"
#: tfrmoptionsarchivers.lblarchiveridposition.caption
msgid "ID Po&sition:"
msgstr "Položaj LB:"
#: tfrmoptionsarchivers.lblarchiverids.caption
msgid "&ID:"
msgstr "LB:"
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
msgid "ID See&k Range:"
msgstr "Područje traženja ID-a:"
#: tfrmoptionsarchivers.lblarchiverlist.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
msgid "&List:"
msgstr "Popis&:"
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
msgid "Archi&vers:"
msgstr "Programi za sažimanje:"
#: tfrmoptionsarchivers.lblarchiverlistend.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
msgid "Listing &finish (optional):"
msgstr "&Kraj i popisa (mogućnost):"
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
msgid "Listing for&mat:"
msgstr "Oblik &Popisa:"
#: tfrmoptionsarchivers.lblarchiverliststart.caption
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
msgid "Listin&g start (optional):"
msgstr "Početak popis&a (mogućnost):"
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
msgid "Password &query string:"
msgstr "Niz upita za zaporku:"
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
msgid "Create self extractin&g archive:"
msgstr "Napravi samoizdvajajuću arhivu:"
#: tfrmoptionsarchivers.lblarchivertest.caption
msgid "Tes&t:"
msgstr "Proba:"
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
msgid "Auto Configure"
msgstr "S&amo. uređivanje"
#: tfrmoptionsarchivers.miarchiverdisableall.caption
msgid "Disable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
msgid "Discard modifications"
msgstr ""
#: tfrmoptionsarchivers.miarchiverenableall.caption
msgid "Enable all"
msgstr ""
#: tfrmoptionsarchivers.miarchiverexport.caption
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
msgid "Export..."
msgstr "Izvoz..."
#: tfrmoptionsarchivers.miarchiverimport.caption
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
msgid "Import..."
msgstr "Uvoz..."
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
msgid "Sort archivers"
msgstr ""
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
msgid "Additional"
msgstr "Dodatno"
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
msgid "General"
msgstr "Opće"
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
msgid "When &size, date or attributes change"
msgstr "Prilikom izmena &veličine, datuma ili svojstava"
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Za sljedeće putanje& i njena podmapa:"
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
msgid "When &files are created, deleted or renamed"
msgstr "Prilikom stvaranja datoteka, brisanja ili preimenovanja"
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
msgid "When application is in the &background"
msgstr "Kada je program u pozadini&"
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
msgid "Disable auto-refresh"
msgstr "Onemogući samostalno osvježavanje"
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
msgid "Refresh file list"
msgstr "Osvježi spisak datoteka"
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
msgid "Al&ways show tray icon"
msgstr "Uvijek prikaži ikonu u obavještajnoj oblasti"
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "Samostalno skrivaj& otkačene uređaje"
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
msgid "Mo&ve icon to system tray when minimized"
msgstr "Prilikom umanjenja premjesti ikonu u obavještajnu oblast"
#: tfrmoptionsbehavior.cbonlyonce.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
msgid "A&llow only one copy of DC at a time"
msgstr "Dozvoli samo jedan primjerak DC u isto vrijeme"
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgctxt "tfrmoptionsbehavior.edtdrivesblacklist.hint"
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Ovde možete uneti jedan ili veše uređaja ili točaka kačenja odvajajući ih znacima \";\"."
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "Crni popis uređaja"
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Veličina stupaca"
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Prikaži tip datoteka"
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "por&avnati (s karticom)"
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "Neposredno nakon imena datoteke"
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Automatsko"
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Određeni broj stupaca"
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Određena širina stupca"
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgctxt "tfrmoptionscolumnsview.cbcuttexttocolwidth.caption"
msgid "Cut &text to column width"
msgstr "Otsjeci tekst na širinu stupca"
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgctxt "tfrmoptionscolumnsview.cbgridhorzline.caption"
msgid "&Horizontal lines"
msgstr "Vodoravne& linije"
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgctxt "tfrmoptionscolumnsview.cbgridvertline.caption"
msgid "&Vertical lines"
msgstr "Uspravne& linije"
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgctxt "tfrmoptionscolumnsview.chkautofillcolumns.caption"
msgid "A&uto fill columns"
msgstr "Samostalno& popuni stupce"
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgctxt "tfrmoptionscolumnsview.gbshowgrid.caption"
msgid "Show grid"
msgstr "Prikaži mrežu"
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgctxt "tfrmoptionscolumnsview.grpautosizecolumns.caption"
msgid "Auto-size columns"
msgstr "Automatsko određivanje veličine stupaca"
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgctxt "tfrmoptionscolumnsview.lblautosizecolumn.caption"
msgid "Auto si&ze column:"
msgstr "Automatsko prilogođavanje veličine stupca:"
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "tfrmoptionsconfiguration.btnconfigapply.caption"
msgid "A&pply"
msgstr "Primjeni&"
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "Uredi&"
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr "Povijest naredbi&"
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
msgid "&Directory history"
msgstr "Povijest mapa&"
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
msgid "&File mask history"
msgstr "Povijest maski datoteka&"
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgctxt "tfrmoptionsconfiguration.chksaveconfiguration.caption"
msgid "Sa&ve configuration"
msgstr "Sačuvaj& postavke"
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgctxt "tfrmoptionsconfiguration.chksearchreplacehistory.caption"
msgid "Searc&h/Replace history"
msgstr "Povijest pretrage& i zamene"
#: tfrmoptionsconfiguration.gbdirectories.caption
#, fuzzy
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Mape"
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgctxt "tfrmoptionsconfiguration.gblocconfigfiles.caption"
msgid "Location of configuration files"
msgstr "Putanja datoteka postavki"
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgctxt "tfrmoptionsconfiguration.gbsaveonexit.caption"
msgid "Save on exit"
msgstr "Kopiraj po izlazu"
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgctxt "tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption"
msgid "Sort order of configuration order in left tree"
msgstr "Uredi redoslijed konfiguracije na lijevom stablu "
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgctxt "tfrmoptionsconfiguration.lblcmdlineconfigdir.caption"
msgid "Set on command line"
msgstr "Uključi naredbenu liniju"
#: tfrmoptionsconfiguration.lblhighlighters.caption
msgid "Highlighters:"
msgstr ""
#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""
#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgctxt "tfrmoptionsconfiguration.rbprogramdir.caption"
msgid "P&rogram directory (portable version)"
msgstr "Mapa programa& (Povijest )"
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgctxt "tfrmoptionsconfiguration.rbuserhomedir.caption"
msgid "&User home directory"
msgstr "Mapa korisnika&"
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr "Primijenite izmjene na sve stupce"
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr "Primijenite izmjene na sve stupce"
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr "Primijenite izmjene na sve stupce"
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr "Primijenite izmjene na sve stupce"
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr "Primijenite izmjene na sve stupce"
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Primijenite izmjene na sve stupce"
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr "Primijenite izmjene na sve stupce"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr "Primijenite izmjene na sve stupce"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr "Primijena izmjena na sve stupce"
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr "Primijena izmjena na sve stupce"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr "Primijena izmjena na sve stupce"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Sve"
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr "Primijena izmjena na sve stupce"
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Postavi na zadane vrijednosti"
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Novo"
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr ""
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr ""
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Preimenovanje"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr "R"
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr "Ponovno na zadane postavke"
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Kopiraj kao"
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "Sačuvaj"
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Omogući pojačano bojanje"
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "Ako klikanjem nešto promijenite, to će se odrazit na sve stupce"
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "Opće"
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Okvir pokazivača"
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Korištenje pokazivača sa okvirom"
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Boja odabranog teksta u neaktivnom prozoru"
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Korištenje obrnutog odabira"
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Korištenje prilagođenog fonta i boje za ovaj prikaz"
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "Pozadina:"
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Pozadina 2:"
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Podesi pogled stupaca datoteka:"
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Naziv trenutnog stupca]"
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "Boja pokazivača:"
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Pokazivač teksta:"
#: tfrmoptionscustomcolumns.lblfontname.caption
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Slovni lik:"
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Veličina:"
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "Boja teksta:"
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Boja neaktivnog pokazivača"
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Boja neaktivne oznake"
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "Boja označavanja:"
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Ispod je prozor pregleda. Pomicanjem pokazivača i odabirom datoteke,prikazuju se različite postavke prilagodbe."
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Postavke stupaca"
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Dodaj stupac"
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Položaj okvirne ploče nakon usporedbe"
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
msgid "Add a copy of the selected entry"
msgstr "Dodaj umnožak označene stavke"
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Dodaj razdvajač"
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr "Dodaj Mapu za upis"
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Skupi sve"
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Obrišite označenu stavku"
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr "Ubaci Mapu za upis"
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Otvori sve grane"
#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
#, fuzzy
#| msgid "Add..."
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Dodavanje..."
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
#, fuzzy
#| msgid "Backup..."
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Sigurnosne kopije..."
#: tfrmoptionsdirectoryhotlist.btndelete.caption
#, fuzzy
#| msgid "Delete..."
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Brisanje..."
#: tfrmoptionsdirectoryhotlist.btnexport.caption
#, fuzzy
#| msgid "Export..."
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Izvoz..."
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
#, fuzzy
#| msgid "Help"
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "Pomoć"
#: tfrmoptionsdirectoryhotlist.btnimport.caption
#, fuzzy
#| msgid "Import..."
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Uvoz..."
#: tfrmoptionsdirectoryhotlist.btninsert.caption
#, fuzzy
#| msgid "Insert..."
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Umetanje..."
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
#, fuzzy
#| msgid "Miscellaneous..."
msgid "&Miscellaneous..."
msgstr "Razno..."
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVETARGET.HINT"
msgid "Some functions to select appropriate target"
msgstr "Neke radnje za odabir odgovarajućeg cilja"
#: tfrmoptionsdirectoryhotlist.btnsort.caption
#, fuzzy
#| msgid "Sort..."
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Razvrstavanje..."
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
#, fuzzy
#| msgid "When adding directory, add also target"
msgid "&When adding directory, add also target"
msgstr "Prilikom dodavanja mapa, dodaj i cilj"
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
#, fuzzy
#| msgid "Always expand tree"
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Uvjek raširi stablo mapa"
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
#, fuzzy
#| msgid "Show only valid environment variables"
msgid "Show only &valid environment variables"
msgstr "Prikaži samo važeće varijable okruženja"
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
#, fuzzy
#| msgid "In popup, show [path also]"
msgid "In pop&up, show [path also]"
msgstr "Pri iskačućim prozorima prikaži [i putanju]"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRPATH.TEXT"
msgid "Name, a-z"
msgstr "Ime, a-š"
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr "Ime, a-š"
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Brzi spisak mapa (preurediti prevlačenjem i spuštanjem)"
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Ostale mogućnosti"
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr "Ime:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr "Putanja:"
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
#, fuzzy
#| msgid "Target:"
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRTARGET.EDITLABEL.CAPTION"
msgid "&Target:"
msgstr "Cilj:"
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
#, fuzzy
#| msgid "...current level of item(s) selected only"
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "...trenutni stupanj stavki koje su samo označene"
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
#, fuzzy
#| msgid "Scan all hotdir's path to validate the ones that actually exist"
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHEXIST.CAPTION"
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Pretraži sve putanje brzih mapa radi utvrđivanja koje stvarno postoje"
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
#, fuzzy
#| msgid "Scan all hotdir's path && target to validate the ones that actually exist"
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIDETECTIFPATHTARGETEXIST.CAPTION"
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "Pretraži sve putanje brzih mapa i ciljeva radi utvrđivanja koji stvarno postoje"
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
#, fuzzy
#| msgid "to a Directory Hotlist file (.hotlist)"
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "u datoteku spiska brzih mapa (brzi spisak)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
#, fuzzy
#| msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "u \"wincmd.ini“ TC-a (zadrži postojeće)"
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
#, fuzzy
#| msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "u „wincmd.ini“ TC-a (izbriši postojeće)"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
#, fuzzy
#| msgid "Go to configure TC related info"
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Otvori informacije o TC postavkama"
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
#, fuzzy
#| msgid "Go to configure TC related info"
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to &configure TC related info"
msgstr "Otvori informacije o TC postavkama"
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "Izbornik probe spiska brzih mapa"
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
#, fuzzy
#| msgid "from a Directory Hotlist file (.hotlist)"
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "iz datoteke brzog spiska mapa (brzi spisak)"
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
#, fuzzy
#| msgid "from \"wincmd.ini\" of TC"
msgid "from \"&wincmd.ini\" of TC"
msgstr "iz \"wincmd.ini\" TC-a"
#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
#, fuzzy
#| msgid "Restore a backup of Directory Hotlist"
msgid "&Restore a backup of Directory Hotlist"
msgstr "Povrati spisak brzih mapa iz arhive"
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
#, fuzzy
#| msgid "Save a backup of current Directory Hotlist"
msgid "&Save a backup of current Directory Hotlist"
msgstr "Kopiraj u arhivi trenutni spisak brzih mapa"
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
#, fuzzy
#| msgid "Search and replace..."
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "pretraži i zamjeni"
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
#, fuzzy
#| msgid "...everything, from A to Z!"
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...sve, od A do Z!"
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
#, fuzzy
#| msgid "...single group of item(s) only"
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "...pojedinačni skup stavki, isključivo"
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
#, fuzzy
#| msgid "...content of submenu(s) selected, no sublevel"
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "...sadržaj označenog podizbornika, bez podnivoa"
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
#, fuzzy
#| msgid "...content of submenu(s) selected and all sublevels"
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "...sadržaj označenog podizbornika i sve njegove podnivoe"
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
#, fuzzy
#| msgid "Test resulting menu"
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MITESTRESULTINGHOTLISTMENU.CAPTION"
msgid "Test resultin&g menu"
msgstr "Provjeri izlazni izbornik"
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
#, fuzzy
#| msgid "Addition from main panel:"
msgid "Addition from main panel"
msgstr "Dodatak iz glavne ploče:"
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Uvijek pita u kojem pdržanom formatu će se zapis upotrijebljavati"
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Kada spremate Unicode tekst, spremite ga u UTF8 formatu (inače će se koristiti UTF16)"
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Dok povlači tekst, automatski se generira naziv datoteke (inače će se pojaviti polje za unos)"
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Prikaži& prozorčić potvrde poslije otpuštanja"
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Pri povlačenju teksta u prozore:"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Postavite najprikladniji zapis na vrhu popisa (sortiranje povlačenjem)"
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(Ako najprikladniji nije dostupan, zapis će se koristiti negdje drugdje)"
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(možda neće raditi s nekim izvornim programima, pokušajte ukloniti poteškoće)"
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "Prikaži sustav datoteka"
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Prikaži slobodan& prostor"
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Prikaži natpis&"
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Spisak uređaja"
#: tfrmoptionseditor.chkautoindent.caption
msgid "Auto Indent"
msgstr ""
#: tfrmoptionseditor.chkautoindent.hint
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
msgstr ""
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Kraj linije znakova"
#: tfrmoptionseditor.chkscrollpastendline.hint
msgid "Allows caret to go into empty space beyond end-of-line position"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Prikaz posebnih znakova"
#: tfrmoptionseditor.chkshowspecialchars.hint
msgid "Shows special characters for spaces and tabulations"
msgstr ""
#: tfrmoptionseditor.chktabindent.caption
msgid "Tab indents blocks"
msgstr ""
#: tfrmoptionseditor.chktabindent.hint
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.caption
msgid "Use spaces instead tab characters"
msgstr ""
#: tfrmoptionseditor.chktabstospaces.hint
msgid "Converts tab characters to a specified number of space characters (when entering)"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.caption
msgid "Delete trailing spaces"
msgstr ""
#: tfrmoptionseditor.chktrimtrailingspaces.hint
msgid "Auto delete trailing spaces, this applies only to edited lines"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Opcije za interni uređivač"
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "&Pozadina"
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr "&Pozadina"
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Vrati na podrazumijevano"
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr "Sačuvaj"
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Svojstva stavke"
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Sučelje&"
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr "Sučelje&"
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "Oznaka tekstom&"
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Koristi (i uredi) opće& postavke sheme"
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Koristi mesne& postavke sheme"
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Podebljan"
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Iz&vrni"
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Isključi"
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr "Uključi"
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "&Iskošeno"
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Iz&vrni"
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Isključi"
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr "&Uključi"
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "Pre&crtaj"
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr "Iz&vrni"
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr "&Isključi"
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr "U&ključi"
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "Podv&učeno"
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "Iz&vrni"
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "&Isključi"
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "U&ključi"
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr "Dodavanje..."
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr "Brisanje..."
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Unos/Izvoz"
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr "Umetanje..."
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Preimenovanje"
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr "Razvrstavanje..."
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Nijedan"
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr "Uvjek prošireno stablo mapa"
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Ne"
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Lijevo"
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Desno"
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Lista omiljenih kartica (promjena poretka vrši se mišem - povlačenjem i otpuštanjem)"
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr "Ostale mogućnosti"
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr "Što vratiti i gdje za odabrani unos:"
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Zadržavanje postojećih kartica na:"
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Spremi povijest mapa"
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr "Vraćanje kartica spremljenih s lijeve strane na:"
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr "Vraćanje kartica spremljenih s desne strane na:"
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr "razdvajač"
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Dodavanje razdvajača"
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr "podizbornik"
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr "Dodaj podizbornik"
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr "Skupi sve"
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr "...trenutna razina stavki koje su samo označene"
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Isjeci"
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr "obriši sve!"
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr "podizbornik i svi njegovi elementi"
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr "samo podizbornik, ali zadrži elemente"
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr "označena stavka"
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr "Obrišite označenu stavku"
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr "Izvezi odabrane naslijeđene .tab datoteke"
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr "Izbornik za testiranje omiljenih kartica"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr "Uvoz naslijeđene .tab datoteke prema zadanim postavkama"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Uvezite naslijeđene .tab datoteke na odabranom mjestu"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Uvezite naslijeđene .tab datoteke na odabranom mjestu"
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr "Uvezite naslijeđene .tab datoteke na odabranom mjestu u podizborniku"
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Umetanje razdjelnika"
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Umetanje podizbornika"
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr "Otvori sve grane"
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Priljepi"
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Preimenovanje"
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr "...sve, od A do Š!"
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr "...pojedinačni skup stavki isključivo"
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr "Razvrstaj pojedinačni skup stavki isključivo"
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "...sadržaj označenog podizbornika, bez podnivoa"
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "...sadržaj označenog podizbornika i sve njegove podnivoe"
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr "Provjeri izlazni izbornik"
#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Dodaj"
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "&Add"
msgstr "Dodaj&"
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr "Kloniranje"
#: tfrmoptionsfileassoc.btndownact.caption
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "&Down"
msgstr "&Dolje"
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edit"
msgstr "Uredi"
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Umetanje"
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "Insert"
msgstr "Umetanje"
#: tfrmoptionsfileassoc.btnremoveact.caption
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
msgid "Remo&ve"
msgstr "Ukloni&"
#: tfrmoptionsfileassoc.btnremoveext.caption
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
msgid "Re&move"
msgstr "Uklanjanje&"
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "Uklanjanje&"
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "Pre&imenuj"
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "&Gore"
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr "Početni put naredbe. Nikad ne citiraj ovaj niz."
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr "Naziv akcije. Nikada se ne prenosi u sustav, to je samo mnemoničko ime koje ste odabrali"
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr "Parametar za prelazak na naredbu. Treba citirati dugo ime datoteke s razmakom."
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr "Naredba za izvršenje. Treba citirati dugačak naziv datoteke s razmakom."
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr "Opis djelovanja"
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Radnje"
#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
msgid "Extensions"
msgstr "Nastavci"
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Sortiranje povlačenjem i ispuštanjem"
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Vrste datoteka"
#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
msgid "Icon"
msgstr "ikona"
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Sortiranje radnji povlačenjem i ispuštanjem"
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Sortiranje nastavka povlačenjem i ispuštanjem"
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Sortiranje tipa dadoteka povlačenjem i ispuštanjem"
#: tfrmoptionsfileassoc.lblaction.caption
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
msgid "Action name:"
msgstr "Radnja:"
#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "&Command:"
msgstr "&Naredba:"
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "Odrednica&:"
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Početna &putanja:"
#: tfrmoptionsfileassoc.menuitem1.caption
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Prilagođeno s ..."
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Prilagođeno"
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Uredi"
#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
msgid "Open in Editor"
msgstr "Otvori u uređivaču"
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Uredi sa"
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
msgid "Get output from command"
msgstr "Dobavi izlaz iz naredbe"
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Otvori u internom uređivaču"
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Otvori u internom pregledniku"
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Otvori"
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Otvori sa"
#: tfrmoptionsfileassoc.miseparator.caption
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionsfileassoc.mishell.caption
msgctxt "tfrmoptionsfileassoc.mishell.caption"
msgid "Run in terminal"
msgstr "Pokreni u terminalu"
#: tfrmoptionsfileassoc.miview.caption
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Pregled"
#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
msgid "Open in Viewer"
msgstr "Otvori u pregledniku"
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Prikaz s..."
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Kliknite na ikonu za promjenu!"
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "Izvrši putem ljuske"
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Dodatni kontekstni izbornik"
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Konfiguracija povezivanja datoteka"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr "Ponuda za dodavanje odabira za povezivanje datoteka kada nije već uključena"
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Kod pridruživanja datoteke, ponudi dodavanje trenutačne odabrane datoteke ako već nije uključena u konfiguriranu vrstu datoteke"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "Izvrši putem terminala i zatvori"
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "Izvrši putem terminala i ostavi ga otvorenim"
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Dodatne stavke opcija"
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr "Prikaži prozor potvrde za:"
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Kop&iraj postupak"
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "&Izbriši postupak"
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Prem&esti u smeće (gumb shift poništava ovu radnju)"
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "R&adnja slanja u smeće"
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
msgid "D&rop readonly flag"
msgstr "P&oništi oznaku samo za čitanje"
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "&Radnja premještanja"
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr "&Obradi napomene sa datotekama i kazalima"
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr "Označi ime &datoteke bez nastavka prilikom preimenovanja"
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "prikaži karticu ploče odabira u prozoru za umnožavanje premještanje"
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr "Z&anemari greške radnji nad datotekama i upiši ih u datoteku događanja"
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Izvršavanje radnji"
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Korisničko sučelje"
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "Veličina ostave za radnje nad datotekama (u KB):"
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Prikaži početni napredak radnji u"
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr "Naziv automatskog preimenovanja stila za kopiranje:"
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr "&Broj prolaza potpunog brisanja:"
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Postavljanje DC-a na zadanu vrijednost"
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Omogući pojačano bojenje"
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr "Koristi &trepereći pokazivač"
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Koristi &indikator gradijenta"
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Izbor neaktivne postavke boje"
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr "K&oristi obrnuti odabir"
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Okvir pokazivača"
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
msgid "Drive Free Space Indicator"
msgstr "Ukazivač slobodnog mesta na uređajima"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr "P&ozadina:"
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
msgid "Backg&round 2:"
msgstr "P&ozadina 2:"
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
msgid "C&ursor Color:"
msgstr "B&oja pokazivača:"
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
msgid "Cursor Te&xt:"
msgstr "Pokazivač te&ksta:"
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Neaktivna boja pokazivača"
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Neaktivna boja oznake"
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr "Osvjetljenje neradne kartice"
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Pozadinska boja &ukazivača:"
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Čeona boja &ukazivača:"
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
msgid "&Mark Color:"
msgstr "Boja označavanja&:"
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "Ispod je pregled. Možete pomicati pokazivač, odabrati datoteku i dobiti stvarni izgled i dojam različitih postavki"
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
msgid "T&ext Color:"
msgstr "Boja teksta&"
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.cbpartialnamesearch.caption"
msgid "&Search for part of file name"
msgstr "&Pretraga po djelu imena datoteke"
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.dbtextsearch.caption"
msgid "Text search in files"
msgstr "Pretraživanje teksta u datotekama"
#: tfrmoptionsfilesearch.gbfilesearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Pretraga datoteka"
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption"
msgid "Default search template:"
msgstr "Zadani predložak pretraživanja"
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.rbusemmapinsearch.caption"
msgid "Use memory mapping for search te&xt in files"
msgstr "Koristi kartu memorije za pretrage po te&kstu u datotekama"
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
#, fuzzy
msgctxt "tfrmoptionsfilesearch.rbusestreaminsearch.caption"
msgid "&Use stream for search text in files"
msgstr "Koristi tok za pretrage po tekstu"
#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "Dodaj&"
#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "Pomoć&"
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "Nemoj učitavati spisak datoteka dok se kartica ne pokrene"
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr "prikaži& uglaste zagrade oko mapa"
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Istakni& nove i osvježene datoteke"
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Omogući &preimenovanje na mjestu pri dvokliku na ime"
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
msgid "Load &file list in separate thread"
msgstr "Učitaj spisak &datoteka u posebnom procesu"
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
msgid "Load icons af&ter file list"
msgstr "Učitavaj ikone nakon& spiska datoteka"
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
msgid "Show s&ystem and hidden files"
msgstr "Prikaži sistemske i skrivene datoteke"
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "Prilikom odabira datoteka pomoću <SPACEBAR>, prijeđi na sljedeću datoteku ( kao i sa <INSERT>)"
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Oblikujem"
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr "Slaganje"
#: tfrmoptionsfilesviews.lbattributemask.caption
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Osetljivo na &veličinu slova"
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Neispravan oblik"
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr "Oblik datuma i vremena:"
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Oblik veličine& datoteka:"
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
#, fuzzy
#| msgid "&Insert new files"
msgid "&Insert new files:"
msgstr "Umetni& nove datoteke"
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "Raspored mapa:"
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr "Način raspoređivanja:"
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
#, fuzzy
#| msgid "&Move updated files"
msgid "&Move updated files:"
msgstr "&Premjesti osvježene datoteke"
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "Primjeni&"
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "&Obriši"
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Obrazac..."
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr "Boje vrsta datoteka (rasporedite ih povlačenjem i &spuštanjem)"
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr "Svojstva& vrste:"
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "Boja vrste&:"
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
msgid "Category &mask:"
msgstr "Maska vrste&:"
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
msgid "Category &name:"
msgstr "Ime &vrste:"
#: tfrmoptionsfonts.btnpatheditfnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
#, fuzzy
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr ""
#: tfrmoptionsfonts.lbleditorfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
msgid "&Editor font"
msgstr "Uređivač fontova"
#: tfrmoptionsfonts.lbllogfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
msgid "&Log font"
msgstr "Datoteka događanja fontova&"
#: tfrmoptionsfonts.lblmainfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
msgid "Main &font"
msgstr "Glavni font&"
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr ""
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr ""
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
msgid "Viewer&Book Font"
msgstr "Preglednik& knjige fontova"
#: tfrmoptionsfonts.lblviewerfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
msgid "&Viewer font"
msgstr "Preglednik& fontova"
#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Dodaj prečicu&"
#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "Izbriši"
#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "Izbriši& prečicu"
#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "Uredi& prečicu"
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Preimenovanje"
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
msgid "&Filter"
msgstr "Propusnik&"
#: tfrmoptionshotkeys.lblcategories.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION"
msgid "C&ategories:"
msgstr "Vrste&:"
#: tfrmoptionshotkeys.lblcommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION"
msgid "Co&mmands:"
msgstr "Naredbe&:"
#: tfrmoptionshotkeys.lblscfiles.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
msgid "&Shortcut files:"
msgstr "Prečica& Datoteke:"
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Naredba"
#: tfrmoptionshotkeys.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Za sljedeće &putanje i njihova podmapa:"
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Prikaži ikonice radnji u izbornicima&"
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr "16x16"
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
msgid "Show o&verlay icons, e.g. for links"
msgstr "prikaži preklapajuće& ikonice, npr. za veze"
#: tfrmoptionsicons.chkshowhiddendimmed.caption
msgid "&Dimmed hidden files (slower)"
msgstr ""
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Onemogući posebne ikone"
#: tfrmoptionsicons.gbiconssize.caption
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
msgid " Icon size "
msgstr " Veličina ikona"
#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr ""
#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
msgid " Show icons to the left of the filename "
msgstr " prikaži ikonice lijevo od imena datoteka"
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
msgid "A&ll"
msgstr "Sve&"
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
msgid "All associated + &EXE/LNK (slow)"
msgstr "Sve povezane + &EXE/LNK (sporo)"
#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
msgid "&No icons"
msgstr "Bez& ikona"
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
msgid "Only &standard icons"
msgstr "Samo &uobičajene ikonice"
#: tfrmoptionsignorelist.btnaddsel.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
msgid "A&dd selected names"
msgstr "Dodaj& označena imena"
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
msgid "Add selected names with &full path"
msgstr "Dodaj označena imena sa &potpunim putanjama"
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "Zanemari& (ne prikaži) sledeće datoteke i kazala:"
#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
msgid "&Save in:"
msgstr "&Kopiraj u:"
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "Ljeva& i desna strelica menja Mapa (Lynx-like movement)"
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Tipkanje"
#: tfrmoptionskeyboard.lblalt.caption
#, fuzzy
#| msgid "Alt+L&etters"
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
msgid "Alt+L&etters:"
msgstr "Alt+s&lova(mjenjane slova)"
#: tfrmoptionskeyboard.lblctrlalt.caption
#, fuzzy
#| msgid "Ctrl+Alt+Letters"
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
msgid "Ctrl+Alt+Le&tters:"
msgstr "Ctrl+Alt+s&lova(mjenjane slova)"
#: tfrmoptionskeyboard.lblnomodifier.caption
#, fuzzy
#| msgid "&Letters"
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
msgid "&Letters:"
msgstr "&Slova"
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
msgid "&Flat buttons"
msgstr "Ravna& dugmad"
#: tfrmoptionslayout.cbflatinterface.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
msgid "Flat i&nterface"
msgstr "Ravno &sučelje"
#: tfrmoptionslayout.cbflattoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
msgid "Flat b&uttons"
msgstr "Ravna dugmad&"
#: tfrmoptionslayout.cbfreespaceind.caption
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
msgid "Show fr&ee space indicator on drive label"
msgstr "Prikaži kazivač slobodnog prostora na natpisu uređaja"
#: tfrmoptionslayout.cblogwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
msgid "Show lo&g window"
msgstr "Prikaži datoteku događanja&"
#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
msgid "Show panel of operation in background"
msgstr "Prikaži tablu radnje iz pozadine"
#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
msgid "Show common progress in menu bar"
msgstr "Prikaži uobičajeni napredak u traci izbornika"
#: tfrmoptionslayout.cbshowcmdline.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
msgid "Show command l&ine"
msgstr "Prikaži naredbenu liniju&"
#: tfrmoptionslayout.cbshowcurdir.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
msgid "Show current director&y"
msgstr "Prikaži trenutnu mapu"
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
msgid "Show &drive buttons"
msgstr "Prikaži dugmiće uređaja&"
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
msgid "Show free s&pace label"
msgstr "Prikaži natpis slobodnog prostora&"
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "prikaži gumb spiska uređaja"
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
msgid "Show function &key buttons"
msgstr "Prikaži dugmiće radnji"
#: tfrmoptionslayout.cbshowmainmenu.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
msgid "Show &main menu"
msgstr "prikaži glavni& izbornik"
#: tfrmoptionslayout.cbshowmaintoolbar.caption
#, fuzzy
#| msgid "Show &button bar"
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
msgid "Show tool&bar"
msgstr "Prikaži traku dugmadi"
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Prikaži natpis malog slobodnog prostora"
#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
msgid "Show &status bar"
msgstr "prikaži traku stanja&"
#: tfrmoptionslayout.cbshowtabheader.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
msgid "S&how tabstop header"
msgstr "prikaži& zaglavlje kartice za zaustavljanje"
#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
msgid "Sho&w folder tabs"
msgstr "Prikaži kartice mapa"
#: tfrmoptionslayout.cbtermwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
msgid "Show te&rminal window"
msgstr "Prikaži prozor terminala&"
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Prikaži dvije trake dugmadi uređaja (stalne širine, iznad prozora)"
#: tfrmoptionslayout.gbscreenlayout.caption
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
msgid " Screen layout "
msgstr "Raspored na ekranu"
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Uključi datum u zapisničku datoteku"
#: tfrmoptionslog.cblogarcop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
msgid "&Pack/Unpack"
msgstr "&Sažmi/izvuci"
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Izvršenje vanjskog naredbenog retka"
#: tfrmoptionslog.cblogcpmvln.caption
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
msgid "Cop&y/Move/Create link/symlink"
msgstr "Kopiraj/premjesti/napravi vezu/simboličku vezu"
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmoptionslog.cblogdirop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
msgid "Crea&te/Delete directories"
msgstr "&Napravi/Izbriši mapa"
#: tfrmoptionslog.cblogerrors.caption
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
msgid "Log &errors"
msgstr "Datoteka događanja grešaka"
#: tfrmoptionslog.cblogfile.caption
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
msgid "C&reate a log file:"
msgstr "Napravi& zapisničku datoteku:"
#: tfrmoptionslog.cbloginfo.caption
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
msgid "Log &information messages"
msgstr "Unosi u datoteku događanja poruke podataka&"
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Pokretanje/Zaustavljanje programa"
#: tfrmoptionslog.cblogsuccess.caption
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
msgid "Log &successful operations"
msgstr "Unosi u dnevnik uspešne& radnje"
#: tfrmoptionslog.cblogvfs.caption
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
msgid "&File system plugins"
msgstr "Priključci &sistema datoteka"
#: tfrmoptionslog.gblogfile.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
msgid "File operation log file"
msgstr "Zapisnička datoteka radnji nad datotekama"
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Upiši radnje u datoteku događanja"
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Stanje radnje"
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "&Ukloni ikone nepostojećih datoteka"
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr "Prikaz sadržaja dnevničke datoteke"
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgid "Create new with the encoding:"
msgstr ""
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Uvijek idi u& sistemsku mapu uređaja prilikom menjanja uređaja"
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION"
msgid "Show &warning messages (\"OK\" button only)"
msgstr "Prikaži poruke upozorenja (samo gumb „U redu“)"
#: tfrmoptionsmisc.chkthumbsave.caption
msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION"
msgid "&Save thumbnails in cache"
msgstr "&Usnimi ikone u predmemoriju"
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr "Ikone"
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr ""
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "TC izvoz / uvoz"
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgid "Default encoding:"
msgstr ""
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Konfiguracijska datoteka"
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "Izvršna TC datoteka"
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Izlazni put alatne trake"
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "točke"
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
msgid "X"
msgstr "H"
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "Veličina &umanjenih sličica:"
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "&Odabir mišem"
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
msgid "By clic&king on icon"
msgstr ""
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Klizanje"
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Izbor"
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Način:"
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "&Linija po linija"
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Linija po linija &sa pomeranjem pokazivača"
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Stranica po stranica"
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "Podesi&"
#: tfrmoptionsplugins.btnenableplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
msgid "E&nable"
msgstr "&Omogući"
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "&Ukloni"
#: tfrmoptionsplugins.btntweakplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
msgid "&Tweak"
msgstr "&Lickaj"
#: tfrmoptionsplugins.lbldsxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Priključci &pretrage omogućuju zamjenske algoritme pretrage, ili vanjske alate (kao što je „locate“, itd.)"
#: tfrmoptionsplugins.lblwcxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
msgid "Pack&er plugins are used to work with archives"
msgstr "Priključci za sažimanje se upotrebljavaju za rad sa arhivama"
#: tfrmoptionsplugins.lblwdxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Priključci za sadržaje se upotrebljavaju za proširenje prikaza pojedinosti datoteka kao što su mp3 oznake ili svojstva slika u spiskovima datoteka, ili se koriste u priključcima pretrage i alatima za višestruko preimenovanje"
#: tfrmoptionsplugins.lblwfxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Priključci sistema datoteka& omogućavaju pristup radnjama sa diskovima koje nisu dostupne iz operativnog sustava ili spoljnjim uređajima ko što su Palm i džepni računar."
#: tfrmoptionsplugins.lblwlxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Priključci za pregled omogućavaju prikaz oblika datoteka kao što su slike, tabele, baze podataka itd. u pregledniku (F3, Ctrl+Q)"
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
msgid "Active"
msgstr "Radno"
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr "Priključak"
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
msgid "Registered for"
msgstr "Prijavljeno za"
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr "Ime datoteke"
#: tfrmoptionsplugins.tsdsx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
msgid "&Search plugins (.DSX)"
msgstr "&Priključci pretrage (.DSX)"
#: tfrmoptionsplugins.tswcx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
msgid "Pac&ker plugins (.WCX)"
msgstr "Priključci za sažimanje (.WCX)"
#: tfrmoptionsplugins.tswdx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
msgid "Content pl&ugins (.WDX)"
msgstr "Priključci& sadržaja (.WDX)"
#: tfrmoptionsplugins.tswfx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
msgid "F&ile system plugins (.WFX)"
msgstr "Priključci sistema datoteka (.WFX)"
#: tfrmoptionsplugins.tswlx.caption
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
msgid "&Viewer plugins (.WLX)"
msgstr "Priključci preglednika (.WLX)"
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
msgid "&Beginning (name must start with first typed character)"
msgstr "&Počinje sa (ime mora počinjati prvim otkucanim znakom)"
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "&Završava se sa (posljednji znak pre otkucane točke . mora se poklapati)"
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Mogućnosti"
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Potpuno slaganje imena"
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Veličina slova pretrage"
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Traži ove stavke"
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Preimenovanje kartice kod otključavanja iste"
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Pokreni ciljnu ploču& pri kliku na jednu od njenih kartica"
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
msgid "&Show tab header also when there is only one tab"
msgstr "&Prikaži i zaglavlje kartice kada se prikažie samo jedna kartica"
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Zatvori duple kartice prilikom zatvaranja aplikacije"
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
msgid "Con&firm close all tabs"
msgstr "&Potvrdi zatvaranje svih kartica"
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Potvrdite zatvaranje zaključanih kartica"
#: tfrmoptionstabs.cbtabslimitoption.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
msgid "&Limit tab title length to"
msgstr "&Ograniči dužinu naslova kartice na"
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
msgid "Show locked tabs &with an asterisk *"
msgstr "Prikaži zaključane kartice &sa znakom *"
#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
msgid "&Tabs on multiple lines"
msgstr "&Kartice na višestrukim linijama"
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Ctrl+&gore otvara novu karticu u pozadini"
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
msgid "Open &new tabs near current tab"
msgstr "Otvori novu karticu pored trenutnr kartice"
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Ponovno upotrijebite postojeću karticu kada je to moguće"
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
msgid "Show ta&b close button"
msgstr "prikaži gumb za zatvaranje &kartice"
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr ""
#: tfrmoptionstabs.gbtabs.caption
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
msgid "Folder tabs headers"
msgstr "Zaglavlje kartice mapa"
#: tfrmoptionstabs.lblchar.caption
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
msgid "characters"
msgstr "znak"
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Akcija koja se treba učiniti kada dvaput kliknete karticu:"
#: tfrmoptionstabs.lbltabsposition.caption
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
msgid "Ta&bs position"
msgstr "Položaj kartica&"
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr "Nijedan"
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Ne"
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr "Lijevo"
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr "Desno"
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr "Otvaranje podešavanja omiljene kartice nakon presnimavanja"
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr "Otvaranje podešavanja omiljene kartice nakon kopiranja na novo"
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr "Omogući dodatne opcije za Omiljene kartice (odaberite ciljnu stranu kada se vratite i sl.)"
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr "Zadane dodatne postavke prilikom spremanja novih omljenih kartica:"
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr "Kartice dodatnih zaglavlja mapa"
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr "Prilikom vraćanja kartice postojeće kartice očuvaj"
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr "Kartice spremljene na lijevoj strani vratit će se na:"
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr "Kartice spremljene na desnoj strani vratit će se na:"
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Sačuvajte povijest pretpregleda pomoću omiljenih kartica :"
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr "Zadana pozicija u izborniku prilikom spremanja nove omiljene kartice:"
#: tfrmoptionsterminal.edrunintermcloseparams.hint
#, fuzzy
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{Naredba} Prisutne naredbe za pokretanje u terminalu"
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
#, fuzzy
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{Naredba} Prisutne naredbe za pokretanje u terminalu"
#: tfrmoptionsterminal.edruntermparams.hint
#, fuzzy
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{Naredba} Prisutne naredbe za pokretanje u terminalu"
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Naredba za samo pokretanje terminala:"
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Naredba za pokretanje naredbe na terminalu i zatvaranje nakon tog:"
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Naredba za pokretanje naredbe na terminalu koji nakon tog ostaje otvoren:"
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
#, fuzzy
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Naredba:"
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
#, fuzzy
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Parametri:"
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
#, fuzzy
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Naredba:"
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
#, fuzzy
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Parametri"
#: tfrmoptionsterminal.lbruntermcmd.caption
#, fuzzy
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Naredba:"
#: tfrmoptionsterminal.lbruntermparams.caption
#, fuzzy
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Parametri:"
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "Gumb potpuno istih umnožaka"
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr "&Izbriši"
#: tfrmoptionstoolbar.btnedithotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION"
msgid "Edit hot&key"
msgstr "Uredi &prečicu"
#: tfrmoptionstoolbar.btninsertbutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION"
msgid "&Insert new button"
msgstr "&Unesi novi gumb"
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Odabiranje"
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Drugo..."
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION"
msgid "Remove hotke&y"
msgstr "Ukloni &prečicu"
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Predložiti"
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr "Omogućite da DC predloži alatnu tipku na temelju vrste gumba, naredbe i parametara"
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "Ravna& dugmad"
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Prijava pogrešaka s naredbama"
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Unesite odrednice naredbe, svaku u posebnoj liniji. Pritisnite F1 za pregled pomoći za odrednice."
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr "Prikaz"
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "Veličina &trake:"
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION"
msgid "Comman&d:"
msgstr "&Naredba:"
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr "Odrednica&:"
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr "Pomoć"
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Prečica:"
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr "ikona&:"
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Veličina& ikonice:"
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "Naredba&:"
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "Odrednice&:"
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Početna &putanja:"
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "&Napomena:"
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "Dodavanje alatne trake s svim DC naredbama"
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "za vanjsku naredbu"
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "za unutarnju naredbu"
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "za razdjelnik"
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "za podređenu alatnu traku"
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr "Ostava..."
#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr "Izvoz..."
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Trenutna alatna traka"
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "u datoteku alatne trake (.toolbar)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "u TC.BAR datoteci (zadržite postojeće)"
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "u TC.BAR datoteci (izbrišite postojeće)"
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "u „wincmd.ini“ TC-a (zadrži postojeće)"
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "u „wincmd.ini“ TC-a (izbriši postojeće)"
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Najpopularnija alatna traka"
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "Spremanje sigurnosne kopije Alatne trake"
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "u datoteku Alatne trake (.toolbar)"
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "u TC.BAR datoteci (zadržite postojeće)"
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "u TC.BAR datoteci (obrišite postojeće)"
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "u „wincmd.ini“ TC-a (zadrži postojeće)"
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "u „wincmd.ini“ TC-a (izbriši postojeće)"
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "odmah nakon trenutng odabira"
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr "kao prvi element"
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr "kao zadnji element"
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "neposredno prije trenutnog odabira"
#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr "Uvoz..."
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Vračanje sigurnosne kopije alatne trake"
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "dodavanje trenutačne alatne trake"
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "dodavanje nove alatne trake na trenutačnu alatnu traku"
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "dodavanje nove alatne trake na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr "dodavanje na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
#, fuzzy
#| msgid "to add to top toolbar"
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr "dodavanje na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "iz datoteke Alatne trake (.toolbar)"
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "dodavanje trenutačne alatne trake"
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "dodavanje nove alatne trake na trenutačnu alatnu traku"
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "dodavanje nove alatne trake na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "dodavanje na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "zamjena popularne alatne trake"
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "iz jedne TC .BAR datoteke"
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "dodavanje trenutačne alatne trake"
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "dodavanje nove alatne trake na trenutačnu alatnu traku"
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "dodavanje nove alatne trake na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "dodavanje na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "zamjena popularne alatne trake"
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "iz datoteke \"wincmd.ini\" programa TotalCommander ..."
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "dodavanje na trenutačnu alatnu traku"
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "dodavanje nove alatne trake na trenutačnu alatnu traku"
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "dodavanje nove alatne trake na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr "dodavanje na omiljenu alatnu traku"
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr "zamjena popularne alatne trake"
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "odmah nakon trenutng odabira"
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr "kao prvi element"
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr "kao zadnji element"
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "odmah nakon trenutng odabira"
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr "Traži i zamijeni"
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "odmah nakon trenutng odabira"
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "kao prvi element"
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "kao zadnji element"
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "odmah nakon trenutng odabira"
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "u svim gore navedenim ..."
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "u svim naredbama ..."
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "u svim imenima ikona ..."
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "u svim parametrima ..."
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "Na svim početnim putanjima"
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr "odmah nakon trenutng odabira"
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr "kao prvi element"
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr "kao zadnji element"
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr "samo prethodni trenutni odabir"
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Vrsta gumba"
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "&Zadrži otvoreni prozor terminala poslije izvršenja programa"
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "&Izvrši u terminalu"
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "&Koristi vanjski program"
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "&Dodatne odrednice"
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "&Putanja programa za izvršenje"
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "&Dodaj"
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "Primeni&"
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "Izbriši&"
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Obrazac..."
#: tfrmoptionstooltips.chkshowtooltip.caption
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
msgid "&Show tooltip for files in the file panel"
msgstr "Prikaži napomenu"
#: tfrmoptionstooltips.gbcustomfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
msgid "Custom fields by file type"
msgstr "Prilagođeno polje po vrsti datoteka"
#: tfrmoptionstooltips.lblfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Vrsta napomene&:"
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Vrsta maske&:"
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "Vrsta imena&:"
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
#, fuzzy
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Način prikaza preglednika knjiga"
#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
msgid "Example"
msgstr "Primjer"
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "&Pozadinska boja u pregledniku knjiga"
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "&Boja slova u pregledniku knjiga"
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "Broj stupaca u pregledniku knjiga"
#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "&Podesi"
#: tfrmpackdlg.caption
msgctxt "TFRMPACKDLG.CAPTION"
msgid "Pack files"
msgstr "Sažmi datoteke"
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "&Napravi odvojene arhive, posebno za svaku odabranu datoteku i mapu"
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "Napravi samoizdvajajuće arhive"
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "&Šifriraj"
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "Premjesti& u arhivu"
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "&Višestruke arhive na diskovima"
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "Prvo smejsti& u TAR arhive"
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Takođe sažmi& i imena putanja (samo rekurzivno)"
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Sažmi datoteku(e) u datoteku:"
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Sažimalac"
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "&Zatvori"
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "Izdvoji &sve i izvrši"
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "&Izdvoji i izvrši"
#: tfrmpackinfodlg.caption
msgctxt "TFRMPACKINFODLG.CAPTION"
msgid "Properties of packed file"
msgstr "Svojstva sažimane datoteke"
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Svojstva:"
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Stupanj sažimanja:"
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Datum:"
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Način:"
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Izvorna veličina:"
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Datoteka:"
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Veličina sažimane datoteke:"
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Sažimalac:"
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Vreme:"
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr "H"
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Zatvori tablu propusnika"
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Unesite tekst ili uvjet pretrage"
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr "Aa"
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Osetljivo na veličinu slova"
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr "D"
#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "mapa"
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr "F"
#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Datoteke"
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr "{"
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Početak poklapanja"
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr "}"
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Završetak poklapanja"
#: tfrmquicksearch.tglfilter.caption
msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION"
msgid "Filter"
msgstr "Uslov"
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Zamjena pretrage i uvjeta"
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "&Više pravila"
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "M&anje pravila"
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Upotrebi &sadržajne dodatke u kombinaciji s"
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Priključak"
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Vrijednost"
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr ""
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr ""
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Otkaži"
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "&Zatvori"
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "&Pomoć"
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "&Izaberite znakove za unos:"
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmsetfileproperties.caption
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
msgid "Change attributes"
msgstr "Izmjeni svojstva"
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Lepljivo"
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"
#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "Skladište"
#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Napravljeno:"
#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "Skriveno"
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Pristupano:"
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Izmjenjeno:"
#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "Samo za čitanje"
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Uključujući podmapee"
#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "Sistem"
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Svojstva vremenske oznake"
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Svojstva"
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Svojstva"
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bita:"
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Grupa"
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(siva polja označavaju neizmenjene vrednosti)"
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Drugo"
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Vlasnik"
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Tekst:"
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Izvrši"
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(siva polja označavaju neizmenjene vrednosti)"
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Oktalno:"
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Čitaj"
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Piši"
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr "Neke radnje za odabir odgovarajuće putanje"
#: tfrmsplitter.caption
msgctxt "TFRMSPLITTER.CAPTION"
msgid "Splitter"
msgstr "Djelilac"
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Zahtijevajte datoteku za potvrdu CRC32"
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Ime datoteke"
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Veličina i broj djelova"
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "Ciljna &mapa"
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Izvorna &mapa"
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "&Broj delova"
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr ""
#: tfrmsplitter.rbtngigab.caption
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr "&Gigabajta"
#: tfrmsplitter.rbtnkilob.caption
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr "&Kilobajta"
#: tfrmsplitter.rbtnmegab.caption
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr "&Megabajta"
#: tfrmstartingsplash.caption
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblbuild.caption
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
msgid "Build"
msgstr "Izgrađen"
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
msgid "Free Pascal"
msgstr "Slobodni Paskal"
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
msgid "Lazarus"
msgstr "Lazarus"
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Operativni sistem"
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Platforma"
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Prepravka"
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr "Izdanje"
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Napravi simboličku vezu"
#: tfrmsymlink.chkuserelativepath.caption
msgid "Use &relative path when possible"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "&Odredište na koje će ukazivati veza"
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Ime &veze"
#: tfrmsyncdirsdlg.actselectclear.caption
msgid "Remove selection"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopydefault.caption
msgid "Select for copying (default direction)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
msgid "Select for copying -> (left to right)"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
msgid "Reverse copy direction"
msgstr ""
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
msgid "Select for copying <- (right to left)"
msgstr ""
#: tfrmsyncdirsdlg.actselectdeleteright.caption
msgid "Select for deleting -> (right)"
msgstr ""
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr "Zatvori"
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr "Usporedi"
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ">>"
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Uskladi"
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Usklađivanje mapa"
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr "*.*"
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "nesimetrično"
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "po sadržaju"
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "zanemari datum"
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "samo odabrano"
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Podmape"
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Prikaži:"
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
msgid "Name"
msgstr "Ime"
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
msgid "Size"
msgstr "Veličina"
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
msgid "Date"
msgstr "Datum"
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
msgid "Date"
msgstr "Datum"
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
msgid "Size"
msgstr "Veličina"
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
msgid "Name"
msgstr "Ime"
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(u glavnom prozoru)"
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Usporedi"
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Pogled lijeve strane"
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Pogled desne strane"
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr "<"
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ">"
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "duplikati"
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr "="
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr "!="
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "pojedinačni"
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Molim, pritisnite „Usporedi“ za početak"
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr "Uskladi"
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Potvrdi prepisivanje"
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr ""
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr ""
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "&Dodaj novo"
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Otkaži"
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "I&zmeni"
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "Na&zadane vrijednosti"
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&U redu"
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr "Ukloni&"
#: tfrmtweakplugin.caption
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
msgid "Tweak plugin"
msgstr "Priključak za lickanje"
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "&Prepoznaj vrstu arhive po sadržaju"
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Nisam uspio izbrisati datoteke"
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "Podržava &šifriranje"
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "prikaži& kao obične datoteke (sakrij ikonicu sažimanja)"
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Podržava &sažimanje u memoriji"
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Nisam uspio izmijeniti postojeće arhive"
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "&Arhiva može sadržavati višestruke datoteke"
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Nisam uspio napraviti nove arhive&"
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "Podržava& prozor za prikaz mogućnosti"
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Omogućava pretragu& teksta u arhivama"
#: tfrmtweakplugin.lbldescription.caption
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "Opis&:"
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "Prepoznaj& nisku:"
#: tfrmtweakplugin.lblextension.caption
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "Nastavci&:"
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Oznake:"
#: tfrmtweakplugin.lblname.caption
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "Ime&:"
#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "&Priključak:"
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "&Priključak:"
#: tfrmviewer.actabout.caption
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
msgid "About Viewer..."
msgstr "O pregledniku..."
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "prikažie poruku o programu"
#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
msgid "Copy File"
msgstr "Kopiraj datoteku"
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Kopiraj datoteku"
#: tfrmviewer.actcopytoclipboard.caption
#, fuzzy
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "Kopiraj u međuspremnik"
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr ""
#: tfrmviewer.actdeletefile.caption
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
msgid "Delete File"
msgstr "Izbriši datoteku"
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Izbriši datoteku"
#: tfrmviewer.actexitviewer.caption
#, fuzzy
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "&Napusti"
#: tfrmviewer.actfind.caption
#, fuzzy
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Pronađi"
#: tfrmviewer.actfindnext.caption
#, fuzzy
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Nađi sljedeće"
#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr ""
#: tfrmviewer.actfullscreen.caption
#, fuzzy
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Preko cijelog ekrana"
#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr ""
#: tfrmviewer.actloadnextfile.caption
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
msgid "&Next"
msgstr "&Sljedeća"
#: tfrmviewer.actloadnextfile.hint
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT"
msgid "Load Next File"
msgstr "Učitaj sljedeću datoteku"
#: tfrmviewer.actloadprevfile.caption
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
msgid "&Previous"
msgstr "&Prethodna"
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Učitaj prethodnu datoteku"
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr ""
#: tfrmviewer.actmirrorhorz.hint
#, fuzzy
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr "Ogledalo"
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr ""
#: tfrmviewer.actmovefile.caption
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
msgid "Move File"
msgstr "Premjesti datoteku"
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Premjesti datoteku"
#: tfrmviewer.actpreview.caption
#, fuzzy
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Pregled"
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Učitaj ponovo"
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Ponovo učitaj trenutnu datoteku"
#: tfrmviewer.actrotate180.caption
#, fuzzy
#| msgid "Rotate 180"
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
msgid "+ 180"
msgstr "Okreni za 180"
#: tfrmviewer.actrotate180.hint
#, fuzzy
#| msgid "Rotate 180"
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
msgid "Rotate 180 degrees"
msgstr "Okreni za 180"
#: tfrmviewer.actrotate270.caption
#, fuzzy
#| msgid "Rotate 270"
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
msgid "- 90"
msgstr "Okreni za 270"
#: tfrmviewer.actrotate270.hint
#, fuzzy
#| msgid "Rotate 270"
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
msgid "Rotate -90 degrees"
msgstr "Okreni za 270"
#: tfrmviewer.actrotate90.caption
#, fuzzy
#| msgid "Rotate 90"
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
msgid "+ 90"
msgstr "Okreni za 90"
#: tfrmviewer.actrotate90.hint
#, fuzzy
#| msgid "Rotate 90"
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
msgid "Rotate +90 degrees"
msgstr "Okreni za 90"
#: tfrmviewer.actsave.caption
#, fuzzy
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Sačuvaj"
#: tfrmviewer.actsaveas.caption
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
msgid "Save As..."
msgstr "Kopiraj kao..."
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Kopiraj datoteku kao..."
#: tfrmviewer.actscreenshot.caption
#, fuzzy
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Slika ekrana"
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr ""
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr ""
#: tfrmviewer.actselectall.caption
#, fuzzy
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Označi sve"
#: tfrmviewer.actshowasbin.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "Prikaži binarno&"
#: tfrmviewer.actshowasbook.caption
#, fuzzy
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "Prikaži kao knjigu&"
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr ""
#: tfrmviewer.actshowashex.caption
#, fuzzy
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "Prikaži heksadecimalno&"
#: tfrmviewer.actshowastext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "Prikaži kao &tekst"
#: tfrmviewer.actshowaswraptext.caption
#, fuzzy
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "Prikaži kao &uvučen tekst"
#: tfrmviewer.actshowgraphics.caption
#, fuzzy
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Grafika"
#: tfrmviewer.actshowplugins.caption
#, fuzzy
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Priključak"
#: tfrmviewer.actstretchimage.caption
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
msgid "Stretch"
msgstr "Razvuci"
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Razvuci sliku"
#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr ""
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr ""
#: tfrmviewer.actzoomin.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Približi"
#: tfrmviewer.actzoomout.caption
#, fuzzy
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Udalji"
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Kopiraj"
#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Obreži"
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "Obriši"
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "Obriši"
#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Preko cijelog ekrana"
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Isticanje"
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "premjesti"
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Premjesti"
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Oboji"
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Crvene oči"
#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Promeni veličinu"
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Vrati"
#: tfrmviewer.caption
msgctxt "TFRMVIEWER.CAPTION"
msgid "Viewer"
msgstr "Preglednik"
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Pokretne slike"
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Olovka"
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"
#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Isticanje"
#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Bojenje"
#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Pokretni prikaz"
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Pregled"
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "O programu"
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Uredi"
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Šifriranje"
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Datoteka"
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "&Slika"
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Štampaj..."
#: tfrmviewer.mirotate.caption
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
msgid "Rotate"
msgstr "okreni"
#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Slika ekrana"
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Pregled"
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Označi sve"
#: tfrmviewoperations.btnstartpause.caption
#, fuzzy
msgctxt "tfrmviewoperations.btnstartpause.caption"
msgid "&Start"
msgstr "Početak&"
#: tfrmviewoperations.btnstop.caption
msgid "S&top"
msgstr ""
#: tfrmviewoperations.caption
#, fuzzy
msgctxt "tfrmviewoperations.caption"
msgid "File operations"
msgstr "Radnje nad datotekama"
#: tfrmviewoperations.cbalwaysontop.caption
msgid "Always on top"
msgstr ""
#: tfrmviewoperations.lblusedragdrop.caption
msgid "&Use \"drag && drop\" to move operations between queues"
msgstr ""
#: tfrmviewoperations.mnucanceloperation.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
msgid "Cancel"
msgstr "Otkaži"
#: tfrmviewoperations.mnucancelqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
msgid "Cancel"
msgstr "Otkaži"
#: tfrmviewoperations.mnunewqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnunewqueue.caption"
msgid "New queue"
msgstr "Novo zakazivanje"
#: tfrmviewoperations.mnuoperationshowdetached.caption
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.mnuputfirstinqueue.caption
msgid "Put first in queue"
msgstr ""
#: tfrmviewoperations.mnuputlastinqueue.caption
msgid "Put last in queue"
msgstr ""
#: tfrmviewoperations.mnuqueue.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue.caption"
msgid "Queue"
msgstr "Zakazano"
#: tfrmviewoperations.mnuqueue0.caption
msgid "Out of queue"
msgstr ""
#: tfrmviewoperations.mnuqueue1.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Zakazano 1"
#: tfrmviewoperations.mnuqueue2.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Zakazano 2"
#: tfrmviewoperations.mnuqueue3.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Zakazano 3"
#: tfrmviewoperations.mnuqueue4.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Zakazano 4"
#: tfrmviewoperations.mnuqueue5.caption
#, fuzzy
msgctxt "tfrmviewoperations.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Zakazano 5"
#: tfrmviewoperations.mnuqueueshowdetached.caption
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
msgid "Show in detached window"
msgstr ""
#: tfrmviewoperations.tbpauseall.caption
msgid "&Pause all"
msgstr ""
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Kada datoteka postoji"
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Kada datoteka postoji"
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
#, fuzzy
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "Kopiraj v&rijeme i datum"
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Radi u pozadini (posebna veza)"
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Kada datoteka postoji"
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Visina"
#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Širina"
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
"Datoteka se nije pronašla, te nije mogoče overiti končnu kombinaciju datoteka:\n"
"%s\n"
"\n"
"Omogućite pristup datoteci te pritisnite „U redu“ kad budete spremni,\n"
"ili pritisnite „OTKAŽI“ za nastavak bez toga?\n"
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Otkaži brzi uvijet"
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Otkaži trenutnu radnju"
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Unesite naziv i tip datoteke, za ispušteni tekst "
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Vrsta zapisa za uvoz"
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Oštećeno:"
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Opće:"
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Nedostaje:"
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Greška čitanja:"
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Uspjeh:"
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Unesi zbir za provjeru i izaberi algoritam:"
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Provjeri zbir"
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Ukupno:"
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Međuspremnik isečaka ne sadrži ispravne podatke trake alata."
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr "Sve;Aktivni prozor;Lijevi prozor;Desni prozor;Operacije datoteka;Postavke;Mreža;Razno;Paralelni port;Ispis;Označavanje;Sigurnost;Međuspremnik;FTP;Navigacija;Pomoć;Prozor;Naredbeni redak;Alati;Prikaz;Korisnik;Kartice;Sortiranje; Dnevnik"
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr "Nasljeđeno sortiranje;Abecedno sortiranje"
#: ulng.rscolattr
msgid "Attr"
msgstr "Svojstvo"
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Datum"
#: ulng.rscolext
msgid "Ext"
msgstr "Nastavak"
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Ime"
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Veličina"
#: ulng.rsconfcolalign
msgid "Align"
msgstr "Podvuci"
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Naslov"
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "Izbriši"
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Sadržaj polja"
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Premjesti"
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Širina"
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Prilagodi kolonu"
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Uređivanje povezivanja datoteka"
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "Potvrdite naredbu i parametre"
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Kopiraj (%d) %s"
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Unos DC alatne trake"
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Unos TC alatne trake"
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "_Tekst je ispušten"
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "_HTML tekst je ispušten"
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "_Odbacio je promjenjen tekst"
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "_Odbacio je nepromjenjen text"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "_Odbacio je UnicodeUTF16 tekst"
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "_odbacio je UnicodeUTF8 tekst"
#: ulng.rsdiffadds
msgid " Adds: "
msgstr "Dodaje"
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr "Briše"
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "Obje datoteke su identične"
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr "Usklađivanje"
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr "Modificira"
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "&Prekini"
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "&Sve"
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "&Nastavi"
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "&Samostalno preimenuj izvorne datoteke"
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "&Otkaži"
#: ulng.rsdlgbuttoncompare
msgid "Compare &by content"
msgstr ""
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "&Nastavi"
#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "Kopiraj &u"
#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "Kopiraj u &sve"
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "Napusti& program"
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr ""
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Zanemari& sve"
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Ne"
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "&Ništa"
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&U redu"
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "drugo&"
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Prepiši"
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Prepiši &sve"
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "Prepiši sve &veće"
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Prepiši sve &starije"
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Prepiši sve &Manje"
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "P&reimenuj"
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "&Nastavi"
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "Po&novo pokušaj"
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "&Preskoči"
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Preskoči& sve"
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Da"
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Kopiraj datoteku(e)"
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "premjesti datoteku(e)"
#: ulng.rsdlgoppause
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "Stanaka&"
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "Početak&"
#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Zakazano"
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Brzina %s/s"
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Brzina %s/s, preostalo vrijeme %s"
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<bez oznake>"
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<nema uređaja>"
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Unutrašnji uređivač Double Commander-a."
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Idi na liniju:"
#: ulng.rseditgotolinetitle
msgctxt "ulng.rseditgotolinetitle"
msgid "Goto Line"
msgstr "Idi na liniju"
#: ulng.rseditnewfile
msgid "new.txt"
msgstr "novi.txt"
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Ime datoteke:"
#: ulng.rseditnewopen
msgid "Open file"
msgstr "Otvori datoteku"
#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Unazad"
#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Traži"
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "&Unaprijed"
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Zameni"
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "s vanjskim urednikom"
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "s unutrašnjim urednikom"
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Izvrši putem ljuske"
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Izvrši putem terminala i zatvori"
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Izvrši putem terminala i ostavi ga otvorenim"
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Lijevo:Desno;Aktivno;Neaktivno;Oba;Nijedno"
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Ne;Da"
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Izvoz iz DC"
#: ulng.rsfileopdirectoryexistsoptions
#, fuzzy
#| msgid "Ask;Overwrite;Copy into;Skip"
msgid "Ask;Merge;Skip"
msgstr "Pitaj;Prepiši;Kopiraj;Preskoči"
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Pitaj;Prepiši;Prepiši starije;Preskoči"
#: ulng.rsfileopsetpropertyerroroptions
msgctxt "ulng.rsfileopsetpropertyerroroptions"
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Pitaj;Ne postavljaj više;Zanemari greške"
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "Uvijet"
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Odredi obrazac"
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s stupanj(s)"
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "sve (neograničena dubina)"
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "samo trenutnu mapu"
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Mapa %s ne postoji. "
#: ulng.rsfindfound
msgctxt "ulng.rsfindfound"
msgid "Found: %d"
msgstr "Pronašao sam: %d"
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Kopiraj obrazac pretrage"
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Ime obrasca:"
#: ulng.rsfindscanned
msgctxt "ulng.rsfindscanned"
msgid "Scanned: %d"
msgstr "Pregledano je: %d"
#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Pregledam"
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Nađi datoteke"
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Vrijeme skeniranja:"
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Počni sa"
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "Slobodno je %s od %s bajta"
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s bajta je slobodno"
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Datum i vrijeme pristupa"
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Svojstva"
#: ulng.rsfunccomment
msgctxt "ulng.rsfunccomment"
msgid "Comment"
msgstr "Napomena"
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Veličina skladišta"
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Datum i vrijeme nastanka"
#: ulng.rsfuncext
msgid "Extension"
msgstr "Nastavak"
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Grupa"
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Promjena datuma/vremena"
#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Veza do"
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Datum i vrijeme izmene"
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Ime"
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Ime bez nastavka"
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Vlasnik"
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Putanja"
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Veličina"
#: ulng.rsfunctype
msgid "Type"
msgstr "Vrsta"
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Desila se greška pri stvaranju čvrste veze"
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "Nijedno;Ime, a-z;Ime, z-a;tip, a-z; tip, z-a;veličina 9-0;veličina 0-9;datum 9-0;datum 0-9"
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"Upozorenje: Pri vraćanju datoteke .hotlist iz ostave, trenutni spisak će biti izbrisan i zamjenjen uvezenim.\n"
"\n"
"Da li sigurno želite nastaviti?\n"
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Prozor umnožavanja i premještanja"
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Program za razlike"
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Uredite napomenu"
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Uređivač"
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Nađi datoteke"
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Glavni"
#: ulng.rshotkeycategorysyncdirs
msgid "Synchronize Directories"
msgstr ""
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Preglednik"
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr ""
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Odznači masku"
#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Označi masku"
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Unesi masku:"
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Prikaz stupca s tim imenom već postoji"
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr "Da biste promijenili trenutni prikaz stupaca za uređivanje, trenutačno uređivanje spremite, kopirajte, ili obrišite"
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Podesite prilagođene stupce"
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Unesite novi naziv prilagođenih stupaca"
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Radnje"
#: ulng.rsmnucontentdefault
msgid "<Default>"
msgstr ""
#: ulng.rsmnucontentoctal
msgid "Octal"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Odspajanje mrežnog pogona .."
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Uredi"
#: ulng.rsmnueject
msgid "Eject"
msgstr "Izbaci"
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Raspakirajte ovdje"
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Karta mrežnog pogona"
#: ulng.rsmnumount
msgid "Mount"
msgstr "Prikači"
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Nova"
#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Nema dostupnih uređaja"
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Otvori"
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Otvori sa"
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Drugo..."
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Zapakiranje datoteke u mapu"
#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Razvrstaj po"
#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Otkači"
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Prikaži"
#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Nalog:"
#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Dodatne odrednice za naredbenu liniju programa sažimanja:"
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"Izlazna datoteka CRC32 je neispravna:\n"
"„%s“\n"
"\n"
"Da li želite zadržati neispravnu datoteku?\n"
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Ne možete umnožavati i premještati u samu datoteku „%s“!"
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Ne možete izbrisati %s"
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Nisam uspio prijeći na Mapu [%s]."
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Želite li ukloniti sve kartice koje se ne koriste?"
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Kartica (%s) je zaključana. Želite li je uprkos tome zatvoriti?"
#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Da li ste sigurni da želite napustiti program?"
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "Datoteka %s je promijenjena. Želite li je kopirati unatrag?"
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "Ne mogu kopirati unatrag - želite li zadržati promijenjenu datoteku?"
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "Želite li Kopirati %d odabranih datoteka/mapa?"
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Da Kopiram odabrano „%s“?"
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Napravi novi tip datoteke \"%s datoteke\" >"
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Unesite naziv lokacije i datoteke za spremanje datoteke alatne trake DC-a "
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Prilagođena radnja"
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Želite li izbrisati djelomično umnoženu datoteku ?"
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Želite li izbrisati %d odabranih datoteka/kazala?"
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "Želite li premjestiti %d odabrane datoteke/kazala u smeće?"
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Želite li izbrisati odabrani „%s“?"
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Želite li premjestiti odabrano „%s“ u smeće?"
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Nisam uspio da premjestim „%s“ u smeće. Želite li je izbrisati?"
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Disk nije dostupan"
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr ""
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Unesite nastavak datoteke:"
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Unesite ime:"
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Unesite naziv i tip datoteke koju želite izraditi za proširenje\"%s\""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "Desila se CRC greška u podacima arhive"
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Podaci su oštećeni"
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Nisam uspio povezati se sa poslužiteljem „%s“"
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Nisam uspio kopirati datoteku %s u %s"
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Datoteka pod imenom „%s“ već postoji."
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Datum %s nije podržan"
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Mapa %s već postoji."
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Korisnik je prekinuo tekuću radnju"
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Desila se greška pri zatvaranju datoteke"
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Nisam uspio napraviti datoteku"
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Nema više datoteka u arhivi"
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Nisam uspio otvoriti postojeću datoteku"
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Desila se greška pri čitanju datoteke"
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Desila se greška pri upisu u datoteku"
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Nisam uspio napraviti Mapu %s."
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Veza nije ispravna"
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Nisam pronašao datoteke"
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Nema dovoljno memorije"
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Radnja nije podržana."
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Desila se greška u priručnom izborniku"
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Desila se greška prilikom učitavanja postavki"
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Postoji sintaksna greška u regularnom izrazu"
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Nisam uspio promijeniti naziv datoteke %s u %s"
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Nisam uspio sačuvati pridruživanje datoteka programima."
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Nisam uspio sačuvati datoteku"
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Nisam uspio postaviti svojstva datoteci „%s“"
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Nisam uspio postaviti datum i vreme datoteci „%s“"
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Nisam uspio postaviti vlasnika/udruženje datoteci %s“"
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "Nije moguće postaviti dozvole za \"%s\""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Prihvatna memorija je premala"
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Previše datoteka je izabrano za sažimanje"
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Nije poznat oblik željene datoteke za sažimanje"
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "Sigurni ste da želite ukloniti sve unose omiljenih kartica? (Ne postoji \"poništavanje\" ove radnje)?"
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Povucite ovdje druge unose"
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr "Unesite naziv za ovaj unos omiljenih kartica"
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "Spremanje novog unosa omiljene kartice"
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Broj uspješno izvezenih omiljenih kartica: %d on %d"
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr "Zadane dodatne postavke za spremanje povijesti mapa za nove Favourite kartice:"
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Broj uspješno uvezenih datoteka: %d on %d"
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Uvezene kartice sa naslijeđivanjem"
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr "Odaberite .tab datoteke za uvoz (može ih istovremeno biti više!)"
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr "Modifikacija Zadnje omiljene kartice još je spremljena. Želite li je spasiti prije nastavka?"
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Zadržite povijest pregledavanja pomoću omiljenih kartica:"
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Ime podizbornika"
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "To će učitati omiljene kartice: \"%s\""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr "Spremanje trenutačnih kartica preko postojećeg unosa omiljenih kartica"
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Datoteka %s je izmijenjena. Želite li ju sačuvati?"
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s bajta, %s"
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Prepiši:"
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Datoteka %s već postoji, Želite li ju prepisati?"
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Datotekom:"
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Nisam uspio pronaći datoteku „%s“."
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "U pogonu je radnja nad datotekama"
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Neke radnje nad datotekama nisu dovršene. Zatvaranje Double Commander-a može dovesti do gubljenja podataka."
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
#, fuzzy
#| msgid "File %s is marked as read-only. Delete it?"
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Datoteka %s je samo za čitanje. Želite li ju izbrisati?"
#: ulng.rsmsgfilereloadwarning
msgid "Are you sure you want to reload the current file and lose the changes?"
msgstr ""
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "Datoteka veličine „%s“ je prevelika za odredišni sistem datoteka."
#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "Datoteka %s postoji. Želite li ju prepisati?"
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Želite li pratiti simboličku vezu „%s“?"
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Odaberite format teksta za uvoz"
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Dodaj %d označenih mapa"
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Dodaj označeno Mapa: "
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Dodaj trenutno Mapa: "
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Naredba za izvršenje"
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr ""
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Postavke brzog spiska mapa"
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Da li ste sigurni da želite ukloniti sve unose iz brzog spiska mapa? (Opoziv ove radnje nije moguć!)"
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Ovo će izvršiti sledeću naredbu:"
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "Ovo je imenovano kao brzo Mapa."
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Ovo će izmjeniti radni okvir na sljedeću putanju:"
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "I neradni okvir će se izmeniti na sledeću putanju:"
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Desila se greška prilikom smeštaja stavki u ostavu..."
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Desila se greška prilikom izvoza stavki..."
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Izvezi sve!"
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Izvezi brzi spisak mapa - Izaberite stavke koje želite izvesti"
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Izvezi odabrano"
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Uvezi sve!"
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Uvezi brzi spisak mapa- Izaberite stavke koje želite uvesti"
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Uvezi izabrano"
#: ulng.rsmsghotdirjustpath
#, fuzzy
#| msgid "Path"
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Putanja"
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Pronađite datoteku „.hotlist“ za uvoz"
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Ime brzog mapa "
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Broj novih stavki: %d"
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "Nema ništa za izvoz!"
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "Putanja brzog mapa"
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Ponovno dodaj izabrano Mapa: "
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Ponovo dodaj trenutno Mapa: "
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Unesite putanju i ime datoteke brzog spiska mapa za oporavak"
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Naredba:"
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(kraj podizbornika)"
#: ulng.rsmsghotdirsimplemenu
#, fuzzy
#| msgid "Menu name:"
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Naziv izbornika:"
#: ulng.rsmsghotdirsimplename
#, fuzzy
#| msgid "Name:"
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Ime:"
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(razdvajač)"
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Ime podizbornika"
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Cilj podizbornika"
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Određuje želite li razvrstati radni okvir određenim redosledom poslije izmene mapa"
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Određuje ne želite li razvrstavati radni okvir određenim redosledom poslije izmene mapa"
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Neke radnje za izbor prikladne relativne staze, apsolutne, posebnog pogleda mapa, itd."
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Ukupan broj sačuvanih stavki: %d\n"
"\n"
"Ime ostave: %s\n"
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Ukupna broj izvezenih stavki: "
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"Želite li izbrisati sve činioce podizbornika [%s]?\n"
"Odgovorom NE ćete izbrisati samo ograničenje izbornika, ali će se zadržati činilac unutar podizbornika.\n"
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Unesite putanju i ime mesta za čuvanje datoteke brzog spiska mapa"
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Netačna je izlazna dužina datoteke : „%s“"
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Molim, ubacite sljedeći disk ili nešto slično.\n"
"\n"
"To će vam omogućiti da upišete sljedeću datoteku:\n"
"„%s“\n"
"\n"
"Broj bajta preostao za upis: %d\n"
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Greška u naredbenoj liniji"
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Neispravan naziv datoteke"
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Neispravan oblik u datoteci podešavanja"
#: ulng.rsmsginvalidhexnumber
msgid "Invalid hexadecimal number: \"%s\""
msgstr ""
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Neispravna putanja"
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Putanja %s sadrži nedozvoljene znakove"
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Ovo nije ispravan priključak."
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Ovaj priključak je napisan za Double Commander %s.%sNe može raditi sa Double Commander-om %s."
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Neispravan navod"
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Neispravan izbor."
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Učitavam spisak datoteka..."
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr ""
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr ""
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Kopiraj datoteku %s"
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Obriši datoteku %s"
#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Greška: "
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr ""
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Raspakiram datoteku %s"
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Podaci: "
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Napravi vezu %s"
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Napravi Mapa %s"
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Premjesti datoteku %s"
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Putanja do datoteke %s"
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Ukloni Mapa %s"
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Urađeno: "
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Napravi vezu %s"
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Provjeri ispravnost datoteke %s"
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Izbriši potpuno datoteku %s"
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Izbriši potpuno Mapa %s"
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Glavna lozinka"
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Unesite ponovo glavnu lozinku:"
#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Nova datoteka"
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "sljedeći sadržaj će biti izdvojen"
#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Nema datoteka"
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Nije izabrana nijedna datoteka."
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Nema dovoljno mesta u odredištu. Želite li nastaviti?"
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Nema dovoljno slobodnog mesta na odredišnom uređaju. Želite li pokušati ponovo?"
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Nisam uspio izbrisati datoteku %s"
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Nije primenjeno."
#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Ispod je pregled. Možete pomicati pokazivač te odabrati datoteke kako biste dobili stvarni izgled i dojam različitih postavki"
#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Lozinka:"
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Lozinke se razlikuju!"
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Unesite vašu lozinku:"
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Lozinka (vatreni zid):"
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Unesite ponovo lozinku za provjeru:"
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "Obriši %s"
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Datoteka „%s“ već postoji. Da je prepišem?"
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Naredba za izvršavanje problema (%s)"
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Naziv datoteke za ispisani tekst:"
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Molim, pobrinite se da ova datoteka bude dostupna. Pokušati ponovo?"
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Unesite novi odgovarajući naziv za ovu omiljenu karticu"
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Unesite novi naziv za ovaj izbornik"
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "Preimenovanje/premještanje %d označenih datoteka/kazala?"
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Preimenovanje /premještanje označeno „%s“?"
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Molim, ponovo pokrenite Double Commander-a da bi se primijenile izmjene"
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Odaberite vrstu datoteke za dodavanje njenog tipa\"%s\""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Označeno: %s od %s, datoteka: %d od %d, mapa: %d od %d"
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Odaberite izvršnu datoteku za"
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Molim, odaberite samo datoteke za proveru zbroja."
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Izaberite položaj sledećeg sadržaja/uređaja"
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Postavi oznaku uređaju"
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Posebna mapa"
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Dodajte putanju radnom okviru"
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Dodajte putanju iz neradnog okvira"
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Pregledaj i koristi odabranu putanju"
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Koristi varijablu okruženja..."
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Idi na posebnu putanju Double Commander-a..."
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Idi na varijablu okruženja..."
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Idi na drugu posebnu mapu Windows-a..."
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Idi na posebnu mapu sustava Windows (TC)..."
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Napravite u odnosu na hotdir putanju"
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Učini putanju apsolutnom"
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Napravite u odnosu na posebnu putanju Double Commander-a..."
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Napravite u odnosu na varijablu okruženja..."
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Napravite u odnosu na posebnu mapu sustava Windows (TC)..."
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Napravite u odnosu drugu posebnu mapu sustava Windows-a..."
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Koristi posebnu putanju Double Commander-a..."
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr ""
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Koristi drugu naročitu putanju Windows-a..."
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Koristi posebnu mapu sustava Windows-a (TC)..."
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr "Ova je kartica (%s) zaključana! Otvoriti mapu na drugoj kartici?"
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Preimenovanje kartice"
#: ulng.rsmsgtabrenameprompt
msgctxt "ulng.rsmsgtabrenameprompt"
msgid "New tab name:"
msgstr "Novi naziv kartice:"
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Putanja do odredišta:"
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Pogreška! Konfiguracijska datoteka TC se ne može pronaći:\n"
"%s\n"
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Pogreška! Izvršna konfiguracija TC se ne može pronaći:\n"
"%s\n"
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Pogreška! ! TC još uvijek radi, isti bi trebao biti zatvoren za ovu operaciju.\n"
"Zatvorite ga i pritisnite uredu, ili pritisnite otkaži da biste prekinuli.\n"
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Pogreška! Nije moguće pronaći željenu željenu TC izlaznu mapu alatne trake:\n"
"%s\n"
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Unesite mjesto i naziv datoteke za spremanje TC Toolbar datoteke"
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr ""
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr "Tip odabrane datoteke nije među priznatim vrstama datoteka"
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "Pronađite \" alatnu traku \" datoteku za uvoz"
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "Pronađite \".BAR\" datoteku za uvoz"
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Unesite mjesto i naziv datoteke alatne trake za vraćanje"
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Spremljeno!\n"
"Ime datoteke alatne trake: %s\n"
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Odabrano je previše datoteka."
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Neodređeno"
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""
#: ulng.rsmsgurl
msgid "URL:"
msgstr "Adresa:"
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr "bez tipa datoteke"
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr "bez imena"
#: ulng.rsmsgusername
msgid "User name:"
msgstr "Korisničko ime:"
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "korisničko ime (vatreni zid):"
#: ulng.rsmsgverify
msgid "VERIFICATION:"
msgstr ""
#: ulng.rsmsgverifywrong
msgid "The target file is corrupted, checksum mismatch!"
msgstr ""
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Oznaka uređaja:"
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Unesite veličinu uređaja:"
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "Želite li potpuno izbrisati %d označenih datoteka/kazala?"
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Želite li potpuno izbrisati odabrano „%s“?"
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr ""
#: ulng.rsmsgwrongpasswordtryagain
msgid ""
"Wrong password!\n"
"Please try again!\n"
msgstr ""
#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Bez izmena;VELIKA SLOVA;mala slova;Prvi znak veliki;Prvi Znak Svake Riječi Veliki;"
#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsopenwithdevelopment
msgid "Development"
msgstr ""
#: ulng.rsopenwitheducation
msgid "Education"
msgstr ""
#: ulng.rsopenwithgames
msgid "Games"
msgstr ""
#: ulng.rsopenwithgraphics
#, fuzzy
msgctxt "ulng.rsopenwithgraphics"
msgid "Graphics"
msgstr "Grafika"
#: ulng.rsopenwithmultimedia
msgid "Multimedia"
msgstr ""
#: ulng.rsopenwithnetwork
#, fuzzy
msgctxt "ulng.rsopenwithnetwork"
msgid "Network"
msgstr "Mreža"
#: ulng.rsopenwithoffice
msgid "Office"
msgstr ""
#: ulng.rsopenwithother
#, fuzzy
msgctxt "ulng.rsopenwithother"
msgid "Other"
msgstr "Drugo"
#: ulng.rsopenwithscience
msgid "Science"
msgstr ""
#: ulng.rsopenwithsettings
msgid "Settings"
msgstr ""
#: ulng.rsopenwithsystem
#, fuzzy
msgctxt "ulng.rsopenwithsystem"
msgid "System"
msgstr "Sistem"
#: ulng.rsopenwithutility
msgid "Accessories"
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Obustavljeno"
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Izračunavam zbirnu provjeru"
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Računam zbirnu provjeru u „%s“"
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "Računam zbirnu proveru „%s“"
#: ulng.rsopercalculatingstatictics
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "Računam"
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Računam „%s“"
#: ulng.rsopercombining
msgid "Joining"
msgstr "Spajam"
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Spajam datoteke iz „%s“ na „%s“"
#: ulng.rsopercopying
msgid "Copying"
msgstr "Kopiram"
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Kopiram iz „%s“ u „%s“ "
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Kopiram „%s“ na „%s“"
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Stvaram Mapa"
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Stvaram Mapa „%s“"
#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "Brišem"
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Brišem iz „%s“"
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Brišem „%s“"
#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Izvršavam"
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Izvršavam „%s“"
#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Izdvajam"
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Izdvajam iz „%s“ u „%s“"
#: ulng.rsoperfinished
msgid "Finished"
msgstr "Gotovo"
#: ulng.rsoperlisting
msgid "Listing"
msgstr "Listam"
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Listam „%s“"
#: ulng.rsopermoving
msgid "Moving"
msgstr "Premještam"
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Premještam iz „%s“ u „%s“"
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Premještam „%s“ na „%s“"
#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Nije pokrenuto"
#: ulng.rsoperpacking
msgid "Packing"
msgstr "Sažimam"
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Sažimam iz „%s“ u „%s“"
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Sažimam „%s“ u „%s“"
#: ulng.rsoperpaused
msgid "Paused"
msgstr "Stanka"
#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Stanka"
#: ulng.rsoperrunning
msgid "Running"
msgstr "Pokrenuto"
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Postavljam svojstva"
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Postavljam svojstva u „%s“"
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Postavljam svojstva datoteci „%s“"
#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Dijeljenje"
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Djelim „%s“ na „%s“"
#: ulng.rsoperstarting
msgid "Starting"
msgstr "Pokrećem"
#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Zaustavljeno"
#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Prekidam"
#: ulng.rsopertesting
msgid "Testing"
msgstr "Probanje"
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Probam u „%s“"
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Probam „%s“"
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Provjeravam zbir"
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Provjeravam zbir u „%s“"
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "Provjeravam zbir „%s“"
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Čekam na pristup izvornoj datoteci"
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Čekam na odziv korisnika"
#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Brisanje"
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Brisanje u „%s“"
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Brisanje „%s“"
#: ulng.rsoperworking
msgid "Working"
msgstr "Rad"
#: ulng.rsoptaddfrommainpanel
#, fuzzy
#| msgid "Add at beginning;Add at the end;Smart add"
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "dodaj na početak;dodaj na kraj;pametno dodavanje"
#: ulng.rsoptarchiveconfiguresavetochange
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
msgstr ""
#: ulng.rsoptarchiveradditonalcmd
msgid "Mode dependent, additional command"
msgstr ""
#: ulng.rsoptarchiveraddonlynotempty
msgid "Add if it is non-empty"
msgstr ""
#: ulng.rsoptarchiverarchivel
msgid "Archive File (long name)"
msgstr ""
#: ulng.rsoptarchiverarchiver
msgid "Select archiver executable"
msgstr ""
#: ulng.rsoptarchiverarchives
msgid "Archive file (short name)"
msgstr ""
#: ulng.rsoptarchiverchangeencoding
msgid "Change Archiver Listing Encoding"
msgstr ""
#: ulng.rsoptarchiverconfirmdelete
msgid "Are you sure you want to delete: %s"
msgstr ""
#: ulng.rsoptarchiverdefaultexportfilename
msgid "Exported Archiver Configuration"
msgstr ""
#: ulng.rsoptarchivererrorlevel
msgid "errorlevel"
msgstr ""
#: ulng.rsoptarchiverexportcaption
msgid "Export archiver configuration"
msgstr ""
#: ulng.rsoptarchiverexportdone
msgid "Exportation of %d elements to file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverexportprompt
msgid "Select the one(s) you want to export"
msgstr ""
#: ulng.rsoptarchiverfilelistl
msgid "Filelist (long names)"
msgstr ""
#: ulng.rsoptarchiverfilelists
msgid "Filelist (short names)"
msgstr ""
#: ulng.rsoptarchiverimportcaption
msgid "Import archiver configuration"
msgstr ""
#: ulng.rsoptarchiverimportdone
msgid "Importation of %d elements from file \"%s\" completed."
msgstr ""
#: ulng.rsoptarchiverimportfile
msgid "Select the file to import archiver configuration(s)"
msgstr ""
#: ulng.rsoptarchiverimportprompt
msgid "Select the one(s) you want to import"
msgstr ""
#: ulng.rsoptarchiverjustname
msgid "Use name only, without path"
msgstr ""
#: ulng.rsoptarchiverjustpath
msgid "Use path only, without name"
msgstr ""
#: ulng.rsoptarchiverprograml
msgid "Archive Program (long name)"
msgstr ""
#: ulng.rsoptarchiverprograms
msgid "Archive Program (short name)"
msgstr ""
#: ulng.rsoptarchiverquoteall
msgid "Quote all names"
msgstr ""
#: ulng.rsoptarchiverquotewithspace
msgid "Quote names with spaces"
msgstr ""
#: ulng.rsoptarchiversinglefprocess
msgid "Single filename to process"
msgstr ""
#: ulng.rsoptarchivertargetsubdir
msgid "Target subdirecory"
msgstr ""
#: ulng.rsoptarchiveruseansi
msgid "Use ANSI encoding"
msgstr ""
#: ulng.rsoptarchiveruseutf8
msgid "Use UTF8 encoding"
msgstr ""
#: ulng.rsoptarchiverwheretosave
msgid "Enter location and filename where to save archiver configuration"
msgstr ""
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Naziv vrste arhive:"
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Pridruži priključak „%s“ sa:"
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Prvi;posljednji;"
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Klasičan, naslijeđeni redoslijed; Abecedni redoslijed"
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Aktivna okvirna ploča na lijevoj strani,neaktivna na desnoj strani;Lijeva okvirna ploča na lijevoj strani,desna na desnoj"
#: ulng.rsoptdisable
msgid "Disable"
msgstr "Onemogući"
#: ulng.rsoptenable
msgctxt "ulng.rsoptenable"
msgid "Enable"
msgstr "Omogući"
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Unesite nastavak"
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "Dodaj na početak;dodaj na kraj;abecedni redoslijed"
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "Odvojen prozor;umanjen odvojen prozor;table radnji"
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr "pokretna točka;B;K;M;G"
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Prečica %s za „cm_Delete“ će biti prijavljena, tako da može biti upotrijebljena za vraćanje ove postavke."
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Dodaj prečicu za %s"
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Dodaj prečicu"
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Nisam uspio postaviti prečicu"
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Izmeni prečicu"
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Naredba"
#: ulng.rsopthotkeysdeletetrashcanoverrides
#, fuzzy,badformat
msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides"
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Prečica za „cm_Delete“ ima odrednicu koja zaobilazi ove postavke. Da li želite izmijeniti odrednicu i koristiti opće postavke?"
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists"
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Prečici %s za „cm_Delete“ treba se promijeniti odrednica kako bi se slagala sa prečicom %s. Želite li ju promijeniti?"
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Opis"
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Uredi prečicu za %s"
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Ispravi odrednicu"
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Prečica"
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Prečice"
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<ništa>"
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Odrednice"
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Postavi prečicu za brisanje datoteke"
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
#, fuzzy,badformat
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Da bi ove postavke radile sa prečicom %s, prečica mora biti dodijeljena „cm_Delete“, ali je već dodjeljena za %s. Želite li ju promijeniti?"
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Prečica %s za „cm_Delete“ je niz za koji gumb Shift ne može biti dodjeljeno. Najvjerovatnije neće raditi."
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Prečica je u upotrebi"
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "Prečica %s već postoji."
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Da li je dodjeliti %s?"
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "koristi se za %s u %s"
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "koristi za ovu naredbu sa drugačijim odrednicama"
#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Programi za sažimanje"
#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Samoosvježavanje"
#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Ponašanje"
#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr "Sažeto"
#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Boje"
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Stupci"
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Postavke"
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Prilagođeni stupci"
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Brzi spisak mapa"
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Prevuci i spusti"
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Gumb za spisak uređaja"
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Omiljene kartice"
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Povezivanje dodatnih datoteka"
#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Pridruživanje datoteka"
#: ulng.rsoptionseditorfilenewfiletypes
#, fuzzy
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Novo"
#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Radnje nad datotekama"
#: ulng.rsoptionseditorfilepanels
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Ploče s datotekama"
#: ulng.rsoptionseditorfilesearch
#, fuzzy
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Pretraga datoteka"
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Pregledi datoteka"
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Vrste datoteka"
#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Kartice datoteka"
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Posebne kartice mapa"
#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Oblik slova"
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Isticanje"
#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Prečice"
#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Ikonice"
#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Zanemari spisak"
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Tasteri"
#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Jezik"
#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr "Raspored"
#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Dnevnik"
#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Razno"
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Miš"
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Priključci"
#: ulng.rsoptionseditorquicksearch
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Brza pretraga/uvjet"
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Traka alata"
#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Alatke"
#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Napomene"
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr ""
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr ""
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Ništa;Naredbena linija;Brza pretraga;Brzi uvjet"
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Lijevo gumb;Desno gumb;"
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "na vrhu spiska datoteka:poslje mapa (ako se kazala prikažiu prije datoteka); na određenom položaju;na dnu spiska datoteka"
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Priključak %s je već dodjeljen sljedećim nastavcima:"
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Radni"
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Ime datoteke"
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Ime"
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Prijavljen za"
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "&Osetljivo;&Neosjetljivo"
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Datoteke;&Kazala;Datoteke i Kazala"
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "&Skriva ploču uvjeta kada on nije u fokusu;Zadržava promjene prilagodbi postavki za drugi period rada"
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "neosjetljivo na veličinu slova;prema postavkama lokaliteta (aAbBvV);prvo velika, pa mala slova (ABVabv)"
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "rasporedi po imenu i prikaži prvu;rasporedi kao datoteke i prikaži prvu;rasporedi kao datoteke"
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Abecedno, vodeći računa o akcentima;Prirodan raspored: abesedno i brojevno"
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Vrh;Dno"
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "Razdvajač&;&unutrašnja naredba;&Vanjska naredba;Izbornik&"
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "Naslijeđe DC - Kopija (x) ime datoteke.tip;Windows - ime datoteke (x).tip;Drugo - ime datoteke(x).tip"
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "ne mijenjaj položaj;koristi iste postavke za nove datoteke;na položaju po rasporedu"
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Datoteka: %d, mape: %d"
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Nisam uspio promijeniti prava pristupa za „%s“"
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Nisam uspio promijeniti vlasnika „%s“"
#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "Datoteka"
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Mapa"
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Imenovana cev"
#: ulng.rspropssocket
msgid "Socket"
msgstr "Utičnica"
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Posebni blok uređaj"
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Posebni znakovni uređaj"
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Simbolička veza"
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Nepoznata vrsta"
#: ulng.rssearchresult
msgid "Search result"
msgstr "Izlazi pretrage"
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr ""
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<neimenovani obrazac>"
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Izaberite Mapa"
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "&Prikaži pomoć za %s"
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Sve"
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Kategorija"
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Kolona"
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Naredba"
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Ime datoteke"
#: ulng.rssimplewordfiles
msgid "files"
msgstr "datoteke"
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Parametri"
#: ulng.rssimplewordresult
msgid "Result"
msgstr "Rezultat"
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "Radna mapa"
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bajtova"
#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr "Gigabajta"
#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr "Kilobajta"
#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr "Megabajta"
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabajta"
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Datoteka: %d, mapa: %d, Veličina: %s (%s bajta)"
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Nisam uspio napraviti ciljnu Mapu."
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Oblik veličine datoteke nije ispravan."
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Nisam uspio podijeliti datoteku."
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Broj delova je više od 100! Želite li nastaviti?"
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Izaberite Mapa:"
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr ""
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr ""
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Greška prilikom stvaranja simboličke veze."
#: ulng.rssyndefaulttext
msgctxt "ulng.rssyndefaulttext"
msgid "Default text"
msgstr "Podrazumijevani tekst"
#: ulng.rssynlangplaintext
msgctxt "ulng.rssynlangplaintext"
msgid "Plain text"
msgstr "Običan tekst"
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "Nemoj ništa učiniti; Zatvori karticu;Pristupi omiljenoj kartici; Izbornik skočnih prozorčića"
#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Dan(i)"
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Sat(i)"
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minut(i)"
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Mesec(i)"
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Sekunda (e)"
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Nedjelja(e)"
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Godina(e)"
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Preimenovanje omiljene kartice"
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Preimenovanje podizbornika omiljene kartice"
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Usporedba"
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Uređivač"
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Desila se greška pri otvaranju programa za razlike"
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Desila se greška pri otvaranju uređivača"
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Desila se greška pri otvaranju terminala"
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Desila se greška pri otvaranju preglednika"
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Terminal"
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Preglednik"
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Prijavite grešku lovcu bagova sa opisom radnje koju ste primenjivali na sljedeću datoteku: %s. Pritisnite %s za nastavak ili %s za izlazak iz programa."
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "Obje ploče, od aktivne do neaktivne"
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "Oba ploče, s lijeva na desno"
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Putanja do ploče"
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "Unesite svako ime u zagradama ili što god želite"
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Samo naziv datoteke, bez tipa"
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "Punu naziv datoteke (putanja+ime datoteke)"
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr "Pomoć s \"%\" varijablama"
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr "Tražit će od korisnika zahtjev da unese parametar sa zadanom predloženom vrijednošću"
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Lijeva Ploča"
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "Privremeni naziv datoteke sa popisom datoteka"
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "Privremeni naziv datoteke sa popisom punih imena datoteka (putanja+ime datoteke)"
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "Privremeni naziv datoteke sa popisom imena datoteka s relativnom putanjom"
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Samo naziv tipa datoteke"
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Samo ime datoteke"
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Drugi primjer onoga što je moguće"
#: ulng.rsvarpath
#, fuzzy
#| msgid "Path, with ending delimiter"
msgid "Path, without ending delimiter"
msgstr "Putanja, s završnim graničnikom"
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr "Odavde do kraja linije, pokazatelj postotka varijable je \"#\" znak"
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr "Vraćanje postotka znaka "
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr "Odavde do kraja linije, pokazatelj vraćanja postotka varijable je \"%\" znak"
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "Prebacite svaki naziv s \"-a \" ili što želite"
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "%[Upozorenje korisniku za parametar; Predložena zadana vrijednost]"
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "Naziv datoteke s relativnom putanjom"
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Desns ploča"
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "Puna putanja druge odabrane datoteke na desnoj ploči"
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "Prikaži naredbu prije izvršavanja"
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "%[Jednostavna poruka]"
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "Pokazat će se jednostavna poruka"
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Aktivna ploča (izvor)"
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Neaktivna plpča (cilj)"
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr "Ovdje će se citirati nazivi datoteka (zadano)"
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "Naredbe će se izvršiti u terminalu, nakon kojih će ostati otvoren"
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr "Putanje će biti napisane s krajnjim graničnicima"
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "Ovdje se neće citirati nazivi datoteka"
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "Naredbe će se izvršiti u terminalu, nakon kojih će se isti zatvoriti"
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr "Putanje neće biti napisane s krajnjim graničnicima (zadano)"
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "Mreža"
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Unutarnji preglednik Double Commander-a."
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "loša kvaliteta"
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Šifriranje"
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Vrsta slike"
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Nova veličina"
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "Nisam uspio pronaći %s."
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "s vanjskim preglednikom"
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "s unutarnjim preglednikom"
#: ulng.rsxreplacements
#, fuzzy,badformat
msgid "Number of replacement: %d"
msgstr "Broj zamjene"
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "Nije bilo zamjene"